US Pat. No. 10,116,312

CONFIGURABLE GATE ARRAY BASED ON THREE-DIMENSIONAL WRITABLE MEMORY

HangZhou HaiCun Informati...

1. A configurable gate array, comprising:at least a configurable logic element formed on a semiconductor substrate, wherein said configurable logic element selectively realizes a logic function from a logic library; and
at least a configurable computing element, wherein said configurable computing element comprises a first three-dimensional writable memory (3D-W) array stacked above said semiconductor substrate, said first 3D-W array is electrically programmable and can be loaded with a first look-up table (LUT) for a first math function.

US Pat. No. 10,116,290

RF FRONTEND HAVING A WIDEBAND MM WAVE FREQUENCY DOUBLER

SPEEDLINK TECHNOLOGY INC....

1. A radio frequency (RF) integrated circuit, comprising:a RF transceiver to transmit and receive RF signals;
a frequency synthesizer coupled to the RF transceiver to perform frequency synthesis,
wherein the frequency synthesizer includes:
a local oscillator (LO) to generate a LO signal,
a frequency doubler circuit coupled to the LO to double a frequency of the LO signal, the frequency doubler circuit including:
a first field effect transistor having a first gate, a first source, and a first drain; and
a second field effect transistor having a second gate, a second source, and a second drain, wherein the first gate of the first field effect transistor and the second source of the second field effect transistor are driven by an input signal in a first phase, wherein the first source of the first field effect transistor and the second gate of the second field effect transistor are driven by the input signal in a second phase, wherein the first field effect transistor and the second field effect transistor are caused to switch based on the first phase and the second phase of the input signal respectively to generate an output signal at the first drain and the second drain having a frequency that is approximately double of the input signal.

US Pat. No. 10,116,227

SYSTEM AND METHOD FOR PULSE DRIVING FOR REDUCING NUMBER OF OPTICAL FIBERS

Delta Electronics (Shangh...

1. A pulse driving system for driving a multi-level converter which comprises at least M power switches, where M?2, wherein the pulse driving system comprises:a main control module generating encoding information which contains driving information according to sampling information;
a local control module electrically coupled to the multi-level converter to output control signals to the multi-level converter so as to control on and off of the at least M power switches in the multi-level converter; and
a first optical fiber coupled to the main control module and the local control module, wherein the local control module receives the encoding information output from the main control module via the first optical fiber and generates the control signals according to the encoding information;
wherein the main control module comprises:
a data processing unit receiving the sampling information of the multi-level converter and outputting the driving information by a control algorithm;
a first control unit electrically coupled with the data processing unit to receive and encode the driving information and output the encoding information.

US Pat. No. 10,116,223

SWITCHING POWER SUPPLY APPARATUS CAPABLE OF ACHIEVING SOFT SWITCHING OPERATION

COSEL CO., LTD., Toyama ...

1. A switching power supply apparatus comprising:a primary-side circuit and a secondary-side circuit, the primary-side circuit being a synchronous rectification step-up or step-down chopper circuit configured by a series circuit including a main switching element and a choke coil connected in parallel with an input power supply and by a series circuit including a buffer capacitor and a commutation element connected in parallel with the choke coil, and the secondary-side circuit being configured by a series circuit including a second winding of the choke coil, a rectifying element and an output capacitor, an output electric power being obtained from both ends of the output capacitor; and
a switching control circuit including a first deadtime generation circuit and a second deadtime generation circuit configured to complementarily turn the main switching element and the commutation element ON and OFF with a predetermined switching frequency by providing a deadtime,
wherein the first deadtime generation circuit in the switching control circuit is a delay circuit for delaying an ON-duty of the main switching element by a predetermined time, and controls ON and OFF of the main switching element by outputting a control signal based on a PWM signal which is generated from a pulse signal of a switching frequency oscillation circuit which determines the predetermined switching frequency to generate a predetermined first deadtime,
the second deadtime generation circuit synchronizes frequencies of the switching frequency oscillation circuit and an oscillation circuit in the second deadtime generation circuit, and outputs a pulse signal from the switching frequency oscillation circuit which determines the predetermined switching frequency immediately before a pulse signal of the oscillation circuit in the second deadtime generation circuit to generate a predetermined second deadtime, and
the choke coil has an inductance set to have a value so that a current flowing through the choke coil flows in both of a positive direction and a negative direction in one cycle of switching when an output current of the switching power supply apparatus is equal to or smaller than a predetermined rated value.

US Pat. No. 10,116,162

NEAR FIELD TRANSMITTERS WITH HARMONIC FILTERS FOR WIRELESS POWER CHARGING

Energous Corporation, Sa...

1. A near-field transmitter comprising:a plurality of unit cells configured to radiate radio frequency (RF) energy signals, each unit cell in the plurality of unit cells including:
a metal layer having an interior perimeter that surrounds an aperture defined by the metal layer;
a patch antenna configured to radiate an RF energy signal having a plurality of different harmonic frequencies including a center frequency, wherein:
a perimeter of the patch antenna has a separation from the interior perimeter of the metal layer, and
a receiving electronic device includes at least one antenna that is tuned to receive an RF energy signal having the center frequency; and
a harmonic RF filter positioned on at least the patch antenna, the harmonic RF filter being configured to suppress radiation of any of the plurality of different harmonic frequencies, except for the center frequency, when the RF energy signal is radiated by the patch antenna and the RF energy signal interacts with the harmonic RF filter.

US Pat. No. 10,116,144

WIRELESS POWER TRANSFER APPARATUS USING ENCLOSURES WITH ENHANCED MAGNETIC FEATURES AND METHODS OF FABRICATING THE SAME

Eaton Intelligent Power L...

1. An apparatus comprising:an enclosure configured to be installed in an equipment rack and comprising a wall;
a coil assembly in the enclosure and comprising a magnetic core and a coil disposed on the magnetic core, the magnetic core positioned adjacent the wall such that a main flux path in the magnetic core is through at least one portion of the wall having a magnetic permeability greater than air, wherein the at least one portion of the wall comprises a region with a first magnetic permeability embedded in another component of the wall having a second magnetic permeability, and wherein the magnetic core is positioned adjacent the region such that the main flux path is directed through the region; and
a wireless power receiver circuit in the enclosure, coupled to the coil and configured to be connected to at least one power bus in the equipment rack.

US Pat. No. 10,116,143

INTEGRATED ANTENNA ARRAYS FOR WIRELESS POWER TRANSMISSION

Energous Corporation, Sa...

1. An antenna for transmitting focused radio-frequency (RF) waves towards a receiver to provide wireless power thereto, the antenna comprising:an integrated antenna structure, wherein the integrated antenna structure:
is on a multi-layer printed circuit board (PCB);
includes a first group of unit cells with a planar inverted F-antenna (PIFA) transmitting element and a second group of unit cells without a transmitting element, and each respective unit cell of the first and second groups of unit cells is made of an artificial magnetic conductor (AMC) material, wherein:
a ground element of the PIFA transmitting element is formed in a bottom layer of the multi-layer printed circuit board and the PIFA transmitting element is formed on a top layer of the multi-layer PCB,
a metal layer associated with the AMC material is formed on a first inner layer of the multi-layer PCB that is between the top and bottom layers, and
a backing metal layer associated with the AMC material is formed on a second inner layer of the multi-layer PCB that is between the top and bottom layers; and
is configured to transmit, via the transmitting element, RF wireless power waves having a wavelength (?) to a wireless power receiver, and
wherein the second group of unit cells without the transmitting element surrounds at least four sides of the first group of unit cells on the multi-layer printed circuit board and is configured to reflect at least some of the RF wireless power towards the wireless power receiver.

US Pat. No. 10,116,125

COLD SHRINKABLE TERMINATION, COLD SHRINKABLE TERMINATION ASSEMBLY AND METHOD FOR MANUFACTURING THE SAME

Tyco Electronics (Shangha...

1. A cold shrinkable termination for an electric power cable:(a) the electric power cable having:
(1) a conductor core having an exposed segment and an unexposed segment,
(2) an insulation layer having an exposed segment and an unexposed segment covering the unexposed segment of conductor core,
(3) a semi-conductive shield layer having an exposed segment and an unexposed segment covering the unexposed segment of the insulation layer,
(4) a metal shield layer having an exposed segment and an unexposed segment covering the unexposed segment of the semi-conductive shield layer, and
(5) an outer protection layer covering the unexposed segment of the metal shield layer, and
(b) the cold shrinkable termination
(1) comprising:
(i) an insulation tube sized to form a gap between the insulation tube and that segment of the electric power cable where the conductor core, the insulation layer, the semi-conductive shield layer, and the metal shield layer of the electric power cable are exposed when the cold shrinkable termination is mounted on the electric power cable, and
(ii) a stress control glue coated on an inner wall of the insulation tube, the stress control glue having a dielectric constant within a range of 5 to 100, and
(2) adapted to position the stress control glue at the gap between the insulation tube and the exposed segment of the electric power cable when the cold shrinkable termination is mounted on the electric power cable.

US Pat. No. 10,116,068

BONDING BLOCK WITH ROTATABLE COMPRESSION GROUND CONTACT

ANTRONIX INC., Cranbury,...

1. A bonding block, comprising:a block body;
a threaded hole defined in the block body and extending in an axial direction;
a ground wire channel that extends through the threaded hole in a direction perpendicular to the axial direction;
and
a screw assembly configured to be insertable into the threaded hole, the screw assembly comprising a screw and a contacting element, wherein the contacting element includes a pair of attachment arms that form a first contact surface of the contacting element and each of the pair of the attachment arms includes a forked portion that attaches the contacting element to a non-threaded portion of the screw so that the contacting element is able to rotate freely relative to the screw,
wherein the block body includes a substantially flat second contact surface positioned at a bottom of the threaded hole and the ground wire channel, and
wherein the screw assembly is configured to compress a ground wire extending through the ground wire channel between the first contact surface and the second contact surface as the screw is tightened in the threaded hole.

US Pat. No. 10,115,998

CATHODE ADDITIVES TO PROVIDE AN EXCESS LITHIUM SOURCE FOR LITHIUM ION BATTERIES

SINODE SYSTEMS, INC., Ch...

1. An electrochemical cell, comprising:a negative electrode comprising carbon, a negative electrode active material comprising silicon, and graphene;
a positive electrode comprising LiNixCoyAlzO2, where x, y, and z are greater than 0 and x+y+z=1;
an ionically conductive electrolyte located between the positive electrode and the negative electrode; and
a lithiation agent located in at least one of the positive electrode and the negative electrode, the lithiation agent comprising LiN3 or Li5FeO4,
wherein during operation of the electrochemical cell, lithium from the lithiation agent irreversibly reacts with the negative electrode active material to form a lithium compound in and/or on the negative electrode.

US Pat. No. 10,115,988

HEALTH MONITORING OF AN ELECTROCHEMICAL CELL STACK

Nuvera Fuel Cells, LLC, ...

1. An electrochemical cell system, comprising:an electrochemical cell;
a voltage measurement device adapted to measure a voltage across the electrochemical cell;
pressure transmitters connected to an inlet gas channel and an outlet gas channel, wherein the pressure transmitters are configured to measure the pressure at the inlet (Pin ) and at the outlet (Pout ); and
a control unit configured to process voltage signals received from the voltage measurement device, wherein the control unit is configured to:
conduct a linear current sweep across the electrochemical cell;
generate a voltage-current (V-I) curve based on the linear current sweep;
generate a baseline V-I curve of the electrochemical cell using a predetermined ratio of pressures of Pin and Pout and to calculate a slope of the baseline V-I curve;
generate an aged V-I curve of the electrochemical cell at any time point during operation of the electrochemical cell and to calculate a slope of the aged V-I curve;
to calculate a difference in value between the slopes of the baseline V-I curve and the aged V-I curve;
compare the difference in value between the slopes of the baseline V-I curve and the aged V-I curve to a preset reference value; and
automatically initiate at least one corrective action if the difference in value between the slopes of the baseline V-I curve and the aged V-I curve is greater than the preset reference value,
wherein the corrective action is chosen from alerting an operator and initiating a preventative action.

US Pat. No. 10,115,984

INTEGRATED RECIRCULATING OPEN CATHODE FUEL CELL SYSTEM

ALTERGY SYSTEMS, Folsom,...

1. A fuel cell system, comprising:a fuel cell stack;
a fan;
the fan configured to provide process air to supply oxidizer to said fuel cell stack;
an air duct coupled to said fan and said fuel cell stack;
an electrical service load coupled to the fuel cell stack, said electrical service load configured for receiving electrical power generated from reactions within the fuel cell stack; and
wherein said air duct is configured to direct the flow of air to said fuel cell stack to provide cooling air to said fuel cell stack;
wherein the air duct is configured such that said air flow simultaneously provides cooling air and process oxidizer to said fuel cell stack.

US Pat. No. 10,115,983

FLOW BATTERY WITH MANIFOLD PASSAGE THAT VARIES IN CROSS-SECTION

UNITED TECHNOLOGIES CORPO...

1. A flow battery comprising:a cell stack including electrochemically active cells and manifolds defining common manifold passages in fluid communication with the electrochemically active cells;
a supply/storage system external of the cell stack, the supply/storage system including at least one vessel fluidly connected with respective common manifold passages; and
fluid electrolytes in the supply/storage system, at least one of the fluid electrolytes being an ionically-conductive fluid,
the manifolds extending in a length direction through the cell stack, and the common manifold passages including a common manifold passage P varying in cross-section along the length direction, and the common manifold passage P includes a removable insert that defines the varying cross-section.

US Pat. No. 10,115,976

TERMINAL PLATE FOR FUEL CELL, MANUFACTURING METHOD OF TERMINAL PLATE FOR FUEL CELL, AND FUEL CELL

Toyota Jidosha Kabushiki ...

1. A terminal plate for a fuel cell, comprising:a first metal plate being electrically conductive and configured to have a terminal element;
a second metal plate and a third metal plate having higher corrosion resistance than the first metal plate and placed on a surface and a rear face of the first metal plate, the second metal plate and the third metal plate having outer peripheral areas extended more outward than an outer periphery of the first metal plate; and
an elastic seal member bonded with the outer peripheral areas of the second and the third metal plates to seal outer peripheries of the first, the second and the third metal plates,
wherein each of the metal plates has supply through holes for supplying a fuel gas, an oxidizing gas and cooling water and discharge through holes for discharging the fuel gas, the oxidizing gas and the cooling water, in its outer peripheral area,
the first metal plate has plate through holes having diameters larger than diameters of the supply through holes and the discharge through holes,
the second and the third metal plates respectively have plate through holes having diameters larger than the diameters of the supply through holes and the discharge through holes but smaller than the diameters of the plate through holes in the first metal plate, and
the elastic seal member is bonded with hole peripheral areas of the plate through holes in the opposed second and third metal plates to form the supply through holes and the discharge through holes.

US Pat. No. 10,115,935

CORROSION RESISTANT TUBE FOR SECONDARY BATTERY AND SECONDARY BATTERY COMPRISING THE SAME

LG CHEM, LTD., Seoul (KR...

1. A secondary battery, comprising:(i) an electrode assembly comprising: a positive electrode, a negative electrode and a separator;
(ii) a metal can,
wherein the electrode assembly is built in the metal can; and
(iii) a corrosion resistant tube, consisting of one layer, said layer comprising:
a volatile corrosion inhibitor,
wherein the volatile corrosion inhibitor comprises NaNO2 and a polymer resin; and
a base resin, wherein the base resin is a single material selected from the group consisting of polyethylene terephthalate (PET), nylon and polybutylene terephthalate (PBT), or a mixture of two or more types among these;
wherein the corrosion resistant tube is coated on an outer circumference surface of the metal can,
wherein the volatile corrosion inhibitor is included in 2 to 10 parts by weight based on 100 parts by weight of the base resin.

US Pat. No. 10,115,908

IMIDAZOLE[4,5-F][1,10]PHENANTHROLINE DERIVATIVES, METHOD OF PREPARING THE SAME, AND USE THEREOF

BOE Technology Group Co.,...

1. An 11-(9H-carbazol-9-yl)-1H-imidazole[4,5-f][1,10]phenanthroline derivative conforming to a chemical structural formula of:
wherein X is independently selected from the group consisting of a Z-substituted heteroaryl ring and an unsubstituted heteroaryl ring, wherein Y is independently selected from the group consisting of a Z-substituted aryl ring, a Z-substituted heteroaryl ring, an unsubstituted aryl ring, and an unsubstituted heteroaryl ring, and wherein Z is independently selected from the group consisting of aryl, C1-4 alkoxy, amino, nitro, trifluoromethyl, cyano, halo atom, and C1-24 aliphatic hydrocarbyl.

US Pat. No. 10,115,890

MAGNETIC THIN FILM AND APPLICATION DEVICE INCLUDING MAGNETIC THIN FILM

Fuji Electric Co., Ltd., ...

1. A magnetic thin film comprising an ordered alloy, wherein the ordered alloy comprises:at least one first element selected from the group consisting of Fe and Ni;
at least one second element selected from the group consisting of Pt, Pd, Au and Ir; and
a third element consisting of Sc, wherein the content of Sc is in a range from 1.2 at % to 3.8 at %”.

US Pat. No. 10,115,875

LIGHT-EMITTING DEVICE AND METHOD OF MANUFACTURING THE SAME

NICHIA CORPORATION, Anan...

1. A light-emitting device comprising:a base member having a plurality of first recesses each defined by a bottom surface and lateral surfaces that are inner surfaces of a lateral wall separating adjacent first recesses of the plurality of first recesses;
at least one light-emitting element mounted in each of the plurality of first recesses; and
a plurality of light-transmissive members, each having a flat upper surface and covering one of the plurality of first recesses, wherein
the plurality of light-transmissive members are separated from each other by the lateral wall separating the adjacent first recesses; and
the upper surface of each of the plurality of light transmissive members is located higher than an uppermost portion of the lateral wall, wherein
the base member comprises a substrate and the lateral wall, and
in a cross-sectional view of each of the plurality of first recesses, a virtual line passing through an edge of an upper surface of the at least one light-emitting element and an edge of an upper surface of the lateral wall forms an angle of 0 to 5 degrees with respect to an upper surface of the substrate.

US Pat. No. 10,115,746

MANUFACTURING METHOD FOR ACTIVE MATRIX SUBSTRATE, ACTIVE MATRIX SUBSTRATE AND DISPLAY APPARATUS

Sakai Display Products Co...

1. A method of manufacturing an active matrix substrate, the method comprising:forming, on a base substrate, a gate wiring and a source wiring which crosses the gate wiring above the gate wiring;
forming a thin film transistor near a region where the gate wiring and the source wiring face each other;
forming an interlayer dielectric film containing a spin-on-glass (SOG) material having photosensitivity in at least an area between the gate wiring and the source wiring in the region;
forming a hole in the interlayer dielectric film at a position overlapping only one of two outer edges along the longitudinal direction of the gate wiring formed on the base substrate so that a boundary viewed from above between the base substrate and the gate wiring is visually recognized through the hole; and
forming a semiconductor film after the interlayer dielectric film is formed,
wherein the method further comprises:
viewing the position of the boundary through the hole;
forming a film after the interlayer dielectric film is formed while adjusting a position of the film formed after the interlayer dielectric film based on the position of the boundary viewed through the hole.

US Pat. No. 10,115,744

ARRAY SUBSTRATE AND FABRICATION METHOD, DISPLAY PANEL, AND DISPLAY DEVICE

Shanghai Tianma AM-OLED C...

1. An array substrate, comprising: a substrate; a first functional layer configured on one side of the substrate; a first insulating layer configured on the first functional layer facing away from the substrate; a second functional layer configured on the first insulating layer facing away from the substrate; a second insulating layer configured on the second functional layer facing away from the substrate; a third functional layer configured on the second insulating layer facing away from the substrate; a third insulating layer configured on the third functional layer facing away from the substrate; a fourth functional layer configured on the third insulating layer facing away from the substrate; a plurality of through-holes configured to electrically connect different functional layers, wherein a depth of any through-holes does not exceed the thickness of two adjacent insulating layers; and a plurality of pixel driving circuits, wherein a pixel driving circuit comprises a first transistor, wherein a semiconductor layer of the first transistor is located in the first functional layer, a gate electrode of the first transistor is located in the second functional layer, and a source electrode and a drain electrode of the first transistor are both located in the fourth functional layer.

US Pat. No. 10,115,657

DIELECTRIC HEAT PATH DEVICES, AND SYSTEMS AND METHODS USING THE SAME

EATON INTELLIGENT POWER L...

3. A heat path device comprising:a first structure formed of a first thermally conductive material and including a first end and a second end;
a second structure formed of a second thermally conductive material and including a first end and a second end;
a third structure formed of a first dielectric material and including a first end and a second end;
wherein the first end of the third structure is mechanically coupled and thermally coupled at the first end of the first structure,
wherein the second end of the third structure is mechanically coupled and thermally coupled at a first end of the second structure;
wherein the second end of the first structure comprises at least one opening, and wherein the second end of the second structure comprises at least one opening; and
wherein the first structure and the second structure are located on a first plane, and wherein the third structure is located on a second plane such that:
the first end of the third structure overlaps the first end of the first structure; and
the second end of the third structure overlaps the first end of the second structure.

US Pat. No. 10,115,513

INTEGRATED INDUCTOR STRUCTURE

REALTEK SEMICONDUCTOR COR...

1. An integrated inductor structure, comprising:a first guard ring comprising:
a first inner ring disposed in a first metal layer and comprising at least one first inner ring opening; and
a first outer ring disposed in a second metal layer and comprising at least one first outer ring opening;
a second guard ring comprising:
a second inner ring disposed in the first metal layer and comprising at least one second inner ring opening;
a second outer ring disposed in the second metal layer and comprising at least one second outer ring opening;
an interlaced structure comprising:
a first plurality of connection portions arranged and directly connected between end terminals of the at least one first inner ring opening and end terminals of the at least one second outer ring opening in an interlaced manner, in order to couple the at least one first inner ring to the at least one second outer ring; and
a second plurality of connection portions arranged and directly connected between end terminals of the at least one first outer ring opening and end terminals of the at least one second inner ring opening in an interlaced manner, in order to couple the at least one first outer ring to the at least one second inner ring;
a patterned ground shield disposed at inner sides of the first inner ring and the second inner ring, and coupled to the first inner ring, the first outer ring, the second inner ring, and the second outer ring; and
an inductor formed above the guard ring and the patterned ground shield.

US Pat. No. 10,115,461

ELECTRONIC DEVICE USING RESISTIVE MEMORY ELEMENT AND A RECOVERY OPERATION TO COMPENSATE FOR THRESHOLD DRIFT

SK HYNIX INC., Icheon (K...

1. An electronic device including a semiconductor memory, the semiconductor memory comprising:a memory cell including a resistive memory element and a selection element that are connected in series, the resistive memory element configured to have a first resistance state or a second resistance state according to data stored in the memory cell; and
a current clamping NMOS transistor electrically coupled to a first node of the memory cell to limit an amount of current flowing through the memory cell,
wherein in a recovery operation for compensating for a drift amount of a threshold voltage value of the memory cell, a voltage having a rising pulse is applied to a second node of the memory cell while a ground voltage is applied to a gate of the current clamping NMOS transistor, the first node and the second node provided at opposing sides of the memory cell, the drift amount being generated by a drift phenomenon that occurred in the memory cell.

US Pat. No. 10,115,446

SPIN TRANSFER TORQUE MRAM DEVICE WITH ERROR BUFFER

SPIN TRANSFER TECHNOLOGIE...

1. A random access memory (RAM) device, comprisinga memory array comprised of an array of MRAM storage elements arranged as a plurality of data words, wherein each of the plurality of data words comprises an address;
address and data lines, coupled to the memory array, wherein the data lines carry a data word to be written into the memory array and the address lines carry a corresponding address;
a write buffer, coupled to the address and data lines, wherein the write buffer comprises a number of storage elements, and wherein the write buffer stores the data word and the corresponding address carried on the address and data lines during a write cycle;
an error buffer, coupled to the write buffer, wherein the error buffer comprises a plurality of entries, wherein each of the error buffer entries comprises a plurality of storage elements and an associated buffer memory address; and
a memory control logic that operates during a read cycle and the write cycle, wherein the memory control logic, during the write cycle, is operable to determine whether the data word was written into the memory array within a predefined error budget, and wherein the memory control logic writes the data word and the corresponding address from the write buffer into a selected one of the plurality of entries of the error buffer if the data word was not written into the memory array within the predefined error budget, and wherein the memory control logic, during a read cycle, is further operable to determine whether an address to be read is stored in the write buffer, the error buffer or the memory array.

US Pat. No. 10,115,327

OPTICAL DISPLAY SYSTEM WITH ENHANCED RESOLUTION, METHODS, AND APPLICATIONS

UNIVERSITY OF CENTRAL FLO...

1. An optical display/view system, comprising:an optical image-generating apparatus, including:
a programmable/controllable image-generating component adapted to generate a polarized image output, wherein the polarized image output component comprises pixels;
a polarization dependent image offset component disposed to accept the polarized image output from the image-generating component;
means for applying an electrical voltage to said polarization dependent image offset component to induce a shift in deflection angle in angular space of the pixels, wherein the shift moves each pixel of the pixels one of vertically, horizontally, or diagonally from an original location by a half angular size to a shifted location;
means for dividing a high resolution image into first and second sub-frame images to provide computationally optimized images;
means for repeatedly switching the applied electrical voltage to said polarization image offset component between said first sub-frame representative of the original locations of the pixels when voltage is unapplied and said second sub-frame representative of the shifted locations of the pixels when voltage is applied; and
means for synchronizing the switching of said polarization dependent optical component between the first sub-frame and the second sub-frame with the first sub-frame image and second sub-frame image.

US Pat. No. 10,115,322

TORSO SIMULANT WITH VASCULAR ELEMENTS MECHANICALLY RESPONSIVE TO A TOURNIQUET

Techline Technologies, In...

1. A torso simulant for use as a training device for stemming blood flow comprising:(a) a mandrel including an exterior surface which simulates at least a portion of a trunk;
(b) at least one compressible tube which simulates a vascular element;
(c) a plate which partially covers said mandrel and said at least one compressible tube with said at least one compressible tube disposed between said mandrel and said plate, said plate movable toward said mandrel enabling compression of said at least one compressible tube when a force is communicated onto said plate;
(d) a patch which completely covers said plate and partially covers said mandrel and said at least one compressible tube, said patch secured to said mandrel about a perimeter of said plate, said at least one compressible tube extends from under said patch;
(e) a compressible layer which covers said mandrel, said at least one compressible tube and said patch, said compressible layer simulates skin; and
(f) at least one structure disposed along said compressible layer to simulate an injury, said at least one compressible tube communicates a liquid to said at least one structure.

US Pat. No. 10,115,308

TARGET ADDRESSING SYSTEM

Uber Technologies, Inc., ...

1. A method for specifying locations of targets for a transit service, the method being implemented by one or more processors and comprising:receiving a service request for the transit service from a user;
determining a target location for the service request;
based on the target location, determining, from a virtual stopping space database, a vehicle stopping location that is different than the target location; and
transmitting an instruction set to a vehicle, the instruction set comprising a first instruction identifying the vehicle stopping location for a vehicular portion of the transit service, and a second instruction that specifies a path for a driver of the vehicle from the vehicle stopping location to the target location, the path to be followed by the driver upon parking the vehicle at the vehicle stopping location.

US Pat. No. 10,115,234

MULTIPLATFORM BASED EXPERIENCE GENERATION

ACCENTURE GLOBAL SOLUTION...

1. A multiplatform based experience generation system comprising:a processor; and
a memory storing machine readable instructions that when executed by the processor cause the processor to:
determine a set of connected devices that provide services related to virtual reality;
determine a platform type of each of the connected devices;
receive an indication of a modification to an intrinsic property of a virtual object on one of the set of connected devices;
generate, based on the received indication of the modification to the intrinsic property of the virtual object, a modification to a master version of the virtual object; and
generate, based on the platform type of another one of the set of connected devices and based on the modification to the master version of the virtual object, an indication of a modification to an intrinsic property of a virtual object on the another one of the set of connected devices by
analyzing the modification to the master version of the virtual object relative to a global anchor that is defined by a plane, and
generating, based on the platform type of the another one of the set of connected devices and based on the modification to the master version of the virtual object relative to the global anchor, the indication of the modification to the intrinsic property of the virtual object relative to the global anchor on the another one of the set of connected devices, wherein the virtual object on the one of the set of connected devices is generally identical to the virtual object on the another one of the set of connected devices.

US Pat. No. 10,115,112

TRANSACTION EVALUATION FOR PROVIDING REWARDS

Visa U.S.A. Inc., San Fr...

1. A non-transitory machine readable medium storing instructions, which, when executed, cause a computing system to:receive, by a loyalty platform computing device, from an issuer computing device, a set-up file, the loyalty platform computing device coupled to interact by communications with a transaction handler, the communications comprising transaction records provided by the transaction handler from processing of transactions for consumer payment devices in an electronic payment processing network, the network interconnecting issuer computing devices controlling consumer accounts from which payments are made and acquirer computing devices controlling merchant accounts to which the payments are made, and wherein a communication portal is coupled with the loyalty platform computing device and configured to communicate with computer devices outside the electronic payment processing network;
present, in response to the loyalty platform computing device instructing the communication portal to communicate with a computing device of a consumer, a plurality of reward options to the consumer in a user interface of a website, each reward option comprising a reward that is a value to be credited to an account of the consumer, a future qualifying transaction in which to use the reward, and an amount of a loyalty program currency to be exchanged for the reward upon conducting the future qualifying transaction, wherein the consumer has a balance of the loyalty program currency with a loyalty program provider, wherein the future qualifying transaction is a transaction with a first merchant within a predetermined category of merchants, and wherein a unique identifier corresponds to the first merchant;
prior to processing the future qualifying transaction, receive, by the communication portal, a selection in the user interface from the consumer of one of the reward options, the selection defining a selected reward;
after receiving the selection from the consumer, process, by the transaction handler, a plurality of transactions in the electronic payment processing network, the processing comprising receiving a transaction record from a first merchant computing device;
access, by the transaction handler, from a database, transaction records associated with the plurality of transactions, the records including a first transaction record;
in response to receiving the first transaction record from the transaction handler, identify, by the loyalty platform computing device, as controlled by the set-up file, using the first transaction record, a first transaction conducted by the consumer, with the first merchant computing device, that qualifies for the selected reward, wherein the transaction is conducted via a consumer payment device associated with the account of the consumer;
incorporate, in response to occurrence of the first transaction, by the loyalty platform computing device based on instructions received by the loyalty platform computing device from the issuer computing device, the unique identifier corresponding to the first merchant computing device into a field of a first statement credit record;
send, by the loyalty platform computing device to the transaction handler, statement credit records, including the first statement record, associated with corresponding transactions including the first transaction, the statement credit record identifying a location of the first merchant computing device;
in response to identifying the first transaction, send, by the loyalty platform computing device, at least one communication to the issuer computing device to debit the amount of the loyalty program currency from the balance of the loyalty program currency, and to credit the account of the consumer with the selected reward; and
in response to identifying the first transaction, instruct, by the loyalty platform computing device, the communication portal to send, outside the electronic payment processing network, a communication to a computing device of the consumer, the communication causing the computing device of the consumer to display a notification that the conducted transaction with the consumer payment device qualifies for the selected reward, and that, based on the unique identifier, the selected reward is redeemable with the merchant within the predetermined category of merchants.

US Pat. No. 10,115,105

METHOD AND SYSTEM FOR FACILITATING CONSUMER INTERACTIONS FOR PERFORMING PURCHASE COMMANDS

GROUPON, INC., Chicago, ...

1. A computer-executed method for facilitating a transaction, the method comprising:transmitting computer-executable instructions to cause a representation of an item to be displayed on a consumer interface rendered on a touch-screen visual display of a computing device, wherein the consumer interface presents an icon associated with the representation of the item;
receiving, at the touch-screen visual display of the computing device, an indication of a compound consumer input;
associating the compound consumer input with the item by detecting that at least a portion of the compound consumer input occurs at a position on the touch-screen visual display corresponding to a position of the icon;
determining that the compound consumer input corresponds to a purchase command; and
based on the determination that the compound consumer input corresponds to the purchase command, facilitating purchase of the item,
wherein a first portion of the consumer input is associated with the purchase command, and wherein a second portion of the consumer input is associated with a second command, and
wherein the second command comprises a quantity command defining a number of instances of the item selected for purchase, and wherein the method further comprises:
in response to receiving an indication of the second command, transmitting computer-executable instructions to cause facilitating purchase of one or more instances of the item based on the quantity command.

US Pat. No. 10,114,970

IMMUTABLE LOGGING OF ACCESS REQUESTS TO DISTRIBUTED FILE SYSTEMS

ALTR Solutions, Inc., Sa...

1. A tangible, non-transitory, machine-readable medium storing instructions that when executed by one or more processors effectuate operations comprising:receiving, with one or more processors, a request to access a distributed data store, wherein:
the request is a request to read from or write to a unit of content pertaining to a workload application;
the distributed data store stores a plurality of units of content that are each distributed among multiple computing entities hosting different subsets of data of the distributed data store;
each computing entity among the multiple computing entities corresponds to a different host at a different user-space instance of one or more different computing devices; and
each unit of content requires information from a plurality of computing entities to read the respective unit of content;
when writing each unit of content, different portions of information required to access the respective unit of content are written to different ones of the multiple computing entities such that no single one of the multiple computing entities stores all of the information required to access the respective unit of content;
causing, with one or more processors of a computing device configured to participate in combining the information from the plurality of computing entities to access units of content, logging of the request in an entry in a tamper-evident log, wherein the tamper-evident log defines one or more sequences of cryptographic hash values based on earlier logged entries;
storing, with one or more processors, the tamper-evident log in memory;
determining, with one or more processors, whether the tamper-evident log evinces tampering of log entries based on consistency of at least one of the sequences of cryptographic hash values with at least some entries in the tamper-evident log;
determining, with one or more processors, a risk metric based on other access requests documented in the tamper-evident log and the request;
storing, with one or more processors, the risk metric in memory;
determining, with one or more processors, that the risk metric satisfies a threshold; and
in response to the determination, disabling, with one or more processors, a user account associated with the request, wherein disabling a user account associated with the request comprises disabling the user account during an active session in which the user account is authenticated in real time with the determination, wherein:
the tamper-evident log comprises a blockchain having cryptographic hash pointers between sequential blocks of the blockchain and Merkle trees within blocks of the blockchain, the cryptographic hash pointers being based on a cryptographic hash function that implements a Merkle-Damgård hash function;
determining an authoritative entry among a distributed set of instances of the blockchain does not require a proof-of-work from computing devices implementing each of the set of instances;
a given entry in the tamper-evident log comprises:
an identifier of a user account having credentials by which authorization to perform a corresponding database access operation is requested; and
a timestamp of the corresponding database access operation; and
the given entry further specifies a database application program interface command by which the corresponding access operation is expressed.

US Pat. No. 10,114,953

METHOD AND SYSTEM FOR UPGRADING FIRMWARE OF A CARD READER

FEITIAN TECHNOLOGIES CO. ...

1. A method of upgrading firmware of a card reader, comprising steps of:establishing a contact connection between the card reader and Integrated Circuit (IC) card;
determining, by a processor in the card reader, whether the IC card is one IC card for upgrading in which encrypted files for upgrading are stored on the IC card, by determining whether specific information on the IC card obtained through the contact connection to the IC card by the card reader matches information preconfigured in the card reader;
if the IC card is one IC card for upgrading, making, by the processor in the card reader and a processor in the IC card, mutual authentication between the card reader and the IC card;
acquiring, by the card reader, the encrypted files for upgrading and decrypting the encrypted files for upgrading after a successful mutual authentication between the card reader and the IC card, and
upgrading firmware of the card reader by using the decrypted files for upgrading; and wherein
the IC card is one contacting IC card and the card reader is a contacting card reader, and the step of determining by the processor in the card reader whether the IC card is the one IC card for upgrading comprises:
reading, by the card reader, feature information which is the specific information of the IC card sent by the IC card, and determining whether the feature information matches preset feature information which is the information preconfigured in the card reader, determining that the IC card is the one IC card for upgrading if the feature information matches the preset feature information, and determining that the IC card is not the one IC card for upgrading if the feature information does not match the preset feature information;
wherein the step of making by the processor in the card reader and the processor in the IC card mutual authentication with the IC card comprises steps of:
authenticating the IC card by the card reader;
authenticating the card reader by the IC card;
the step of acquiring by the card reader the encrypted files for upgrading from the IC card after a successful authentication between the card reader and the IC card comprises: acquiring, by the card reader, the encrypted files for upgrading from the IC card after the authenticating the IC card by the card reader succeeds and the authenticating the card reader by the IC card succeeds:
and the step of authenticating the IC card by the card reader comprises:
generating, by the card reader, a first valid code and sending the first validation code to the IC card;
generating, by the card reader, a first verification code according to the first validation code by using, by the card reader, the first validation code as the first verification code directly; or converting, by the card reader, the first validation code into the first verification code; or encrypting, by the card reader, the first validation code with a preset symmetrical key to obtain the first verification code: or encrypting, by the card reader, the first validation code with a preset asymmetrical key to obtain the first verification code;
reading, by the card reader, a first authorization code generated according to the first validation code by the IC card; and
determining, by the card reader, whether the first authorization code matches the first verification code, and determining that the card reader succeeds in authenticating the IC card if the first authorization code matches the first verification code, determining that the authenticating the IC card by the card reader fails if the first authorization code does not match the first verification code
reading, by the card reader, a second validation code generated by the IC card, and generating a second authorization code according to the second validation code and sending the second authorization code to the IC card; and
reading, by the card reader, status information returned by the IC card after receiving the second authorization code, and determining whether the status information is the same as preset information which is the information preconfigured in the card reader, determining, by the card reader, that the IC card succeeds in authenticating the card reader if the status information is the same as the preset information, deyermining that the authenticating the card reader by the IC card fails if the status information is not the same as the preset information.

US Pat. No. 10,114,944

SYSTEMS AND METHODS FOR CLASSIFYING PERMISSIONS ON MOBILE DEVICES

Symantec Corporation, Mo...

1. A computer-implemented method for classifying permissions on mobile devices, at least a portion of the method being performed by a computing device comprising at least one processor, the method comprising:detecting, by the at least one processor, that an application installed and executing on a mobile device is issuing a request, through an operating system of the mobile device, for one or more requested permissions to access one or more components of the mobile device that would otherwise be blocked by the operating system of the mobile device;
determining, by the at least one processor, an intended use of the application;
in response to detecting that the application is issuing the request, performing, by the at least one processor and through a security system distinct from the application and the operating system, an analysis of the request being issued by the application at least in part by determining whether the intended use of the application corresponds to an expected use of the one or more requested permissions; and
providing, by the at least one processor via a graphical user interface and prior to an end user of the mobile device granting the one or more requested permissions to the application, a result of the analysis to the end user of the mobile device that indicates a security implication that would be caused by the end user granting the one or more requested permissions to the application.

US Pat. No. 10,114,942

INTERACTIVE CAPTCHA

PAYPAL, INC., San Jose, ...

1. A system, comprising:a non-transitory memory; and
one or more hardware processors coupled to the non-transitory memory and configured to read instructions from the non-transitory memory to cause the system to perform operations comprising:
receiving a request from a user device;
generating obfuscated instructions to be presented on the user device;
constructing a media object that contains a plurality of media components that interact with each other and create a solvable puzzle, wherein the solvable puzzle is culturally relevant to a determined country associated with the user device;
transmitting the media object and the obfuscated instructions to the user device for display;
transmitting media instructions on how to solve the solvable puzzle and a prompt to solve the solvable puzzle to the user device for display;
receiving a description of an action performed by a user on the user device in response to the prompt;
determining, based on the description of the action performed by the user, that the user is human; and
granting the request in response to determining that the user is human.

US Pat. No. 10,114,889

SYSTEM AND METHOD FOR FILTERING KEYWORDS

Beijing Qihoo Technology ...

1. An improved information filtering system for filtering out sensitive information from content, which comprises:a processor; and
a memory communicatively coupled to the processor and storing instructions that upon execution by the processor cause the system to:
acquire text content;
scan the text content through a preset keyword dictionary;
in response to a determination that the text content contains a plurality of keywords stored in the preset keyword dictionary, determine a position of each of the plurality of keywords in the text content;
determine at least one character pitch between any two of the plurality of keywords in the text content based on the position of each keyword among the plurality of keywords, wherein the at least one character pitch is a difference between positions of any two of the plurality of keywords in the text content;
determine whether the at least one character pitch does not exceed a preset character pitch;
in response to a determination that the at least one character pitch does not exceed the preset character pitch, filter out the plurality of keywords from the text content;
wherein the preset keyword dictionary further stores a preset order of at least two keywords among all of the keywords that need to be filtered out; and
wherein the memory further stores instructions that upon execution by the processor cause the system to:
determine the order of the plurality of keywords according to the position of each keyword among the plurality of keywords in the text content,
compare the order of the plurality of keywords in the text content with the preset order of corresponding keywords stored in the keyword dictionary, and
when the order of the plurality of keywords in the text content matches the preset order of the corresponding keywords stored in the keyword dictionary, determine that the plurality of keywords satisfy the preset order.

US Pat. No. 10,114,810

METHODS AND A COMPUTING DEVICE FOR MAINTAINING COMMENTS AND GRAPHICAL ANNOTATIONS FOR A DOCUMENT

Workiva Inc., Ames, IA (...

1. A method for processing comments and graphical annotations on a document, the method comprising:a first computing device transmitting instructions for rendering a document to a second computing device via a computer network;
in response to the instructions, the second computing device
rendering the document on a display device as view-only;
defining a transparent drawing canvas over the rendered document
the second computing device receiving a user input indicating: a coordinate on the rendered document, a graphical annotation, and text for the graphical annotation;
the second computing device drawing the graphical annotation and placing the text on the drawing canvas anchored at the coordinate;
the second computing device mapping the coordinate to a portion of the document underneath the drawing canvas to which the text and the graphical annotation are to be anchored;
the second computing device transmitting, to the first computing device, an identifier of the portion of the document, a request for the graphical annotation to be anchored to the portion of the document, and a request for the text to be associated with the graphical annotation;
the first computing device using the identifier to determine a database entity containing the portion of the document
the first computing device storing the graphical annotation in a database in a graphical annotation entity of the database;
the first computing device creating, within the database, an association between the entity containing the portion of the document and the graphical annotation entity;
the first computing device storing the text in the database in a comment entity; and
the first computing device creating an association between the graphical annotation entity and the comment entity within the database.

US Pat. No. 10,114,629

METHOD AND DEVICE FOR DOWNLOADING PROFILE OF OPERATOR

HUAWEI DEVICE (DONGGUAN) ...

1. A method for downloading a profile of an operator, comprising:acquiring, by a terminal, a download certificate used to download a profile of the operator, wherein the download certificate is generated by the operator or a subscription manager-data preparing (SM-DP);
sending, by the terminal to the SM-DP, a download request for downloading the profile of the operator, wherein the download request carries the download certificate and an ID of an embedded universal integrated circuit card (eUICC) of the terminal;
receiving, by the terminal, the profile of the operator that is sent by the SM-DP and is associated to the download request, and
transmitting, by the terminal, the profile of the operator to the eUICC.

US Pat. No. 10,114,564

MANAGEMENT OF VIRTUAL MACHINE SNAPSHOTS

Rubrik, Inc., Palo Alto,...

1. A method for operating a data management system, comprising:acquiring a set of files corresponding with a plurality of versions of a virtual machine;
determining a first version of the plurality of versions associated with a base file of the set of files;
determining a second version of the plurality of versions associated with a new base file to be generated, the first version of the virtual machine corresponds with a first state of the virtual machine at a first point in time, the second version of the virtual machine corresponds with a second state of the virtual machine at a second point in time subsequent to the first point in time;
generating the new base file corresponding with the second version of the virtual machine, the generating the new base file includes patching the base file with one or more forward incremental files of the set of files, the one or more forward incremental files correspond with the second version and one or more versions of the virtual machine between the first version and the second version, the generating the new base file includes concurrently reading the base file from a magnetic storage device while reading the one or more forward incremental files from a solid-state storage device different from the magnetic storage device, the one or more forward incremental files comprise a plurality of incremental files;
generating a set of reverse incremental files corresponding with the first version and the one or more versions of the virtual machine between the first version and the second version;
storing the new base file corresponding with the second version of the virtual machine using the magnetic storage device, the second version of the virtual machine comprises a more recent version of the virtual machine than the first version of the virtual machine;
storing the set of reverse incremental files using the solid-state storage device different from the magnetic storage device;
acquiring a merged file associated with the second version of the virtual machine, the merged file includes a first pointer to the new base file stored using the magnetic storage device and a second set of pointers to the set of reverse incremental files stored using the solid-state storage device; and
generating the second version of the virtual machine, the generating the second version of the virtual machine includes concurrently reading the new base file pointed to by the first pointer from the magnetic storage device while reading the set of reverse incremental files pointed to by the second set of pointers from the solid-state storage device.

US Pat. No. 10,114,554

ARRANGEMENTS FOR STORING MORE DATA IN FASTER MEMORY WHEN USING A HIERARCHICAL MEMORY STRUCTURE

Intellectual Property Sys...

1. A method for use in a computer system having a hierarchical memory system with at least first and second memory tiers, the first memory tier being faster than the second memory tier, the method enabling more data to be stored in the first memory tier so as to be more quickly accessed by a processor, the method being performed by a processor and comprising:performing an operation with two operands to determine an initial result of the operation, each operand being associated with a sensitivity value, wherein each sensitivity value indicates a number of bits of at least a portion of an associated data value that are not garbage bits, and wherein the initial result is computed without regard to the sensitivity value of either of the operands;
determining a sensitivity value for a final result based at least on the sensitivity values of each of the operands;
developing the final result as a function of the initial result and the determined sensitivity value for the final result;
compressing only that portion of the final result that does not correspond to garbage bits as indicated by the sensitivity value of the final result; and
storing the compressed final result and a representation of its sensitivity value in the first memory tier.

US Pat. No. 10,114,532

EDITING OPTIONS FOR IMAGE REGIONS

Google LLC, Mountain Vie...

1. A method comprising:receiving a definition of a user-defined class of image region from a user, wherein the definition includes one or more defined image characteristics of the image region;
associating a defined set of editing options with the user-defined class of image region, wherein the defined set of editing options is selected from a plurality of available editing options, each editing option in the defined set being associated with at least one edit operation that adjusts a respective set of one or more pixel values of the image region;
detecting a region of an image based on one or more characteristics of one or more pixels of the image, wherein the detected region is a portion of the image that excludes at least one pixel of the image;
determining an identified class of the detected region from a plurality of identifiable classes of regions, wherein each of the plurality of identifiable classes of regions is associated with a respective set of one or more editing options, each editing option in each set being associated with one or more edit operations that adjust a respective set of one or more pixel values of the image, wherein the identified class is determined as the user-defined class based on a determination that one or more image characteristics of the detected region match the one or more defined image characteristics of the image region included in the definition of the user-defined class;
examining previously-selected editing options selected by multiple users of an online networked service to change pixel values of images;
examining classes of regions that include the changed pixel values from the previously-selected editing options;
determining a resulting set of editing options that include editing options selected from the previously-selected editing options based on a frequency of selection of the previously-selected editing options for the identified class of the detected region by the multiple users, wherein the resulting set of editing options are included in the set of one or more editing options associated with the identified class;
presenting the resulting set of editing options for selection, wherein each of the editing options in the resulting set adjusts a respective set of one or more pixel values of the detected region in response to being selected, and wherein the resulting set of editing options is different from at least one of the other sets of editing options associated with the identifiable classes other than the user-defined class; and
providing the definition of the user-defined class and the resulting set of editing options to one or more devices such that each editing option in the resulting set of editing options is available for selection by one or more other users with respect to one or more other images associated with the one or more other users, wherein the resulting set of editing options is configured to be presented for selection by the one or more other users in response to one or more image characteristics of one or more detected regions of the one or more other images matching the one or more defined image characteristics of the user-defined class.

US Pat. No. 10,114,530

SIGNAL DETECTING AND EMITTING DEVICE

SONOS, INC., Santa Barba...

1. A playback device comprising:a signal detector adjacent to a first side of the playback device;
a signal emitter adjacent to a second side of the playback device;
a communication interface for communication with a display device;
at least one processor; and
memory having stored thereon instructions executable by the at least one processor to cause the playback device to perform functions comprising:
receiving via the communication interface with the display device, audio content corresponding to video content being displayed on the display device;
playing the audio content;
while playing the audio content, receiving, via the signal detector, a first signal from a control device configured to control the display device;
generating a second signal based on the first signal; and
emitting, via the signal emitter, the second signal such that the display device receives at a signal receiver of the display device, the first signal from the control device and the second signal at substantially the same time.

US Pat. No. 10,114,516

TOUCH SCREEN SENSOR

3M Innovative Properties ...

1. A patterned substrate for use in a touch screen sensor, comprising:a visible light transparent substrate; and
a plurality of alternating first and second regions disposed on or in the visible light transparent substrate, each first region comprising a first mesh bar comprising a plurality of first traces having a first width and defining a plurality of enclosed first open areas, each first mesh bar electrically connected to an electrically conductive pad for connection to an electronic device, each second region comprising a second mesh bar not electrically connected to an electrically conductive pad for connection to an electronic device, each second mesh bar comprising a plurality of selective breaks in an otherwise continuous mesh.

US Pat. No. 10,114,503

METHOD AND APPARATUS FOR PROCESSING DATA BASED ON TOUCH EVENTS ON A TOUCH SENSITIVE DEVICE

Open Invention Network LL...

1. A method, comprising:detecting at least a first predetermined number of touch events on a touch sensitive device;
determining at least a second predetermined number of control points based on the detected at least first predetermined number of touch events;
determining a command based on a change in value of at least one parameter related to at least two of the control points, wherein the determining of the command comprises determining an intended shape drawn on the touch sensitive device based on the change in value of the at least one parameter related to the at least two of the control points, and determining the command based on the determined intended shape;
processing a first data object and a second data object based on a preselected common attribute tag using the determined command, wherein the preselected common attribute tag is implemented in XML format and comprising time data, location data, and distance data;
sending a list of attributes recognized by a system, the attributes are used for describing at least the first data object or the second data object to a database by the system; and
processing the data record to at least a network node of the system, wherein the network node of the system is in communication with the touch sensitive device;
wherein a measurement signal is compared with a threshold for determining that the touch event is valid.

US Pat. No. 10,114,501

WEARABLE ELECTRONIC DEVICE USING A TOUCH INPUT AND A HOVERING INPUT AND CONTROLLING METHOD THEREOF

Samsung Electronics Co., ...

1. A method of controlling a wearable electronic device including a touch panel, the method comprising:receiving, at the wearable electronic device, at least one first touch input via a front portion of the touch panel;
receiving, at the wearable electronic device, at least one second touch input via an edge portion of the touch panel;
receiving, at the wearable electronic device, a hovering input touching a body part of a user around the wearable electronic device;
determining a control command corresponding to a combination of the at least one first touch input, the at least one second touch input, and the hovering input received at the wearable electronic device; and
controlling the wearable electronic device according to the determined control command.

US Pat. No. 10,114,494

INFORMATION PROCESSING APPARATUS, INFORMATION PROCESSING METHOD, AND PROGRAM

Sony Corporation, Tokyo ...

1. An information processing apparatus comprising:circuitry configured to:
execute a map application;
detect a magnitude of a contacting pressure of a contacted object with respect to an input device operated when physically contacted by the contacted object;
detect positions pointed by the contacted object with respect to the input device;
change a display region displayed on a display device of the map application to be displayed on the display device by either scrolling the display region, or changing a display magnification of the map application by either enlarging or reducing the display magnification based on the pointed positions;
change a speed of either scrolling the display region, or changing the display magnification according to the magnitude of the contacting pressure;
detect a predetermined magnification pattern formed by a predetermined movement trajectory comprised of a plurality of continuous different positions of the contacted object detected by the circuitry;
start either an enlargement mode or a reduction mode of the display magnification of the map application in response to the detecting of the predetermined magnification pattern; and
switch between the enlargement mode and the reduction mode in response to the detecting of the predetermined magnification pattern.

US Pat. No. 10,114,491

TOUCH-DISPLAY PANEL

LEADING UI Co., Ltd., An...

1. A touch-display panel comprising:an organic light-emitting diode (OLED) panel displaying an image through a plurality of sub-pixels; and
a touch-sensing wiring formed on the OLED panel in a mesh shape to receive a driving signal from an external device and to output a sensing signal which varies in accordance with a touch,
wherein the mesh shape comprises a wiring portion having an I-shape and a bridge portion having an X-shape, and
an edge formed at the wiring portion comprises at least one of a round slit and a slit having an X-shape formed at the bridge portion.

US Pat. No. 10,114,486

METHOD AND APPARATUS FOR PROVIDING TOUCH INPUT VIA A TOUCH SENSITIVE SURFACE UTILIZING A SUPPORT OBJECT

CHANGE HEALTHCARE HOLDING...

1. A method of receiving touch input from a user who engages and moves a support object relative to a touch sensitive surface, wherein the support object is independently movable relative to the touch sensitive surface, and wherein the method comprises:determining an orientation of the support object upon the touch sensitive surface while the support object overlies a portion of the touch sensitive surface, wherein the support object includes an asymmetrical pattern of contact elements that are in contact with the touch sensitive surface, and wherein determining the orientation of the support object comprises determining a location of a forward end of the support object relative to a rearward end of the support object based upon the asymmetrical pattern of the contact elements;
while the support object is in contact with the touch sensitive surface and while the user has placed a hand upon the support object such that at least one finger of the hand extends beyond the forward end of the support object and contacts the touch sensitive surface and such that a wrist and forearm of the user extend from the rearward end of the support object, receiving the touch input from the at least one finger of the user as a result of contact between the at least one finger with the touch sensitive surface at a positon upon the touch sensitive surface that is outside of the portion of the touch sensitive surface that the support object overlies so as to be located beyond an edge of the support object and to be distinct and spaced apart from the contact elements of the support object;
after having determined the orientation of the support object upon the touch sensitive surface, determining a relative position of the touch input with respect to the support object based upon the orientation of the support object upon the touch sensitive surface;
determining, with processing circuitry, a type of touch input based upon the relative position of the touch input with respect to the support object; and
causing an action to be taken in response to the type of touch input.

US Pat. No. 10,114,435

METHOD AND APPARATUS TO CONTROL CURRENT TRANSIENTS IN A PROCESSOR

Intel Corporation, Santa...

1. A processor comprising:at least one core including a first core, the first core comprising:
an execution unit;
counter logic to determine a first plurality of sums of power weights of a first plurality of instructions to be executed by the execution unit in a first time window, wherein each instruction is assigned a corresponding power weight that is determined independent of an instruction width of the corresponding instruction; and
control logic to:
categorize each sum of the first plurality of sums of power weights to increment a plurality of bin counters, each bin counter corresponding to one of a first plurality of thresholds;
for each bin counter of the plurality of bin counters, multiply a count of the bin counter by the threshold corresponding to the bin counter to obtain a product associated with the bin counter;
sum the products associated with the plurality of bin counters to determine a value of a first current protection license request for the first core based on the first plurality of bin counters; and
request the first current protection license for the first core using the determined value.

US Pat. No. 10,114,433

THERMAL MANAGEMENT ASSEMBLY

HEWLETT PACKARD ENTERPRIS...

11. An apparatus comprising:a memory device including an upper notch and a lower notch;
a thermal management assembly coupled to the memory device via the upper notch,
wherein the thermal management assembly includes:
a first thermal management member including:
a first main region that is continuous and devoid of a through opening;
a first connection region that is discontinuous; and
a first top side;
a second thermal management member including:
a second main region;
a second connection region, wherein the second main region and the second connection region are continuous, and the second connection region includes a connection tab such that the first connection region and the second connection region are connected by the connection tab; and
a second top side;
a connection member to couple the first thermal management member and the second thermal management member to the memory device, wherein the first top side and the second top side are substantially flush with a top side of the memory device and the connection tab is located directly behind the connection member; and
a memory device socket electrically coupled to the memory device, wherein the memory device socket includes a retention clip receivable in the lower notch.

US Pat. No. 10,114,427

INPUT/OUTPUT MODULE BAFFLE AND MOTHERBOARD WITH THE SAME

ASUSTeK COMPUTER INC., T...

1. An input/output module baffle, adapted to an electronic device, the electronic device includes a motherboard and a casing, the motherboard is located inside the casing, the motherboard includes a connector module, the input/output module baffle comprising:a fixing plate including a plurality of retaining clips to clamp the fixing plate on the connector module;
a conductive component located between the fixing plate and the connector module; and
a frame located between the fixing plate and the casing, wherein the input/output module baffle further includes a baffle fastener to fasten the fixing plate on the connector module of the motherboard, the retaining clips further include a positioning opening, the baffle fastener further includes a positioning portion, and the positioning portion includes a positioning protrusion to position the baffle fastener in the positioning opening, wherein the baffle fastener further includes a connecting portion and a fastening portion, and the fastening portion is buckled on a back of the connector module.

US Pat. No. 10,114,425

PORTABLE ELECTRONIC DEVICE

ASUSTEK COMPUTER INC., T...

1. A portable electronic device, comprising:a body, including a first engaging surface and a first groove, and an opening of the first groove is formed at the first engaging surface;
a stationary magnetic element, disposed at a periphery of the first groove; and
a base, including:
a bottom plate;
a connecting element, disposed on the bottom plate and including a second engaging surface and a second groove, and the opening of the second groove is formed on the second engaging surface;
a rotatable magnetic element, pivotally connected with the second groove, wherein one end of the rotatable magnetic element is adapted to rotate out or rotate in the second groove, when a distance between the first engaging surface and the second engaging surface is less than a predetermined value, and the opening of the first groove faces to the opening of the second groove, the rotatable magnetic element is attracted by the stationary magnetic element to rotate out of the second groove and get into the first groove; and
an auxiliary magnetic element disposed on the other end of the rotatable magnetic element configured such that the other end of the rotatable magnetic element rotates toward the second groove under a magnetic repulsion force between the auxiliary magnetic element and the rotatable magnetic element.

US Pat. No. 10,114,410

COVER

ASUSTEK COMPUTER INC., T...

1. A cover, adapted to an electronic device, the cover comprising:a first plate including a plurality of sub-plate areas, a plurality of crease areas and at least a flexible area, the plurality of sub-plate areas and the plurality of crease areas are alternately disposed on the first plate;
a second plate connected to the flexible area of the first plate;
an input device disposed on the second plate;
a connecting base disposed on the flexible area adjacent to the second plate, and
a plurality of fixing components disposed on at least one of the first plate and the second plate, wherein the plurality of fixing components includes at least one first fixing component disposed on the first plate and a plurality of seventh fixing components disposed on the connecting base, the connecting base and the electronic device are fixed to each other;
wherein the first plate is folded along at least one of the crease area to make the cover in a first state, in the first state, the seventh fixing components are fixed to the first fixing components, and wherein the first plate turns over relative to the second plate to make the cover in a second state.

US Pat. No. 10,114,383

DYNAMIC JACK REFERENCE CONTROL SYSTEM AND METHOD FOR EXTENDING VEHICLE JACKS

Flanders Electric Motor S...

1. A control system for extending at least one jack on a vehicle, comprising:a tilt sensor, the tilt sensor being configured to sense a tilt angle of the vehicle;
a jack deployment system connected to the tilt sensor, the jack deployment system being configured to extend the at least one jack;
a speed controller operatively associated with the jack deployment system and the at least one jack; and
a processor operatively associated with the tilt sensor and speed controller, the processor being configured to:
evaluate the sensed tilt angle against a desired tilt angle of the vehicle to determine if the desired tilt angle has been achieved,
produce a jack reference value using a difference between the sensed tilt angle and the desired tilt angle, if the desired tilt angle has not been achieved, and
apply the jack reference value to the speed controller, the speed controller being configured to control a speed of jack extension for the at least one jack relative to the jack reference value, the jack reference value being a percentage of maximum jack extension speed available for the at least one jack.

US Pat. No. 10,114,354

PERSONAL GROOMING APPLIANCE

BRAUN GMBH, Kronberg (DE...

1. A packaged personal grooming appliance unit, in combination with a packaging that at least partly houses the personal grooming appliance, comprising a personal grooming appliance includingan energy source;
an electronic circuit comprising at least one electric load;
a first sensor for providing a first signal indicating a relevant change of a first external condition;
wherein the personal grooming appliance is arranged to stay in a sleep mode in which the electronic circuit consumes at least a reduced average energy amount in comparison to an active mode and to initiate the active mode when the first signal indicating a change of the first external condition is received;
wherein the electronic circuit is arranged to perform a welcome routine in response to a first active mode initialization and a standard routine, different from the welcome routine, in response to receiving the first signal indicating a relevant change in the first external condition after the welcome routine has been performed, and
wherein the first sensor is sensitive to a change of the packaging condition comprising at least an opening of the packaging.

US Pat. No. 10,114,256

ARRAY SUBSTRATE AND LIQUID CRYSTAL DISPLAY PANEL

XIAMEN TIANMA MICRO-ELECT...

1. An array substrate, comprising:a substrate;
a plurality of scanning lines and a plurality of data lines arranged above the substrate, wherein the plurality of scanning lines intercepts the plurality of data lines to define a plurality of pixel regions;
a plurality of switch elements each disposed in close proximity to an intersection of one of the scanning lines and one of the data lines, wherein each of the plurality of switch elements comprises a gate electrode, a semiconductor layer, a source electrode and a drain electrode;
a plurality of pixel electrodes and a plurality of common electrodes, wherein each of the plurality of pixel electrodes comprises strip-type electrodes and two connecting end portions, wherein each of the connecting end portions is substantially parallel to the plurality of scanning lines,
and
wherein the strip-type electrodes each includes three portions: a first straight-line portion connecting to a second straight-line portion on one end and a third straight-line portion on another end, wherein the second straight-line portion and the third straight-line portion are parallel to each other; and
wherein each of the plurality of common electrodes is a planar electrode covering the scanning lines and the data lines between two adjacent pixel regions and has an opening exposing the switch elements in each said pixel region including the gate electrode, the semiconductor layer, the source electrode and the drain electrode;
a source-drain metal layer patterned on the substrate;
a planarization layer disposed on the source-drain metal layer;
a pixel electrode layer comprising the plurality of pixel electrodes patterned on the planarization layer;
a common electrode layer comprising the plurality of common electrodes patterned on the planarization layer; and
an alignment layer patterned above the common electrode, having an alignment direction substantially perpendicular to a scanning line direction;
wherein a first angle between a direction of the first straight-line portion and the alignment direction is in a range of 4 to 6 degrees, and wherein a second angle between a direction of the second straight-line portion and the third straight-line portion and the alignment direction is larger than the first angle; and
wherein the strip-type electrodes in two adjacent pixel regions at opposite sides of a scanning line are substantially symmetric.

US Pat. No. 10,114,240

SPRAYING DEVICE AND COATING METHOD

BOE TECHNOLOGY GROUP CO.,...

1. A coating method, in which a first spray unit and a second spray unit are adopted, comprising:during coating, advancing the first spray unit and the second spray unit in the same direction, wherein the second spray unit is arranged directly behind the first spray unit in the advancing direction;
spraying a first solution on a surface of a substrate with the first spray unit, wherein the first solution is used for wetting the surface of the substrate, and wherein the first spray unit comprises a plurality of first nozzles, the first nozzles are flat and are arranged in a horizontal direction, and the first spray unit is configured to spray by repeating a fan pattern linearly in the horizontal direction; and
spraying a second solution with the second spray unit in a region of the surface of the substrate on which the first solution has been sprayed, wherein the second solution is used for coating the surface of the substrate, and wherein the second spray unit comprises a plurality of second nozzles, the second nozzles are arranged into two rows in the horizontal direction, the second nozzles in one of the rows are offset with respect to the second nozzles in the other row, and the second spray unit is configured to spray linearly in a longitudinal direction.

US Pat. No. 10,114,229

LENS DRIVING DEVICE AND CAMERA MODULE COMPRISING SAME

LG INNOTEK CO., LTD., Se...

1. A lens driving apparatus, comprising:a housing;
a bobbin disposed in the housing;
a first coil disposed on the bobbin;
a first magnet disposed on the housing and facing the first coil;
a circuit board comprising a second coil disposed below the first magnet and facing the first magnet;
an upper elastic member disposed on an upper portion of the housing;
a first sensor detecting displacement of the bobbin;
a second magnet disposed to face the first sensor;
a second sensor detecting displacement of the housing;
a base disposed below the housing; and
a plurality of support members connecting the upper elastic member and the circuit board,
wherein the upper elastic member comprises six upper elastic members,
wherein the first sensor is electrically connected to four of the six upper elastic members,
wherein the first coil is electrically connected to two of the six upper elastic members,
wherein the housing comprises a first corner area including a first corner, and
wherein two of the plurality of support members are disposed in the first corner area.

US Pat. No. 10,114,222

INTEGRATED EYE TRACKING AND LASER PROJECTION METHODS WITH HOLOGRAPHIC ELEMENTS OF VARYING OPTICAL POWERS

THALMIC LABS INC., Kitch...

1. A method of operating a laser projector to project an image to an eye of a user and to track the eye of the user, the method comprising:outputting visible light by at least a first laser diode of the laser projector, the visible light representative of at least a portion of the image;
outputting infrared light by an infrared laser diode of the laser projector;
controllably and reflectively scanning both the visible light and the infrared light by a scan mirror of the laser projector;
redirecting both the visible light and the infrared light towards the eye of the user by a wavelength-multiplexed HOE, including applying a first positive optical power to the visible light by a first hologram of the wavelength-multiplexed HOE, and applying a second optical power to the infrared light by a second hologram of the wavelength-multiplexed HOE, the second optical power less than the first optical power, to converge the visible light to a first exit pupil with a first diameter and to converge the infrared light to a second exit pupil with a second diameter larger than the first diameter;
detecting a reflection of at least a portion of the infrared light from the eye of the user by an infrared photodetector; and
determining a position of at least one feature of the eye based on the reflection of at least a portion of the infrared light from the eye of the user detected by the infrared photodetector.

US Pat. No. 10,114,216

MINIMALLY INVASIVE LENS CLEANER

C-CLEAR LLC, Midvale, UT...

1. A cleaning device for cleaning a lens of an endoscope, the cleaning device comprising:a sleeve comprising an inner surface configured to engage a medical device;
a first tab linearly extending outward from a first longitudinal end of the sleeve at an inclined angle ranging from 45° to 80° with respect to the first longitudinal end, and a second tab linearly extending outward from a second longitudinal end of the sleeve at an inclined angle ranging from 45° to 80° with respect to the second longitudinal end, the first and second longitudinal ends being located on opposite ends of the sleeve, and wherein the first and second tabs are only partially coterminous with the sleeve; and
a pad secured around the sleeve and configured to wipe the lens, wherein the cleaning device does not include a reservoir for cleaning fluid.

US Pat. No. 10,114,204

APPARATUS AND METHOD FOR OPTICAL BEAM SCANNING MICROSCOPY

HORIBA JOBIN YVON SAS, L...

1. An apparatus for optical beam scanning microscopy comprising:at least one light source configured to emit an optical beam;
a microscope objective having an entrance pupil, the microscope objective being arranged according to a longitudinal optical axis of the microscopy apparatus, the pupil having a center on the longitudinal optical axis and the microscope objective being configured to focus said optical beam in an object plane transverse to the longitudinal optical axis; and
an angular displacement system configured to angularly displace the optical beam according to two transverse spatial directions in the object plane, the angular displacement system consisting of:
a first mirror and a second mirror disposed in series on the optical path of the optical beam between the light source and the microscope objective,
the first mirror being mounted on an actuator with two axes of rotation configured to tilt said first mirror according to a first predetermined rotation angle around a first rotation axis and configured to tilt the first mirror according to a third predetermined rotation angle around a second rotation axis transverse to the first rotation axis,
the second mirror being mounted on another actuator with two axes of rotation configured to tilt said second mirror according to a second predetermined rotation angle as a function of said first rotation angle, around the first rotation axis and configured to tilt the second mirror according to a fourth predetermined rotation angle as a function of the third rotation angle around the second rotation axis transverse to the first rotation axis, to angularly tilt the axis of the optical beam by pivoting about the center of the pupil of the microscope objective, said optical beam remaining centered on the center of the pupil of the microscope objective in a range of tilting angles of the axis of the optical beam with respect to the longitudinal optical axis, to displace the optical beam according to said two directions in the object plane.

US Pat. No. 10,114,179

OPTICAL CONNECTOR, PIN KEEPER, PIN INSERTION JIG, EXPANSION MEMBER, AND PIN INSERTION TOOL

SEI OPTIFRONTIER CO., LTD...

1. An optical connector that is connected to another connector in a predetermined connection direction, the optical connector comprising:a ferrule that includes insertion holes into which pins to be connected to the another connector are to be inserted; and
a pin keeper that is provided on a side of the ferrule opposite to the another connector and includes retaining holes retaining the pins inserted into the insertion holes,
wherein the pin keeper includes a pair of side portions in which the retaining holes are formed, and a bottom portion that connects end portions of the pair of side portions, and
the retaining holes are formed in a shape in which inside surfaces of the side portions facing each other are notched, the optical connector further comprising
a housing that receives the ferrule and the pin keeper,
wherein the housing includes a first opening through which an expansion member widening the pair of side portions is inserted into the housing, and
the pair of side portions is pushed to be widened when the expansion member is inserted from the first opening and comes into contact with the inside of each of the side portions.

US Pat. No. 10,114,006

SELF-DIAGNOSIS METHOD AND APPARATUS FOR MEASURING RESULTS FROM BLOOD ANALYZERS

Shenzhen Mindray Bio-Medi...

1. A method for self-diagnosis of measurement results of a blood sample from a blood analyzer comprising an acquisition driver and a pipeline, the method comprising:flowing the blood sample from a sample tube through the pipeline to the acquisition driver for a sample acquisition;
detecting changes with time in an optical transmittance of the blood sample in the pipeline by using a photoelectric sensor during the sample acquisition;
generating an acquisition transmittance curve according to the changes versus time in the optical transmittance of the blood sample; and
determining whether there is an anomaly in the acquisition process according to the acquisition transmittance curve.

US Pat. No. 10,113,999

METHOD AND A DEVICE FOR DETECTING A SUBSTANCE

CITY UNIVERSITY OF HONG K...

1. A device for detecting a substance comprising:a light source arranged to emit a light signal through a sample cell, wherein the sample cell is arranged to temporally house a sample compound having a portion of the substance; and
an optical processing module arranged to detect the light signal emitted through the sample cell to identify physical attributes of the light signal altered by the sample compound at multiple wavelengths, the light signal is at least partially absorbed by the sample compound in the sample cell;
wherein the physical attributes of the light signal altered by the sample compound are processed by fitting the physical attributes at the multiple wavelengths to a reference absorption spectrum of the substance so as to detect the substance within the sample compound; and wherein the optical processing module includes a light sensor and a micro-electric-mechanical-system arranged to enable the light sensor to detect the physical attributes of the altered light signal at the multiple wavelengths; and
wherein the optical processing module is further arranged to process the detected physical attributes using an iterative retrieval process so as to correct a non-linear effect of the light signal altered by the sample compound in a dispersive infrared spectroscopy measurement process; the iterative retrieval process includes:
a convolution process of high resolution cross sections with an instrument spectral resolution of the optical processing module; and
a second order polynomial in a fitting process between a measured absorption spectrum and a reference absorption spectrum of the sample compound; wherein the fitting process is carried out using a modified absorption cross section represented by:

 where L represents a distance that the light signal passes through the sample compound, c represents a concentration of the sample compound, and F represents an instrument function associated with an influence of the instrument on the spectra including the sampling process.

US Pat. No. 10,113,907

ULTRAVIOLET-SENSING SHEET, ULTRAVIOLET-SENSING SET, AND ULTRAVIOLET-SENSING METHOD

FUJIFILM Corporation, To...

1. An ultraviolet-sensing sheet comprising:a filter layer that selectively allows transmission of light having a specific wavelength; and
an ultraviolet-sensing layer that includes a capsule including a color-forming dye and a photooxidant; and
wherein a maximum value of a transmittance of the filter layer in a thickness direction in a wavelength range of 300 nm or longer and shorter than 380 nm is 70% or higher, and
a maximum value of a transmittance of the filter layer in the thickness direction in a wavelength range of 380 nm to 450 nm is 20% or lower.

US Pat. No. 10,113,882

INDICATING DEVICE, IN PARTICULAR A PRESSURE GAUGE

ASCO AS, Luce (FR)

1. An indicating device comprising:a basic housing comprising a drive mechanism that drives a rotary indicator needle that is mobile relative to a dial,
an interface housing attached to the basic housing,
at least one rotary screen borne by the interface housing, for identifying an operating zone, of which the angular position about the axis of the needle is adjustable,
a protective cover fixed removably to the interface housing and, when removed, allowing the position of the rotary screen to be adjusted without detaching the interface housing from the basic housing.

US Pat. No. 10,113,872

MICRO-ELECTRO-MECHANICAL DEVICE WITH COMPENSATION OF ERRORS DUE TO DISTURBANCE FORCES, SUCH AS QUADRATURE COMPONENTS

STMicroelectronics S.r.l....

1. A gyroscope comprising:a substrate;
elastic elements;
a drive system; and
a plurality of movable mass systems elastically coupled to the substrate and the drive system by the elastic elements, the plurality of movable mass systems being configured to be driven by the drive system, each of the plurality of movable mass systems including:
a suspended mass configured to be subjected to disturbance forces; and
a damping mass coupled to the suspended mass by elastic elements and configured to resonate at its natural frequency in response to the respective movable mass systems being driven by the drive system, the damping mass being configured to reduce movements of the suspended mass due to the disturbance forces.

US Pat. No. 10,113,827

FIREARM RECOIL CONTROL SYSTEM

1. A recoil control system comprising:a base portion having a main body having a length, a flat bottom surface, and at least two machined contoured sections extending the length of the main body;
a slide portion having a main body with a flat upper surface;
wherein the at least two machined contoured sections provide a sliding interface between the base portion and the slide portion such that the slide portion is slidingly engaged with, and can move forward and backward with respect to, the base portion; and
a damper in communication with the slide portion,
wherein the at least two machined contoured sections each include one indentation and one flange and wherein the at least two machined contoured sections together form a single rail.

US Pat. No. 10,113,804

HEAT EXCHANGER AND AIR CONDITIONING DEVICE

DENSO CORPORATION, Kariy...

1. A heat exchanger comprising:a core part having a plurality of tubes in which refrigerant flows;
a pair of tank parts extending in an intersection direction to intersect the tubes at longitudinal ends of the tubes to distribute fluid to the tubes and to gather fluid flowing inside the tubes;
an inner wall part arranged in the pair of tank parts to change a flow of the refrigerant in the tank parts;
a reinforcement part that partially reinforces an outer periphery part of the pair of tank parts from outer side; and
a protruding rib extending inwardly from an inner surface of the reinforcement part and engaging the outer periphery part of the pair of tank parts, so as to space the inner surface of the reinforcement part from the outer periphery part of the tank parts, wherein
the reinforcement part is located at a position not overlapping with both ends of the pair of tank parts in the intersection direction and not overlapping with the inner wall part.

US Pat. No. 10,113,770

WARM AIR HEATER

RINNAI CORPORATION, Nago...

1. A warm air heater comprising:a burner which is disposed in a combustion chamber;
a fuel supply unit which supplies fuel gas to the burner;
an air supply passage which communicates the combustion chamber with outdoors;
a combustion fan which is disposed in the air supply passage, and supplies air in the outdoors to the combustion chamber through the air supply passage as combustion air;
an orifice which is provided in the air supply passage;
a differential pressure detection unit which detects differential pressure between front and rear of the orifice in the air supply passage;
a combustion control unit which rotates the combustion fan based on target combustion quantity of the burner, and causes the fuel supply unit to supply the fuel gas to allow the burner to burn;
an abnormality detection unit which detects presence and absence of an abnormality of the air supply passage based on the differential pressure detected by the differential pressure detection unit; and
a correction unit which, based on the differential pressure detected by the differential pressure detection unit, obtains an air density ratio which is a ratio of a mass flow rate of the combustion air with respect to a reference mass flow rate of combustion air in a reference state, and based on the air density ratio, obtains a first correction value for correcting a rotation speed of the combustion fan from a reference rotation speed of the reference state such that the rotation speed of the combustion fan increases as the ratio decreases; and
wherein
the correction unit, based on the air density ratio, obtains a second correction value for correcting a supply quantity of the fuel gas supplied by the fuel supply unit from a reference supply quantity of the reference state, such that the supply quantity of the fuel gas increases as the air density ratio decreases.

US Pat. No. 10,113,752

CEILING-EMBEDDED AIR CONDITIONER WITH A BLOWOFF STRUCTURE BLOWING AIR TO ALL DIRECTIONS

FUJITSU GENERAL LIMITED, ...

1. A ceiling-embedded air conditioner comprising:a casing main body embedded in a ceiling;
a decorative panel mounted on a bottom surface of the casing main body;
a turbo fan disposed in the casing main body;
a heat exchanger disposed in the casing main body to surround an outer periphery of the turbo fan;
a drain pan that is disposed in the casing main body along a bottom side of the heat exchanger and includes a foamed resin drain pan main body and a resin drain sheet integrated with the foamed resin drain pan main body on a side of the heat exchanger;
an air suction path that is disposed in a center of the drain pan in a horizontal direction and reaches the turbo fan;
an air blowoff path for conditioned air having passed through the heat exchanger, the air blowoff path being provided at four places along the sides surrounding the air suction path, wherein the sides are parallel to sides of the casing main body;
an air suction opening that is provided in the decorative panel and communicates with the air suction path; and
a rectangular air blowoff opening that is provided in the decorative panel and communicates with the air blowoff path, wherein
the air blowoff path is integrated with the drain pan, as a cuboidal shape having a pair of second side walls disposed with a predetermined space therebetween in parallel to the sides surrounding the air suction path and a pair of first side walls connecting ends of the second side walls, the second side wall being longer than the first side wall,
an airflow guide vane is provided in the air blowoff path to direct part of the blown airflow of the conditioned air toward a first side of the rectangular air blowoff opening,
an attachment portion formed of the same material as that for the drain sheet and configured to attach the airflow guide vane is provided at an inflow-side opening portion of the air blowoff path,
the airflow guide vane includes:
a base plate disposed along the second side walls;
a plurality of guide fins that is vertically erected from a surface of the base plate in parallel to one another with a predetermined space therebetween; and
a lock piece that is provided at an upper end of a back surface of the base plate and is locked in the attachment portion,
the attachment portion has a lock concave formed by recessing, in a thickness direction, part of the inflow-side opening of the air blowoff path, and
the lock piece is housed in the lock concave such that the lock piece is flush with an inflow-side upper end surface of an upper end portion of the air blowoff path.

US Pat. No. 10,113,740

FLUIDIZED BED COMBUSTION OF CARBONACEOUS FUELS

GAS TECHNOLOGY INSTITUTE,...

1. A method of combusting a carbonaceous fuel, said method comprising:introducing the carbonaceous fuel and an oxygen-containing gas into a staged fluidized bed reactor wherein the carbonaceous fuel comprises a solid selected from the group consisting of coal, petroleum coke, biomass and combinations thereof and wherein the carbonaceous fuel and the oxygen-containing gas are eluted through a fluidized bed comprising an inert material, dolomite or a combination thereof;
wherein the oxygen-containing gas comprises a mixture of oxygen, recycled CO2 and steam having sufficient oxygen added to the recycled CO2 and steam that the mixture in each stage contains 7-20 mole % oxygen, and
wherein the carbonaceous fuel and the oxygen-containing gas are introduced into the fluidized bed at a location in sufficiently close proximity to each other to avoid producing a reducing atmosphere at the location;
combusting the carbonaceous fuel and with at least a portion of the oxygen-containing to produce at least CO2 and steam; and
recycling to the fluidized bed reactor at least a portion of the produced CO2 and steam as a portion of the oxygen-containing gas such that the total quantity of oxygen supplied to the reactor is greater than 20% but the quantity of oxygen supplied in each stage is no more than 20%.

US Pat. No. 10,113,724

STRUCTURAL BEAM AND LIGHT FIXTURE FOR A WALKABLE CLEAN ROOM CEILING

AES Clean Technology, Inc...

1. A walkable structural beam and light fixture for a walkable ceiling of a clean room, the walkable ceiling having a ceiling top side and a ceiling bottom side, the walkable structural beam and light fixture comprising:(a) an elongated channel, said elongated channel defining a channel first end and a channel second end, said elongated channel having a configuration for support of said elongated channel from said channel first end and said channel second end, said elongated channel being configured to be substantially flush with both the ceiling top side and the ceiling bottom side when said elongated channel is installed in the walkable ceiling, said elongated channel being walkable when said elongated channel is installed in the walkable ceiling;
(b) a lamp, said lamp being disposed within said elongated channel, said elongated channel having a channel top side and a channel bottom side, said lamp being configured to project a light through said channel bottom side when said elongated channel is installed in the walkable ceiling.

US Pat. No. 10,113,714

LIGHTING UNITS WITH REFLECTIVE ELEMENTS

PHILIPS LIGHTING HOLDING ...

1. A lighting unit, comprising:a base adapted to be inserted into a socket of a luminaire or lighting fixture;
one or more light sources to emit light at least in a first direction; and
one or more reflective elements arranged to:
define-an aperture through which a first spatial portion of the emitted light continues in the first direction;
prevent a second spatial portion of the emitted light from continuing in the first direction; and
reflect at least part of the second spatial portion of the light in a second direction that is different than the first direction;
wherein the one or more reflective elements comprise a plurality of reflective blades of a diaphragm shutter, wherein the plurality of reflective blades is configured to be slid over each other to alter a diameter of the aperture.

US Pat. No. 10,113,698

LIGHTING ASSEMBLY EMITTING A PORTION OF UV LIGHT

PHILIPS LIGHTING HOLDING ...

1. A lighting assembly for illumination, the lighting assembly comprising:a light exit window for emitting light into an ambient of the lighting assembly,
a first light emitting element for emitting visible light, the first light emitting element being capable of emitting visible light having a color point in a CIE XYZ color space, the color point having a distance smaller than 25 SDCM to a black body line in said color space, the first light emitting element being arranged to emit the visible light directly towards the light exit window,
a second light source for emitting UV light, the UV light having a spectral range from 280 nm to 350 nm, wherein the UV light is at least partly emitted through the light exit window, the second light source being arranged not to emit the UV light directly towards the light exit window,
a reflection element configured to reflect the UV light, the reflection element being arranged at a position for receiving at least a portion of the UV light and is arranged for reflecting the received UV light towards the light exit window, wherein the lighting assembly is configured to emit an amount of the UV light in the spectral range through the light exit window, the amount of the UV light having a first radiant flux and the lighting assembly is configured to emit a second radiant flux of the visible light through the light exit window, a ratio between the first radiant flux and the second radiant flux is in a range from 0.01 to 0.0001.

US Pat. No. 10,113,688

MAGNETIC MOUNTING APPARATUS AND METHOD

Suzhou Uni-Solution Impor...

1. A magnetic mounting apparatus, comprising:a base structure comprising a steel ball;
a magnet having a peripheral exterior sidewall, a first face and a second face, the steel ball being secured to the first face of the magnet solely by magnetic attraction;
a friction collar having:
an internal shoulder that engages the first face of the magnet,
a skirt section that extends in a first direction from the shoulder along the peripheral exterior sidewall of the magnet and terminates in a contact edge co-planar with the second face of the magnet, and
a bowl section that extends in a second direction from the shoulder and surrounds a portion of the steel ball, when the steel ball is secured to the first face of the magnet.

US Pat. No. 10,113,686

HEIGHT-ADJUSTABLE FOOT ARRANGEMENT

Mettler-Toledo (Albstadt)...

1. A device for adjusting a relationship of a housing to a surface on which the housing stands, while protecting against inadvertent changes of an adjustment setting, the device comprising:a foot piece, arranged in a recess on a surface of the housing that faces the surface on which the housing stands, the foot piece having an internal thread that defines a displacement axis, the foot piece further having a cross-sectional profile, perpendicular to the displacement axis, that coacts with the recess to prevent rotation of the foot piece about the displacement axis;
a spindle with an external thread that cooperates with the internal thread of the foot piece;
a levelling wheel;
a snap connection that releasably connects the levelling wheel to an end of the spindle, limiting the spindle to co-rotation with the levelling wheel about the displacement axis; and
a top that covers the housing, and which, when installed, completely covers the levelling wheel, preventing rotation thereof.

US Pat. No. 10,113,642

ROTATION DETECTING DEVICE

KAWASAKI JUKOGYO KABUSHIK...

1. A rotation detecting device comprising:a rotation sensor including a rotor spaced from a rotation member in an axial direction of the rotation member and rotatable about a rotational axis of the rotation member, a detector detecting a rotating position of the rotor, and a housing supporting the rotor and the detector; and
a junction body separatable from the rotation member and the rotation sensor, rotatable about the rotational axis, and transmitting the rotative movement of the rotation member to the rotor,
wherein the junction body is supported by the rotation member on a first side in the axial direction extending along the rotational axis, and is supported by the rotor on a second side in the axial direction, and
wherein the junction body includes:
a supported portion fitted on an inner peripheral face of a tubular section disposed on the first side and formed into a tubular shape to prevent movement in the radial direction with respect to the rotation member; and
a rotation prevention portion fitted on a rotation prevention section formed on an end face of the tubular section to prevent relative movement in the circumferential direction with respect to the rotation member.

US Pat. No. 10,113,639

TRANSMISSION WITH L1-L2 SHIFT METHOD WHILE ENGINE BRAKING

GM Global Technology Oper...

1. A transmission for use with an engine, the transmission comprising:a stationary member;
an input member connectable to the engine;
a plurality of gear sets each having a plurality of nodes, including a ring gear, a sun gear, and a carrier member;
a first clutch that, when applied, connects a node of one of the gear sets to the stationary member to establish a 1st gear low (L1) mode;
a second clutch that, when applied, connects a node of another one of the gear sets to the stationary member to establish a 2nd gear low (L2) mode;
a selectable one-way clutch (SOWC) connected between nodes of two of the gear sets; and
a controller programmed, in response to a requested shift from the L1 mode to the L2 mode during an engine braking maneuver, to release the first clutch and thereby enter a neutral mode of the transmission, release the SOWC when a slip level across the first clutch exceeds a first calibrated slip threshold, reapply the first clutch when a slip level of the SOWC exceeds a second calibrated slip threshold to thereby enter a 1st gear freewheeling mode, and apply the second clutch to enter the L2 mode and resume the engine braking maneuver.

US Pat. No. 10,113,607

ACTIVE VIBRATION DAMPING DEVICE AND ACTIVE VIBRATION DAMPING METHOD

HONDA MOTOR CO., LTD., T...

1. An active vibration damping device, comprising:an actuator disposed between a drive source and a vehicle body; and
a computer configured to suppress transmission of vibrations from the drive source to the vehicle body by causing the actuator to actively generate vibrations;
wherein the computer comprises:
an internal temperature estimating unit configured to calculate an internal temperature of the actuator;
a command value calculating unit configured to calculate an operation command value for the actuator from rotation information of the drive source;
a command value correction unit configured to correct the operation command value in accordance with the internal temperature;
a drive control unit configured to apply a drive voltage to the actuator using a voltage duty ratio based on the corrected operation command value; and
a point number calculating unit configured to obtain an integer value point number which is set so as to become larger as a period of rotation of the drive source becomes longer; and
wherein the internal temperature estimating unit comprises:
an output average duty ratio calculating unit configured to calculate an output average duty ratio, which is an average of target values or actually measured values of the voltage duty ratios that are used for realizing the operation command value, when the period of rotation of the drive source is a predetermined period;
a reference average duty ratio calculating unit configured to calculate, on basis of the operation command value and the point number, a reference average duty ratio, which is an average of the voltage duty ratios that realize the operation command value when the internal temperature is a reference temperature and the period of rotation of the drive source is the predetermined period;
an average duty ratio rate-of-change calculating unit configured to calculate, from the operation command value and the point number, an average duty ratio rate of change, which indicates a relationship between an amount of change of the internal temperature and an amount of change of an average duty ratio which is an average of the voltage duty ratios, when the period of rotation of the drive source is the predetermined period; and
an internal temperature calculating unit configured to calculate as the internal temperature a value obtained by adding the reference temperature to a product of the average duty ratio rate of change and a deviation between the output average duty ratio and the reference average duty ratio.

US Pat. No. 10,113,282

CUTTING EDGE ATTACHMENT FOR SNOW PLOW

Nordic Auto Plow LLC, We...

1. A snow plow blade attachment and mounting for use with an existing plow blade mold board with a set of holes, comprising:a traditional cutting blade with a hole pattern and with a bottom part having a lower edge for engaging a ground;
a reinforcing plate with the hole pattern;
and a rounded cutting edge snow blade attachment having a first upper vertical flat thin section of a thickness with pre-drilled holes that match the hole pattern to receive the reinforcing plate on one side and the traditional cutting blade on the other side to secure the blade attachment to the traditional cutting blade, further including integral and adjacent to the first upper vertical flat thin section a second lower thin section of the first thickness separated from the first upper vertical flat thin section by a horizontal bend of approximately 30 to 45 degrees from the vertical and wherein the second lower thin section includes a primary curved section forming a rounded portion that protrudes forward of the first upper vertical flat thin section and bends downward to pass below the lower edge of the bottom part of the traditional cutting blade in a secondary flat and horizontal section.

US Pat. No. 10,113,239

CUTTING TOOL

KYOCERA CORPORATION, Kyo...

1. A cutting tool comprising:a base including cemented carbide containing W, C, Co, Cr, Si and Fe; and
a coating layer comprising a Ti-based layer including at least a layer of Ti(Cx1Ny1Oz1) (0?x1?1, 0?y1?1, 0?z1?1, x1+y1+z1=1), an Al2O3 layer, and an outermost layer of Ti(Cx3Ny3Oz3) (0?x3?1, 0?y3?1, 0?z3?1, x3+y3+z3=1), which are laminated in order from the base side on a surface of the base, wherein a content of Cr contained at a thickness-center position of a first Ti-based layer of the Ti-based layer on a side closer to the base is lower than a content of Cr contained in the base, and higher than a content of Cr contained at a thickness-center position of the Al2O3 layer, and a content of Cr contained at a thickness-center position of the outermost layer is higher than the content of Cr contained at the thickness-center position of the Al2O3 layer in a glow-discharge emission spectrometry (GDS analysis).

US Pat. No. 10,113,120

PROCESSING FLUID FROM A WELL

STATOIL PETROLEUM AS, St...

1. Apparatus for processing fluid from a well, the apparatus comprising:a first wall portion adjacent a first region;
a second wall portion adjacent a second region;
said first and second regions arranged to let fluid pass therethrough;
the apparatus further comprising:
a first heat exchanger which includes said first wall portion, said first heat exchanger being arranged to heat said first wall portion to release wax from said first wall portion into said fluid at said first region; and
a second heat exchanger which includes said second wall portion, said second heat exchanger being arranged in a first configuration to cool said fluid at said second region during said heating of the first wall portion to cause wax from said fluid to deposit on said second wall portion, wherein said second heat exchanger is operable in said first configuration to cool said fluid at said second region, and in a second configuration, different from said first configuration, to heat said second wall portion to release wax from the second wall portion into said fluid; and
an outlet arranged to receive therein said fluid from said first and second regions,
wherein the first heat exchanger and the second heat exchanger are disposed in a parallel configuration.

US Pat. No. 10,113,112

PREPARATION OF NANORODS

Massachusetts Institute o...

1. A method of preparing a core-shell nanorod comprising growing a shell of a core-shell nanorod (M1X1)M2X2 in a solution through a slow-injection of M2 precursor solution and X2 precursor solution to a suspension of M1X1 nanocrystals to form the shell in a first shell growth step, and, after stopping the first shell growth step, further growing the shell of the core-shell nanorod (M1X1)M2X2 in the solution through a slow-injection of M2 precursor solution and X2 precursor solution to a suspension of M1X1 nanocrystals to form a thicker shell in a second shell growth step and, wherein the core-shell nanorod includes a M1X1 core.

US Pat. No. 10,112,934

(CYANO-DIMETHYL-METHYL)-ISOXAZOLES AND -[1,3,4]THIADIAZOLES

Centrexion Therapeutics C...

1. A method of treating pain selected from the group consisting of acute pain, visceral pain, and neuropathic pain, comprising administering to a human being an effective amount of a compound selected from the group consisting ofand a pharmaceutically acceptable salt thereof, to treat the pain.

US Pat. No. 10,112,813

SAFETY BRAKE FOR A LIFTING DEVICE

Siemens Aktiengesellschaf...

1. A safety brake for a lifting device, comprising:a brake blocking gear element connected to at least one drive of the lifting device;
a pawl for engaging in a latch void of the brake blocking gear element in cases of an impermissible lowering speed of the lifting device, the brake blocking gear element being blocked;
an actuator for activating the pawl, the pawl and the actuator being configured and arranged such that, in a non-energized state of the actuator, the pawl bears on the brake blocking gear element or moves into the latch void of the brake blocking gear element, and in an energized state of the actuator, the pawl moves away from the brake blocking gear element or moves out of the latch void and releases the brake blocking gear element;
an electronic or numeric controller for controlling the at least one drive and for activating the actuator, the controller monitoring the lowering speed of the lifting device, a transfer of the actuator to the non-energized state occurring when the permissible lowering speed is exceeded; and
at least two sensors which are linked to the controller for determining an operating state of the pawl, a differentiation with respect to the operating state being determinable at least between the moved-away state, the bearing state, and the completely moved-into the latch void state via the at least two sensors.

US Pat. No. 10,112,783

TRANSFER DEVICE FOR PRODUCT CARRIERS WITH HOLDING MEANS

FERAG AG, Hinwil (CH)

1. A transfer device (1) for the separated transfer of product carriers (2a-2e; 2c?, 2d?) with holders (21, 21a-21e; 21c?, 21d?) to an overhead conveyor, the transfer device (1) comprising:a helical conveyor (11, 11?) forming a conveying section (F) for the holders (21, 21a-21e; 21a?-21f?) with a conveying portion (FF) and a transfer portion (FU), wherein the conveying section (F) in the conveying portion (FF) following a linear path and in the transfer portion (FU) following a transversely curved path superimposed on the linear path, wherein the helical conveyor (11, 11?) ends in the transfer portion (FU) in an eccentrically arranged guide tongue (111), which has a tapering cross-section as compared to the cross-section of the helical conveyor (11, 11?) in the conveying portion.

US Pat. No. 10,112,772

INVENTORY HOLDER LOAD DETECTION AND/OR STABILIZATION

Amazon Technologies, Inc....

5. A management module configured for inclusion in or communication with a mobile drive unit, the management module comprising a non-transitory computer-readable storage medium having stored therein instructions that, when executed by one or more processors of a computer system, cause the computer system to at least:receive or generate instructions that instruct motion of the mobile drive unit for facilitating a shift of position of at least one inventory item from one position in an inventory holder docked with the mobile drive unit for movement by the mobile drive unit to another position within or out of the inventory holder.

US Pat. No. 10,112,761

PACKAGE HAVING INTEGRAL TAB WITH FINGER HOLE OPENING FEATURE

Hollister Incorporated, ...

1. A package, comprising a sheet material having first and second side panels and upper and lower panels, the sheet material being wrapped into a three-dimensional configuration wherein the first and second side panels are placed in confronting relation to define a fin having a longitudinal free edge and opposed end free edges, at least a portion of the side panels parallel to the longitudinal free edge of the fin being adhered to one another to define a fin seal extending between the longitudinal free edge and a terminal line parallel to the longitudinal free edge, portions of the upper and lower panels being placed in confronting relation and said portions of the upper and lower panels being adhered to one another to define first and second end seals, and a starter line formed in the fin at a location intermediate the end free edges extending from the longitudinal free edge of the fin toward the upper panels wherein the starter line directs tearing of the package parallel to the longitudinal free edge.

US Pat. No. 10,112,644

METHOD FOR OPERATING A STEERING SYSTEM

1. A method for operating a steering system (2) of a motor vehicle having an electric drive unit (15) for boosting the steering force, the method comprising:operating an electric drive unit by a control device configured to execute software, and
during a restart of the software, operating the electric drive unit (15) so that torque introduced via a steering device to a steering rack is damped by a torque generated by the electric drive unit.

US Pat. No. 10,112,607

DRIVING SUPPORT DEVICE THAT PERFORMS DRIVING SUPPORT IN ACCORDANCE WITH CHARACTERISTICS AND SKILLS OF DRIVER

HONDA MOTOR CO., LTD., T...

1. A driving support device comprising:a processing device that performs driving support by controlling in-vehicle equipment having an influence on running of a subject vehicle equipped with the driving support device,
the processing device being configured to
repeatedly obtain and store, at a predetermined time interval or a predetermined distance interval, a pair of a value of longitudinal acceleration and a value of lateral acceleration that are generated as a result of a driving operation performed by a driver, the longitudinal acceleration being an acceleration in a traveling direction of the subject vehicle, the lateral acceleration being an acceleration in a direction orthogonal to the traveling direction,
set at least one parameter of a support operation for performing the driving support, by using a plurality of pairs of the value of the longitudinal acceleration and the value of the lateral acceleration, repeatedly obtained and stored,
plot points, each representing the respective pairs, on a two-dimensional coordinate plane that includes two axes respectively representing the longitudinal acceleration and the lateral acceleration,
generate a first shape, which is a closed shape, by connecting the plotted points adjacent to one another by line segments,
generate a second shape, which is a closed shape, formed of a circumscribed curve of the first shape,
calculate an area difference by subtracting an area of the first shape from an area of the second shape, and
set the one parameter of the support operation for performing the driving support, by using the area difference.

US Pat. No. 10,112,593

POWER ASSIST SYSTEM WITH BALL NUT, BRAKE BOOST ACTUATOR, AND METHOD

STEERING SOLUTIONS IP HOL...

1. A power assist system comprising:a motor having a rotor shaft;
a drive pulley attached to the rotor shaft;
a driven pulley;
a flexible belt configured to connect the drive pulley to the driven pulley; and,
a ball screw assembly including:
a rotatable ball screw rotatable with the driven pulley;
a linearly translated ball nut surrounding the ball screw;
a plunger attached to or integral with the ball nut, the plunger extending along a longitudinal axis of the ball screw and configured for attachment to a driven shaft to axially move the driven shaft; and,
an anti-rotation device arranged to prevent rotation of the ball nut.

US Pat. No. 10,112,533

VEHICLE DECORATIVE COMPONENT AND VEHICLE DECORATIVE COMPONENT INSTALLING METHOD

TS Tech Co., Ltd., Saita...

1. A vehicle decorative component installed on an indoor side of a vehicle, the vehicle decorative component comprising:a light emitting region that emits light, wherein the light emitting region comprises:
an irradiation body that irradiates the light toward a front side of the light emitting region;
a transmissive body through which the light emitted from the irradiation body is transmitted at a front position of the irradiation body; and
a decorative layer provided at a front position of the transmissive body in a state where a surface is exposed; andwherein:a decoration style of the exposed surface of the decorative layer is a same style as a decoration style of a surface of a non-light emitting region adjacent to the light emitting region;
the decorative layer is a decorative film attached to the transmissive body;
the decorative film has a transmissive portion through which the light transmitted through the transmissive body is transmitted, a blocking portion by which the light transmitted through the transmissive body is blocked, and a pattern layer which is translucent;
the transmissive portion and the blocking portion are provided in a part of the decorative film that faces the transmissive body; and
the pattern layer is a part exposed on the indoor side of the decorate film and is overlapped on both the transmissive portion and the blocking portion to cover both the transmissive portion and the blocking portion;
the irradiation body has a light source, and a light guiding body including a light emission surface that emits the light from the light source;
the light source and the light guiding body are integrated as a light source unit;
the non-light emitting region is adjacent to the light emitting region;
the transmissive body, the decorative layer, and the non-light emitting region are integrated as a decorative unit;
the light source unit is arranged at a position sandwiched between a base member to which the vehicle decorative component is attached and the decorative unit;
the decorative unit comprises a rib that extends from an opposing surface of the decorative unit to the base member and that has an annular shape;
an inner side of the rib surrounds the light source unit along an outer peripheral edge of the light source unit when the light source unit is assembled to the decorative unit; and
the light guiding body and the transmissive body are disposed separated from each other at a predetermined distance by the rib between the light guiding body and the transmissive body.

US Pat. No. 10,112,489

METHOD OF CONTROLLING REGENERATIVE BRAKING COOPERATION FOR ELECTRIC VEHICLE

Hyundai Motor Company, S...

1. A method of controlling a regenerative braking cooperation for an electric vehicle, the method comprising:a correction mode entering operation, of entering a correction mode when a braking quantity of a driver is detected by a pedal stroke sensor of the vehicle;
a first braking pattern analyzing operation, by a controller, of comparing an accumulated correction hydraulic pressure braking quantity with a predetermined first hydraulic pressure braking quantity, to analyze a braking pattern of the driver through the entering to the correction mode, the first braking pattern analyzing operation including a total required braking quantity determining operation;
a regenerative braking restriction requesting operation of, when the accumulated correction hydraulic pressure braking quantity is smaller than the first hydraulic pressure braking quantity, determining, by the pedal stroke sensor, that the driver has a gradual braking-centered braking pattern and transferring a signal for requesting a regenerative braking restriction of a motor to the controller; and
a hydraulic pressure braking operation, by the controller, of determining a correction hydraulic pressure braking quantity based on a braking quantity of the driver input into the pedal stroke sensor in a state where regenerative braking of the motor is restricted, and performing a hydraulic pressure braking according to the correction hydraulic pressure braking quantity,
wherein the total required braking quantity determining operation includes a second braking pattern analyzing operation, by the controller, in which when it is determined that a traveling distance of the vehicle in a state where the total required braking quantity is determined is equal to or larger than a predetermined distance, an accumulated general hydraulic pressure braking quantity according to the travelling distance equal to or larger than the predetermined distance is compared with a predetermined second hydraulic pressure braking quantity.

US Pat. No. 10,112,352

PRESS MOULDING METHOD

Gurit (UK) Ltd., Newport...

1. A method of press moulding a multilayer moulding material structure to form a moulded part of fibre-reinforced resin matrix composite material, the method comprising the steps of:i. providing a multilayer moulding material structure, the multilayer moulding material structure containing fibres, resin and a syntactic layer comprising a polymer matrix and a plurality of hollow bodies distributed within the polymer matrix, wherein the multilayer moulding material structure comprises a multilayer laminate and the syntactic layer is a core layer between first and second fibre layers, and then in a loading step locating the multilayer moulding material structure into a mould tool which comprises a lower part and an upper part, wherein at least the upper part is heated to an elevated temperature;
ii. draping a lower surface of the multilayer moulding material structure onto at least a part of a lower moulding surface of the mould tool thereby permitting the multilayer moulding material structure to drape at least partly under the action of gravity within the mould tool so as to configure at least part of the draped multilayer moulding material structure in a partly moulded shape, wherein the multilayer moulding material structure drapes by bending about a neutral axis substantially centrally located with respect to the thickness of the multilayer moulding material structure, the neutral axis being located within the syntactic layer;
iii. fully closing the mould tool to define a closed mould cavity containing the multilayer moulding material structure;
iv. applying pressure to the mould cavity to cause resin to flow and impregnate the fibres and to configure the multilayer moulding material structure in a fully moulded shape; and
v. substantially fully curing the resin to form a moulded part from the multilayer moulding material structure, wherein steps ii and iv are carried out at elevated temperature, from step i until at least the commencement of step iii the lower part is at a lower temperature than the upper part, and in step ii the multilayer moulding material structure is heated to cause the viscosity of the resin initially to decrease as a result of an increase in resin temperature and then to increase as a result of initiation of curing prior to step iii, and the temperature of the lower part is controlled so as to delay the onset of gelation of the resin until after step iii.

US Pat. No. 10,112,236

DEVICE AND METHOD FOR THE MANUFACTURE OR REPAIR OF A THREE-DIMENSIONAL OBJECT

MTU AERO ENGINES AG, Mun...

1. A device for the manufacture or repair of a three-dimensional object, comprising:at least one construction chamber for successive solidification of at least one solidifiable material layer by layer in predefined regions for the layer-by-layer buildup of the three-dimensional object or for layer-by-layer repair of individual regions of the three-dimensional object within the construction chamber, and
at least one inlet nozzle and at least one suction nozzle for a process gas, with the inlet nozzle and the suction nozzle being arranged where a gas flow that passes at least partially over a buildup and joining zone of a construction platform formed in the construction chamber is created,
wherein the ratio of the sums of the fluid-dynamically relevant cross-sectional areas of the at least one suction nozzle to the at least one inlet nozzle is 2.5:1 to 0.3:1, and
wherein the at least one suction nozzle comprises at least two suction orifices, wherein said at least two suction orifices are each connected to an associated suction channel in such a way as to carry the flow, and each suction channel has wall surfaces that have a contoured course that is curved at least in sections in the flow direction and the associated suction channels are separated from one another.

US Pat. No. 10,112,143

GRAFTED POLYMER NANOCOMPOSITE MATERIALS, SYSTEMS, AND METHODS

The Trustees of Columbia ...

1. A system, comprising:a chamber having an inlet,
the inlet in fluid communication with a first membrane, the first membrane being configured to receive a material from the inlet and effect at least partial separation of a component of the material,
the first membrane comprising a plurality of graft nanoparticles,
a graft nanoparticle comprising a nanoparticle (a) having an average cross-sectional dimension in the range of from about 1 nm to about 50 nm and (b) having a population of polymer chains attached thereto, and
the plurality of graft nanoparticles being arranged in a periodic lattice structure.

US Pat. No. 10,112,091

REMOVABLE, ROTATABLE GRIP ELEMENT FOR A BALL BAT OR OTHER SPORTING-GOOD IMPLEMENT

EASTON DIAMOND SPORTS, LL...

1. A grip element for use on a sporting-good implement having a knob, the grip element comprising:a body having a length, a first end, and a second end;
a substantially linear opening along the length of the body;
a low-friction inner surface; and
a projection located substantially at the first end, the projection being configured to mate with a groove in the knob;
wherein a portion of the grip element is positioned to rotate against a portion of the knob; and
wherein the body is tapered between the first end and the second end.

US Pat. No. 10,111,995

ELECTROACTIVE ACTUATORS

THE NOTTINGHAM TRENT UNIV...

1. An actuator comprising:an inner tubular structure; and
an outer tubular structure surrounding the inner tubular structure;
wherein:
the outer tubular structure comprises a plurality of layers of a dielectric elastomeric material;
the outer tubular structure comprises a tubular elastic support structure;
the tubular elastic support structure is configured to maintain a pre-stress in the plurality of layers of the dielectric elastomeric material;
the outer tubular structure is configured to contract in a radial direction around the inner tubular structure upon application of an actuation voltage signal across the dielectric elastomeric material layers; and
the tubular elastic support structure comprises an auxetic structure configured such that a ratio between expansion in the circumferential direction and contraction in the axial direction of the tubular elastic support structure when unconstrained is zero or negative.

US Pat. No. 10,111,987

MARKED FLUOROPOLYMER SURFACES AND METHOD OF MANUFACTURING SAME

Innovatech, LLC, Chicago...

1. A method of manufacturing a coated polytetrafluoroethylene tube, said method comprising:inserting a support member into a lumen of a body of a polytetrafluoroethylene tube;
coupling the support member and the body of the polytetrafluoroethylene tube to a shielding device;
blocking, via the shielding device, a plurality of spaced apart portions of an outer surface of the body of the polytetrafluoroethylene tube;
rotating the support member and the body of the polytetrafluoroethylene tube;
while rotating the support member and the body of the polytetrafluoroethylene tube, applying a coating to each of a plurality of spaced apart unblocked portions of the outer surface of the body of the polytetrafluoroethylene tube; and
curing the applied coating to cause the applied coating to bond to the outer surface of the body of the polytetrafluoroethylene tube to indicate a plurality of spaced apart markings formed on the outer surface of the body of the polytetrafluoroethylene tube.

US Pat. No. 10,111,884

METHODS AND COMPOSITIONS FOR TREATING VIRAL INFECTIONS

Hadasit Medical Research ...

1. A method of treating a viral infection or suppressing viral replication in a subject having a viral infection, comprising the step of administering to said subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier or excipient and a therapeutically effective amount of a compound having anti-viral activity represented by the structure of formula I:
or a salt or a solvate thereof, wherein Y represents an optionally substituted morpholinosulphonyl group or a group —NR1R2; wherein R1 and R2 together with the interjacent nitrogen atom represent an optionally substituted non-aromatic heterocyclic group selected from the group consisting of piperazinyl, morpholinyl, and thiomorpholinyl,
wherein said viral infection or replication is a cytomegalovirus infection or replication, and wherein the compound inhibits cytomegalovirus infection and/or replication in said subject.

US Pat. No. 10,111,873

DIHYDROPYRIMIDINONE DERIVATIVES

KING SAUD UNIVERSITY, Ri...

1. A compound having the chemical structure according to Formula 1:whereinZ is selected from N and O;
X is selected from O and S; and
R is selected from aryl, substituted aryl, heteroaryl, or substituted heteroaryl;
or a pharmaceutically acceptable salt thereof.

US Pat. No. 10,111,859

METHODS AND COMPOSITIONS ASSOCIATED WITH THE GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR

LIGAND PHARMACEUTICALS, I...

1. A method of treating a hematopoietic or neurological disorder selected from the group consisting of granulocytopenia, neutropenia, amyotrophic lateral sclerosis, multiple sclerosis, multiple dystrophy, and spinal cord injury, the method comprising administering an effective amount of a compound of Formula (II) wherein the compound of Formula (II) has the following structure:
a tautomer thereof, or a pharmaceutically acceptable salt thereof,
wherein:
R3 is selected from hydrogen, an optionally substituted C1-C6 alkyl, an optionally substituted C2-C6 alkenyl, an optionally substituted C2-C6 alkynyl, an optionally substituted C1-C6 heteroalkyl, an optionally substituted C3-C8 cycloalkyl, an optionally substituted C3-C8 cycloalkenyl, an optionally substituted C1-C6 heterocycle, an optionally substituted aryl, and an optionally substituted heteroaryl;
R4 is selected from hydrogen, an optionally substituted C1-C6 alkyl, an optionally substituted C2-C6 alkenyl, an optionally substituted C2-C6 alkynyl, an optionally substituted C1-C6 heteroalkyl, an optionally substituted C3-C8 cycloalkyl, an optionally substituted C3-C8 cycloalkenyl, an optionally substituted C1-C6 heterocycle, an optionally substituted heteroaryl, and an optionally substituted heteroarylalkyl;
R9 is selected from hydrogen, an optionally substituted C1-C6 alkyl, an optionally substituted C2-C6 alkenyl, an optionally substituted C2-C6 alkynyl, an optionally substituted C1-C6 heteroalkyl, an optionally substituted C3-C8 cycloalkyl, an optionally substituted C3-C8 cycloalkenyl, an optionally substituted C1-C6 heterocycle, an optionally substituted heteroaryl, an optionally substituted arylalkyl, an optionally substituted arylalkenyl, an optionally substituted arylalkynyl, an optionally substituted heteroarylalkyl, an optionally substituted heteroarylalkenyl, and an optionally substituted heteroarylalkynyl;
W is selected from O (oxygen) and NH;
X is N (nitrogen) or CR2; and
Y is selected from an optionally substituted C1-C6 alkyl, C2-C6 alkenyl, an optionally substituted C1-C6 heteroalkyl, an optionally substituted C1-C6 heteroalkenyl, an optionally substituted phenylalkenyl, and an optionally substituted heterocyclealkenyl.

US Pat. No. 10,111,821

METHODS AND COMPOSITIONS FOR ADMINISTERING A SPECIFIC WAVELENGTH PHOTOTHERAPY

Applied Biology, Inc., I...

1. A method of treating a human patient suffering from psoriasis, vitiligo, atopic dermatitis, and/or pruritis, comprising:delivering, from ambient solar radiation, a dose of EMR to skin of a human subject by:
covering a region of the skin with a topical composition;
exposing the human subject to the ambient solar radiation for a predetermined period of time to generate an erythemally weighted irradiance therapeutic response; and
stopping the exposure of the human subject to the ambient solar radiation after the passage of the predetermined period of time;
wherein the topical composition comprises:
a cosmetic-grade carrier suitable for application to the human skin;
a first compound, suitable for application to human skin, which blocks more total radiation within wavelength range B (280 to 300 nm) than it blocks in wavelength range A (300 to 320 nm); and
a second compound, suitable for application to human skin, which blocks more total radiation within wavelength range C (320 to 340 nm) than it blocks in wavelength range A
wherein:
the topical composition blocks a percentage PFB of radiation in wavelength range B that is greater than a percentage PFA of radiation blocked in wavelength range A,
PFA is defined as:

PFB is defined as:

the topical composition blocks a percentage PFC of radiation in wavelength range C (320 to 340 nm) that is greater than PFA, wherein PFC is defined as:

PFC?PFA is at least about 5%; and
? is a wavelength of radiation, I(?) is an intensity of radiation according to solar irradiance standard ASTM G177-03 passing through the topical composition at a given wavelength in W/m2/nm, T(?) is the mean transmittance of a topical composition determined using the methodology outline in the US FDA Broad Spectrum Test (21 CFR 201.327(j), Jul. 5, 2011), and w(?) is a weighting function defined as:

PFB?PFA is at least about 10%; and
further wherein the first compound and the second compound are present in amounts and in a ratio such that the topical composition has an absorbance spectra forming a spectra valley defined by a wavelength range from 306 nm to 315 nm, the spectra valley allowing passage of light to generate the erythemally weighted irradiance therapeutic response,
wherein the topical composition comprises 4% hesperidin by weight percent and 1.125% or 2.5% diethylamino hydroxybenzoyl hexyl benzoate by weight percent.

US Pat. No. 10,111,811

AIR-COOLING MICRO DROP PILL CAPSULE PRODUCTION LINE

TASLY PHARMACEUTICAL GROU...

1. An air-cooling micro drop pill capsule production line comprising a drop pill system, an air-cooling circulation system and a control system,the drop pill system comprising a molten material tank and a dripper connected thereto, a vibration apparatus which drives the dripper to vibrate up and down is arranged between the molten material tank and the dripper, the vibration apparatus configured to generate a vibration shear force which cuts liquor flowing out from the dripper into drops, and forms drop pills after the drops fall into the air-cooling circulation system and are cooled,
an online monitoring apparatus arranged on the dripper, and comprising a pulse signal emission mechanism with an emission frequency which is the same as a vibration frequency of the vibration apparatus,
the control system configured to control and regulate a dropping parameter according to a monitoring result of the online monitoring apparatus,
the air-cooling circulation system comprising a cooling duct and a refrigerating apparatus connected to the cooling duct configured to refrigerate the cooling duct, wherein an interlayer is arranged outside the cooling duct and a lower part of the interlayer is configured to communicate with an interior of the cooling duct;
the refrigerating apparatus comprising a cooling air refrigerating apparatus and a cold trap refrigerating apparatus, wherein the cooling air refrigerating apparatus comprises a freezer, an air outlet of the freezer and a cooling air inlet of the cooling duct being communicated with each other such that cooling air rises circularly in an inner chamber of the cooling duct;
wherein the cold trap refrigerating apparatus comprises: a refrigerant storage tank containing a refrigerant, a refrigerator refrigerating the refrigerant in the refrigerant storage tank, and a heat exchanger, a refrigerant outlet of the refrigerant storage tank being connected to a refrigerant inlet arranged on an upper part of the interlayer such that the refrigerant is transferred into the interlayer through the refrigerant inlet, then transferred from the upper part of the interlayer to the lower part of the interlayer and then to the inner chamber of the cooling duct; the refrigerant configured to rise circularly together with the cooling air in the inner chamber of the cooling duct simultaneously, and then be discharged or recycled through a top of the cooling duct
the air-cooling circulation system further comprising a gas recycling apparatus including a first valve, a second valve, a gas recycling machine and a separator, one end of a duct controlled by the first valve being configured to communicate with the cooling duct, and another end thereof being configured to communicate with atmosphere; one end of a duct controlled by the second valve being configured to communicate with the cooling duct, and another end thereof being connected to the separator via the gas recycling machine;
the gas recycling machine further including a gas discharging pipe, a vortex blower, a gas recycling pipe and a gas recycling box, and when the second valve is opened, the vortex blower operates to extract gas in the cooling duct through the gas discharging pipe and to discharge gas collected by extraction into the gas recycling box through the gas recycling pipe.

US Pat. No. 10,111,797

DEVICE FOR HEIGHT ADJUSTMENT OF AN OPERATING TABLE

MAQUET GMBH, Rastatt (DE...

1. A device for height adjustment of an operating table, including a lifting carriage which is movable relative to a chassis of the operating table, including a primary guide having a first longitudinal axis (L1) about which the lifting carriage is rotatable, including a secondary guide having a second longitudinal axis (L2), and including a guide which is connected to the chassis of the operating table and which has a contact area in which the guide contacts the secondary guide in a contact area of the secondary guide, wherein the primary guide and the secondary guide serve for guiding a lifting motion of the lifting carriage within an adjustment range of the lifting carriage parallel to the first longitudinal axis (L1), wherein a plane (E) extending perpendicular to the first longitudinal axis (L1) and through the guide has a first point of intersection (S1) with the first longitudinal axis (L1) and a second point of intersection (S2) with the second longitudinal axis (L2), wherein the position (P1, P2) of the second point of intersection (S2) changes by a displacement distance during the lifting motion of the lifting carriage within the adjustment range thereof, and wherein the connection between the guide and the chassis permits a compensating motion of the guide such that the contact area of the guide is shiftable by said displacement distance.

US Pat. No. 10,111,784

DEVICE FOR PRODUCING DISPOSABLE WEARABLE ARTICLE AND METHOD FOR PRODUCING DISPOSABLE WEARABLE ARTICLE

Zuiko Corporation, Setts...

1. A device for producing a disposable wearable article, comprising:a doubling unit provided in a line for continuously conveying a sheet and configured to double the sheet together with an absorber such that opposite side edges of the sheet having the absorber arranged thereon are proximate to or overlapped with each other; and
a joining/cutting unit provided in the line and configured to join parts of the doubled sheet at opposite sides of a crotch part having the absorber arranged thereon and then cut the joined parts,
the joining/cutting unit including a drum having a peripheral surface and rotatable with the doubled sheet placed on the peripheral surface, at least one joining mechanism configured to join the parts of the doubled sheet at the opposite sides of the crotch part between the joining mechanism and the drum, a cutting mechanism arranged downstream of the joining mechanism in a rotating direction of the drum and configured to cut the parts of the sheet joined by the joining mechanism between the cutting mechanism and the drum, a claw member mounted on the drum to be vertically movable with respect to the peripheral surface of the drum, and a vertically moving cam mechanism configured to move the claw member downward to press a part of the sheet between the crotch parts against the peripheral surface of the drum on a side upstream of the at least one joining mechanism in the rotating direction of the drum and move the claw member upward to release the pressing on a side downstream of the cutting mechanism in the rotating direction of the drum,
the vertically moving cam mechanism including a cam disc having an eccentric cam groove, facing a side surface of the drum and coaxially arranged with the drum and a cam follower provided on the claw member and configured to be engaged with the eccentric cam groove so that the claw member vertically moves according to the rotation of the drum, and
the joining/cutting unit further including a phase adjusting mechanism capable of adjusting a phase of the eccentric cam groove with respect to the drum.

US Pat. No. 10,111,783

SILICA FIBER COMPOSITION AND METHOD OF USE

American Nano, LLC, Clem...

25. A method for making and using a silica fiber composition, the method comprising:preparing a sol that contains 70% to 90% tetraethyl orthosilicate (TEOS) by weight, 12% to 25% ethanol by weight, 1% to 10% water by weight, and an acid catalyst;
transitioning the sol to a sol-gel for 2 to 7 days under conditions where humidity is within the range of 40% to 80%, and the temperature is within the range of 50 to 90° F.;
electrospinning the sol-gel into a silica fiber mat; and
combining at least a portion of the silica fiber mat with a liquid or gelatinous composition.

US Pat. No. 10,111,781

EAR WARMER WITH A SUBSTANTIALLY CONTINUOUS SURFACE

180s, Inc., Baltimore, M...

1. An ear warmer frame, comprising:a band having an upper surface and an end portion having an end surface; and
an ear member having an upper surface and an end portion movably coupled to the first end portion of the band so that the ear member can be pivoted between a first position relative to the band and a second position relative to the band, the end portion of the ear member including an end surface,
when the ear member is in the first position, an ear member axis nonparallel to a band end portion axis,
when the ear member is in the second position, the ear member axis substantially parallel to the band end portion axis and at least a portion of the end surface of the end portion of the band abutting at least a portion of the end surface of the ear member and the upper surface of the band portion and the upper surface of the ear member forming a substantially continuous surface.

US Pat. No. 10,111,771

BARIATRIC DEVICE AND METHOD FOR WEIGHT LOSS

Apollo Endosurgery US, In...

1. A bariatric device for placement into a stomach to achieve weight loss, comprising:a. a cardiac element, the cardiac element comprising:
i. a contact member having a shape of a portion of a tapered side surface of a frustocone which extends longitudinally about a longitudinal axis from a first end having a smaller diameter to a second end having a larger diameter, the portion of the tapered side surface being circumferentially discontinuous about the longitudinal axis, the contact member being adapted to contact at least one-third of a circumference of a cardia, the contact member being constructed of materials flexible enough to be compressed for placement and expanded for operation; and
ii. a stiffening member inside the contact member that can be compressed for placement and will cause the contact member to substantially return to and maintain its desired shape in the stomach after the cardiac element is expanded for operation;
b. a pyloric element, the pyloric element comprising:
i. a second contact member adapted to engage a pyloric region of the stomach, sized to prevent the pyloric element from passing through a pyloric valve of the stomach, the second contact member being constructed of materials flexible enough to be compressed for placement and expanded for operation; and
ii. a second stiffening member inside the second contact member that can be compressed for placement and will cause the second contact member to substantially return to and maintain its desired shape in the stomach after the pyloric element is expanded for operation; and
iii. the pyloric element defines an opening sufficiently sized to allow chyme to pass through to the pyloric valve;
c. a connecting element coupled with the pyloric element and the cardiac element, constructed of resilient shape-holding material and shaped so that it causes the cardiac element to at least intermittently contact an upper stomach.

US Pat. No. 10,111,757

DEVICES AND METHODS FOR SPINAL STABILIZATION AND INSTRUMENTATION

Cogent Spine, LLC, San D...

1. A device sized to be at least partially implanted within an intervertebral disc space, the device comprising:a first member that comprises:
(i) a first top surface and an opposing first bottom surface that are connected by at least a first side surface;
(ii) a first internal channel extended along an axis extended from said first top surface to the opposing first bottom surface;
(iii) a first front surface and a first back surface, the first member extended from said first front surface to the first back surface along a first longitudinal axis; and
(iv) a second internal channel extended from said first back surface to intersect said first internal channel;
a second member that comprises:
(i) a second top surface and an opposing second bottom surface that are connected by at least a second side surface; and
(ii) a second front surface and a second back surface, the second member extended along a second longitudinal axis from the second front surface to the second back surface; and
a linkage that comprises:
(i) a first portion that is configured to be at least partially received within said first internal channel of the first member, and is sized to translate therein; and
(ii) a second portion extended away from the first portion along a third longitudinal axis of the linkage, said second portion being at least partially received within said second internal channel of the first member;
wherein the device is configured to transition from a first configuration to a second configuration, the first configuration comprising:
(i) said first back surface of the first member positioned to face said second front surface of the second member; and
(ii) the third longitudinal axis of the second portion of the linkage positioned to be at least one of parallel or colinear to said first longitudinal axis of the first member; and
the second configuration comprising:
(i) the third longitudinal axis of the second portion of the linkage positioned non-parallel and non-colinear to said first longitudinal axis of the first member; and
wherein said transition between the first configuration and the second configuration produces movement of said linkage relative to said first member, said movement comprising:
(i) a rotation of said first portion of the linkage around the axis that extends from said first top surface to said opposing first bottom surface of the first member; and
(ii) a translation of the first portion of the linkage within said first internal channel of the first member.

US Pat. No. 10,111,752

CRANIOPLASTY PLATE

UNIVERSITY OF IOWA RESEAR...

1. A cranioplasty plate, comprising: a body adapted to cover a skull opening exposing the brain and having opposite upper and lower surfaces and a perimeter edge; a gasket on the lower surface of the body adjacent the perimeter to space the body apart from the skull; the gasket being adapted to shrink over time so that the body settles onto the skull;elastic fasteners fixed to the body and extending radially outward; and
cranial screws adapted to fix the elastic fasteners to the skull;
whereby the elastic fasteners pull the body towards the skull as the gasket shrinks over time.

US Pat. No. 10,111,750

METHOD AND APPARATUS FOR THERAPY OF AORTIC VALVE

Jeko Metodiev Madjarov, ...

1. A device for supporting a valve annulus comprising:a plurality of spaced apart support members configured to be sutured to tissue surrounding a valve opening so as to support leaflets of the valve to promote sufficient closure of the leaflets;
a connecting member extending between and connecting the support members; and
at least one adjustor engaged with the connecting member and configured to modify a length of the connecting member between two adjacent support members,
wherein each support member comprises at least two channels extending through at least a portion of a length of the respective support member at different heights with respect to an overall thickness of the respective support member,
wherein each channel is configured to receive a portion of the connecting member therethrough, wherein each support member comprises a passageway between the at least two channels, and
wherein each passageway is configured to allow selection of one of the channels for receipt of the connecting member such that the device is configured to be adjusted in at least two dimensions to support the valve leaflets and promote sufficient closure of the leaflets.

US Pat. No. 10,111,680

THERAPEUTIC ULTRASOUND SYSTEM

Flowcardia, Inc., Tempe,...

1. An ultrasound catheter comprising:an elongated catheter body having a proximal end, a distal end and at least one lumen extending longitudinally therethrough;
a proximal housing that is coupled to the proximal end of the elongated catheter body, the proximal housing having a distal bore;
an ultrasound transmission member extending longitudinally through the lumen of the catheter body;
a sonic connector positioned on the proximal end of the ultrasound transmission member for connecting the ultrasound transmission member to a separate ultrasound generating device at a connection location, the sonic connector comprising a proximal section for connection to the separate ultrasound generating device, and a front portion which connects to the proximal end of the ultrasound transmission member;
and
an absorber retained inside the distal bore of the proximal housing and which substantially surrounds the ultrasound transmission member.

US Pat. No. 10,111,669

FLUOROSCOPY-INDEPENDENT, ENDOVASCULAR AORTIC OCCLUSION SYSTEM

THE REGENTS OF THE UNIVER...

1. A vessel occlusion system for occluding a thoracic artery of a patient between the left subclavian artery and an aortic bifurcation to reduce blood flow to the patients extremities, the system comprising:a balloon shaft including a distal end portion and a proximal end portion, the proximal end portion including a port, the balloon shaft also including pre-calibrated length indicia on an external surface;
an occlusion balloon connected to the distal end portion, the port being in fluid communication with the occlusion balloon;
a balloon inflation lumen extending along a length of the balloon shaft, the balloon inflation lumen being in fluid communication with the balloon and the port;
a curved tip at the distal end portion, the curved tip configured to limit perforation of vessels as the balloon shaft is advanced through blood vessels of the patient toward and through the target blood vessel; and
a nomogram correlating a first distance between at least two externally identifiable boney anatomical landmarks of humans of a pool of humans and a second distance from an insertion puncture to the predetermined location of the humans, wherein a reference distance between the at least two externally identifiable external boney anatomical landmarks of the patients torso, the nomogram configured to enable a comparison of a measurement on the patient to the first distance on the nomogram to determine the correlated second distance such that the predetermined location is the determined second distance from the insertion puncture and the occlusion balloon is to be inserted into the patient and positioned at the predetermined location within the target blood vessel without using fluoroscopy, the pre-calibrated length indicia providing an indication of an insertion distance of the occlusion balloon from the insertion puncture, the nomogram also including a listing of a diameter of the aorta.

US Pat. No. 10,111,615

SLEEP SCORING BASED ON PHYSIOLOGICAL INFORMATION

Fitbit, Inc., San Franci...

1. A method of assessing sleep quality of a user at an electronic device having one or more processors and a non-transitory computer readable storage medium, the method comprising:receiving one or more signals indicating an attempt by the user to fall asleep;
receiving physiological information associated with the user including at least one sleeping heart rate, the physiological information generated by one or more physiological sensors;
determining respective values for one or more sleep quality metrics based at least in part on the physiological information and at least one wakeful resting heart rate of the user; and
determining a unified score for sleep quality of the user, based at least in part on the respective values of the one or more sleep quality metrics.

US Pat. No. 10,111,463

COMBUSTIBLE HEAT SOURCE HAVING A BARRIER AFFIXED THERETO AND METHOD OF MANUFACTURE THEREOF

Philip Morris Products S....

1. A combustible heat source for a smoking article comprising:a barrier affixed to an end face of the combustible heat source; and
a thermally-activated adhesive provided between the end face of the combustible heat source and the barrier,
wherein the combustible heat source is a combustible carbonaceous heat source and comprises an ignition aid.

US Pat. No. 10,111,445

PROCEDURE FOR PREPARING PREMIUM COCKTAIL BERRIES

Lounge Attire LLC, Shell...

1. A cold process of preparing and preserving whole cranberries to result in preserved cranberries having an appearance that is close to natural cranberries, comprising:selecting a quantity of whole cranberries;
ensuring the temperature of the whole cranberries at no time during the process exceeds 70° F.;
at no time freezing the whole cranberries;
measuring the Brix of the whole cranberries in ° Bx;
preparing a syrup with no more than 10% sugar;
adjusting the syrup to within ±1° Bx of the whole cranberries;
adding a preservative to the syrup or reducing the pH;
agitating the syrup in a tank;
filling jars with the whole cranberries and syrup;
capping, rinsing and labelling the jars, and
wherein during the entire process neither the syrup nor the cranberries are heated which ensures that the preserved cranberries have an appearance that is close to natural cranberries.

US Pat. No. 10,111,400

CLAW FOR A MILKING MACHINE

DELAVAL HOLDING AB, Tumb...

1. A claw (C) for a milking machine, comprising:an enclosure having an upper part (1) and a lower part (2) that together enclose an inner space (3) for a milk flow during a milking operation, the enclosure having a center axis (x) extending through the upper part (1) and the lower part (2), the center axis (x) defining a height direction of the enclosure,
wherein the lower part (2) is detachably connected to the upper part (1) along a connection plane (p),
wherein the upper part (1) comprises i) an upper end (5) defining an upper end point (5?), ii) an upper wall (16) adjoining the upper end (5), and iii) a lower annular end (7) at a periphery of the claw (C) in the connection plane (p),
wherein the lower part (2) comprises a bottom surface (4) facing the inner space (3) with the center axis (x) extending through the bottom surface (4),
wherein the lower part (2) is rotationally symmetric with respect to an axis (x?) of rotation being perpendicular to the connection plane (p),
wherein the center axis (x) is non-coincident with the axis (x?) of rotation, and
wherein the connection plane (p) is inclined with respect to the center axis (x) such that the enclosure has i) a first height at a first peripheral position (p1) of the upper part, and ii) a second height at a second peripheral position (p2) of the upper part, the second peripheral position (p2) being diametrically opposite to the first peripheral position (p1), the first height being greater than the second height; and
an outlet nipple (12) extending from the end (5) and outwardly with respect to the center axis (x), the outlet nipple (12) providing a milk discharge path from the inner space (3), the outlet nipple (12) configured for connection to a long milk conduit (13) for discharge of milk from the inner space (3), wherein,
the upper wall (16) further comprises a plurality of inlet members (8), each inlet member (8) configured for receiving a respective short milk conduit (9), and
the lower annular end (17) comprises a lower side wall (17) adjoining a lower part of the upper wall (16) to the periphery of the claw (C) in the connection plane (p).
US Pat. No. 10,115,963

NEGATIVE ELECTRODE MATERIAL FOR SECONDARY BATTERY AND SECONDARY BATTERY USING THE SAME

LG Chem, Ltd., (KR)

1. A negative electrode material for a secondary battery capable of intercalating and de-intercalating lithium, wherein the negative electrode material consists of alloy particles including a silicon phase and a metal phase, and a carbonaceous material, whereinthe silicon phase has a crystallite size of 10 nm or less,
the metal phase comprises two or more kinds of metals alloying with silicon but not with lithium,
the carbonaceous material has a crystallite size of 30 nm or more, and
the carbonaceous material is present on a surface of, or within the alloy particles.
US Pat. No. 10,111,868

ANTINEOPLASTIC COMBINATIONS CONTAINING HKI-272 AND VINORELBINE

WYETH LLC, New York, NY ...

1. A method for treating a neoplasm in a patient in need thereof, consisting of administering to the patient:i) 100-300 mg of (E)-N-{4-[3-chloro-4-(2-pyridinylmethoxy)anilino]-3-cyano-7-ethoxy-6-quinolinyl}-4-(dimethylamino)-2-butenamide, or a pharmaceutically acceptable salt thereof; and
ii) vinorelbine, or a pharmaceutically acceptable salt thereof;wherein the neoplasm:a) overexpresses or amplifies HER-2; and
b) is selected from the group consisting of prostate cancer, myeloma, head and neck cancer, transitional cell carcinoma, and small cell and large cell neuroendocrine carcinoma of the uterine cervix.
US Pat. No. 10,111,932

COAGONISTS OF GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AND NEUROPEPTIDE Y2 RECEPTOR

Syracuse University, Syr...

1. A composition for simultaneously treating obesity and insulin deficiency, comprising a peptide sequence selected from the group consisting of HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3), HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4), IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2 (SEQ ID NO: 15), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2 (SEQ ID NO: 16), and HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY (SEQ ID NO: 17).
US Pat. No. 10,112,834

SYNTHESIS OF AMMONIUM DINITRAMIDE, ADN

TOTALFOERSVARETS FORSKNIN...

1. Method for producing ammonium dinitramide characterized in that guanylureadinitramide is reacted with an ammonium source in the absence of potassium so that an ion-change takes place and ammonium dinitramide is formed.

US Pat. No. 10,117,182

COMMUNICATING CONTROL MESSAGES THAT INDICATE FREQUENCY RESOURCE INFORMATION TO RECEIVE DATA

InterDigital Technology C...

1. A method performed by a wireless device, the method comprising:receiving, by the wireless device, a wireless signal that includes a plurality of control messages, wherein each control message from the plurality of control messages points to a different message and indicates frequency resource information and coding information of data for each respective different message;
determining, by the wireless device, that a control message from the plurality of control messages corresponds to the wireless device; and
receiving, by the wireless device, the data pointed to by the control message that corresponds to the wireless device.

US Pat. No. 10,117,129

METHOD AND APPARATUS FOR BROADCASTING USING CHANNEL INFORMATION

Samsung Electronics Co., ...

1. An electronic device, comprising:a wireless communication module; and
a processor configured to:
transmit a broadcasting signal using at least one first channel predetermined among a plurality of channels, through the wireless communication module,
identify at least one channel used to transmit at least one signal by at least one external device, using the wireless communication module,
determine whether the at least one channel overlaps the at least one first channel,
determine at least one second channel among a remainder of the plurality of channels when the at least one channel overlaps the at least one first channel, and
transmit another broadcasting signal using the at least one second channel, through the wireless communication module.

US Pat. No. 10,117,109

SYSTEM AND METHOD FOR DETERMINING OPTIMAL PLACEMENT OF TELECOMMUNICATION EQUIPMENT

Tejas Networks, Ltd., Ka...

1. A method to determine placement of one or more telecommunication equipment comprising the steps of:constructing, at a computing device, based on given network parameters and service requirements of a network, using a genetic algorithm, an initial population of possible solutions that are each encoded as a chromosome, wherein
each solution of the possible solutions pertains to a specific deployment of the one or more telecommunication equipment;
iteratively performing, at said computing device, crossover operations comprising selecting two chromosomes and exchanging features of the two chromosomes to obtain daughter chromosomes as additional possible solutions to increase optimality of the chromosomes, based on a combination of cost of placement of the one or more telecommunication equipment and number of telecommunication equipment to be placed as well as the length of the paths over which traffic is routed; and
identifying, at the computing device, based on the iterative crossover operations, a most optimal chromosome as a final solution for the placement of the one or more telecommunication equipment to minimize network cost, maximize network utilization, and meet Service Level Agreements (SLA) for a given network topology and demand requirements.

US Pat. No. 10,117,080

APPARATUS AND METHOD OF DETERMINING AN OPEN STATUS OF A CONTAINER USING RFID TAG DEVICES

Walmart Apollo, LLC, Ben...

1. A radio frequency identification (RFID) device comprising:a first portion of a container, the container being in a closed orientation and configured to be moved into an open orientation by a user;
a second portion of the container removably coupled to the first portion;
a first RFID tag fixed to the first portion and configured to communicate only in a near field of RFID communication;
a conductive element implemented at the second portion and located in proximity to the first RFID tag when the container is in the closed orientation and configured to function as a far field antenna for the first RFID tag such that the first RFID tag is readable by an RFID reader in a far field of RFID communication when the container is in the closed orientation; and
a second RFID tag fixed to the first portion such that the second RFID tag is shielded by the second portion and is not readable by the RFID reader when the container is in the closed orientation;
wherein the first portion and the second portion are configured such that upon a user action to open the container at least a first amount, the first portion and the second portion move relative to each other decoupling the conductive element from the first RFID tag such that the first RFID tag is no longer readable in the far field indicating a first open status of the container; and
wherein the first portion and the second portion are further configured such that upon a user action to open the container at least a second amount, the first portion and the second portion move relative to each other such that the second RFID tag is no longer shielded and is readable by the RFID reader indicating a second open status of the container.

US Pat. No. 10,117,059

WIRELESS BRIDGE HARDWARE SYSTEM FOR ACTIVE RFID IDENTIFICATION AND LOCATION TRACKING

General Electric Company,...

1. A beacon badge comprising:a motion sensor to transition a state of the beacon badge from a low power utilization state to a normal power utilization state when motion of the beacon badge is determined;
a wireless transceiver to, when activated by the motion sensor in the normal power utilization state, receive a beacon message; and
a proximity engine to manage, when activated by the motion sensor in the normal power utilization state, the beacon message, wherein the proximity engine instructs the wireless transceiver to transmit the beacon message to a real time location (RTLS) server when a received signal strength indication (RSSI) value of the beacon message satisfies a proximity threshold and to discard the beacon message when the RSSI value of the beacon message does not satisfy the proximity threshold.

US Pat. No. 10,117,037

ORIENTATION-BASED PLAYBACK DEVICE MICROPHONE SELECTION

SONOS, INC., Santa Barba...

1. A playback device comprising:a set of microphones;
an orientation sensor;
one or more processors; and
tangible, non-transitory computer-readable medium having stored thereon instructions executable by the one or more processors to cause the playback device to perform functions comprising:
determining that the playback device is in a vertical orientation based on an indication from the orientation sensor that the longest side of the playback device is substantially perpendicular to a surface on which the playback device is positioned;
selecting a subset of the set of microphones for sound input detection based on the determination that the playback device is in the vertical orientation;
detecting, via the selected subset of the set of microphones, a sound input;
processing the sound input detected via the selected subset of the set microphones; and
executing one or more commands contained in the processed sound input.

US Pat. No. 10,117,035

ACTIVE OUTPUT DRIVER SUPPLY COMPENSATION FOR NOISE REDUCTION

SEMICONDUCTOR COMPONENTS ...

19. An audio noise reduction method, comprising:taking a first measurement of a power source voltage at a first time;
taking a second measurement of said power source voltage at a second time;
calculating a rate of change based on said first and second voltage measurements;
generating an amplitude correction signal based at least partially on the calculated rate of change and a target load voltage;
generating a switch control signal using the amplitude correction signal and an audio signal; and
controlling one or more switches using the switch control signal to regulate the provision of power to a load.

US Pat. No. 10,116,617

SYSTEM ARCHITECTURE FOR DMZ EXTERNAL IP ADDRESSES

CardinalCommerce Corporat...

1. A method for enhancing data security, comprising:with a first demilitarized zone (DMZ) comprising a web server:
receive, via a first firewall, a request for an e-commerce service from a host of an external network;
with a data environment comprising a server:
receive, via a second firewall, a request to offload processing from the first DMZ, wherein the request to offload processing is associated with offloading processing of the request for the e-commerce service from the host of an external network; and
communicate, via the second firewall, a domain name system (DNS) request for a hostname corresponding to the host of the external network to a host of the data environment based on receiving the request to offload processing from the first DMZ;
with a second DMZ comprising a dynamic name service virtual IP gateway (DVG):
receive, via the second firewall, the DNS request for the hostname corresponding to the host of the external network from a host of the data environment;
allocate an internet protocol (IP) address of the second DMZ in response to receiving the DNS request;
determine an IP address of the host of the external network from the hostname by performing a DNS lookup of the hostname corresponding to the host of the external network, wherein determining the IP address of the host of the external network comprises performing the DNS lookup of the hostname corresponding to the host of the external network with a DNS server of the external network;
map the allocated IP address of the second DMZ to the determined IP address of the host of the external network; and
return, via the second firewall, the allocated IP address of the second DMZ to the host of the data environment in response to the DNS request;
with the data environment:
receive, via the second firewall, the allocated IP address of the second DMZ to the host of the data environment in response to the DNS request; and
communicate, via the second firewall, data associated with the request for the e-commerce service to the second DMZ; and
with the second DMZ:
communicate, via a third firewall, data associated with the request for the e-commerce service to the host of the external network after receiving the data associated with the request for the e-commerce service from the host of the data environment.

US Pat. No. 10,116,596

PERSONALIZING DATA SYSTEM COMPONENTS AND DATA SOURCES AS CHATBOTS IN A GROUP CHAT SESSION

International Business Ma...

1. A computer program product, the computer program product comprising a computer readable storage medium having program code embodied therewith, the program code executable by at least one processor to perform:providing, by the at least one processor, a social media gateway interface with a chat adapter for a chat application, wherein the chat adapter comprises (1) an Extract Transform and Load (ETL) job chatbot for accessing a data system and (2) message mapping definitions, wherein the data system comprises an ETL server;
receiving, by the at least one processor, from a group chat server, a request to start a chat session;
creating, by the at least one processor, a chat session between a mobile chat participant using the chat application and the ETL job chatbot; and
in response to receiving a chat message from the mobile chat participant,
converting, by the at least one processor, the chat message to a method invocation for the chatbot using the message mapping definitions;
executing, by the at least one processor, a request of the converted chat message with the chatbot to generate a response chat message by:
selecting an interface of a plurality of interfaces of the data system based on the converted chat message, wherein the plurality of interfaces comprise a first interface to import an ETL job and a second interface to design and monitor the ETL job;
calling, by the at least one processor, the selected interface to obtain the response; and
returning, by the at least one processor, the response chat message.

US Pat. No. 10,116,446

CRYPTOGRAPHIC IGNITION KEY (CIK) EMBEDDED IN REMOVABLE DATA CARTRIDGE

GE Aviation Systems LLC, ...

1. A removable data storage device, comprising:a housing comprising:
a data memory configured to store data subject to cryptographic processing;
at least one connector configured to be removably engaged with a host system;
a cryptographic ignition key device separate from the data memory, and comprising one or more cryptographic ignition keys to be transferred to the host system via a cryptographic ignition key interface for authentication of users;
a data memory interface in communication with the data memory and configured to communicate data subject to cryptographic processing to the host system via the at least one connector; and
the cryptographic ignition key interface configured to communicate the one or more cryptographic ignition keys to the host system to authenticate a user of the host system,
wherein the cryptographic ignition key and the data are transferred to the cryptographic ignition key device and the data memory of the removable data storage device, respectively, at a remote terminal, and
wherein once the user is authenticated at the host system, then the data from the removable data storage device is transferred to the host system.

US Pat. No. 10,116,386

METHODS FOR DETERMINING RECEIVER COUPLING EFFICIENCY, LINK MARGIN, AND LINK TOPOLOGY IN ACTIVE OPTICAL CABLES

SAMTEC, INC., New Albany...

1. A method of determining link topology of a communication system including channels connecting corresponding transmitters and receivers, each of the channels including a light source, a photodetector optically connected to the light source, and a transimpedance amplifier connected to an output of the photodetector, wherein the transimpedance amplifier squelches its output when optical power detected by the photodetector is below a threshold optical power, the method comprising:selecting a pattern of optical powers of the light sources in a test transmitter to be either above the threshold optical power or below the threshold optical power; and
determining which receiver is connected to the test transmitter by matching a pattern of squelched and non-squelched transimpedance amplifier outputs in the receiver with the pattern of optical powers of the light sources in the test transmitter.

US Pat. No. 10,116,362

PARAMETRIC GENERATING METHOD FOR ZCZ SEQUENCE SET

ZTE Wavetone Science and ...

1. A parametric generating method for a ZCZ sequence set, comprising the following steps:(1) determining a zero correlation zone (ZCZ) sequence set to be generated, wherein the ZCZ sequence set to be generated is determined as Z(N, Q, Z), N represents a length of the ZCZ sequence, Q represents a number of the ZCZ sequences, Z represents a length of a zero correlation zone, and they meet the following relation:
N=QKL  (formula 1)
wherein K?2 represents a number of iterations, and L represents an initial sequence length;
(2) determining a limited symbol set according to the types of symbols contained in the ZCZ sequence;
(3) determining an initial non-periodic orthogonal complementary sequence set according to the ZCZ sequence set to be generated and the limited symbol set;
(4) constructing a discrete Fourier transformation (DFT) matrix by using elements in the limited symbol set based on the size of the ZCZ sequence set;
(5) constructing a unitary matrix by using the elements in the limited symbol set based on the size of the ZCZ sequence set and the number of iterations;
(6) constructing a coefficient matrix composed of any elements in the limited symbol set based on the number of the ZCZ sequence sets and the number of iterations; and
(7) using the columns of the coefficient matrix respectively as the coefficients of each sequence in the ZCZ sequence set, finally generating different ZCZ sequence sets by using a method of zero filling the tails of weighted coefficients in two iterative combination modes.

US Pat. No. 10,116,340

WIDEBAND LOW DISTORTION POWER AMPLIFIER

TEXAS INSTRUMENTS INCORPO...

1. A circuit comprising:a frequency oscillator for generating a fundamental signal frequency;
a frequency divider coupled to the frequency oscillator and configured to divide the fundamental signal frequency to generate one or more phases of the fundamental signal frequency;
a power amplifier coupled to the frequency divider, respective amplifier stages of the power amplifier configured to receive the fundamental signal frequency and the one or more phases; and
an output coupled to the respective amplifier stages of the power amplifier.

US Pat. No. 10,116,332

METHOD FOR CONFIGURING CIRCULAR BUFFER INCLUDING OUTER CODE PARITY AND APPARATUS THEREFOR

LG ELECTRONICS INC., Seo...

1. A method for configuring a circular buffer in a wireless communication system, the method performed by a user equipment (UE) and comprising:generating a code block comprising a payload, a first outer code parity, and a second outer code parity from an input signal based on an outer code in a higher layer;
generating a codeword from the code block based on an inner code in a physical layer; and
configuring a circular buffer comprising the codeword and one or more second outer code parities,
wherein the first outer code parity is generated based on a first portion of the payload,
wherein the one or more second outer code parities, to which an encoding is not applied in the physical layer, are generated based on a second portion of the payload,
wherein at least a part of the second portion is different from the first portion,
wherein the codeword comprises the payload, the first outer code parity, and an inner code parity generated from at least a part of the code block based on the inner code, and
wherein a number of the one or more second outer code parities in the circular buffer is determined according to a maximum size of the codeword or an amount of resources for transmission.

US Pat. No. 10,116,295

VOLTAGE COMPARING CIRCUIT AND VOLTAGE COMPARING METHOD

PixArt Imaging Inc., Hsi...

1. A voltage comparing circuit, comprising:a comparator, comprising a first comparing terminal and a second comparing terminal;
a time interval computing unit;
a switch module, coupled to the first comparing terminal and the second comparing terminal, comprising a reference voltage terminal coupled to a reference voltage source, and comprising a first input terminal and a second input terminal;
a first current source, comprising a first charging terminal coupled to the first input terminal and the second input terminal;
a first capacitor, coupled to the first current source at the first charging terminal; and
a capacitance adjusting unit, coupled to the first capacitor.

US Pat. No. 10,116,254

SOLAR-POWERED VENDING MACHINE AND RELATED APPARATUS AND METHODS

1. A solar-powered vending machine comprising:a vending machine; and
a photovoltaic (PV) panel assembly connected to the vending machine having a top and a plurality of sides extending downwardly therefrom, the PV panel assembly including:
a panel subassembly having a plurality of foldably interconnected PV panels to expand to a deployed width greater than a vending machine width and collapse to a stowed width less than or approximately equal to the vending machine width; and
a mounting subassembly connecting the panel subassembly to the vending machine and supporting the plurality of foldably interconnected PV panels for movement between a deployed position, in which the plurality of foldably interconnected PV panels are supported above the top of the vending machine unfolded to the deployed width for sun exposure, and a stowed position, in which the plurality of foldably interconnected PV panels extend downwardly adjacent one of the sides of the vending machine folded to the stowed width;
wherein, in the deployed position, at least one of the plurality of foldably interconnected PV panels is supported directly above the top of the vending machine;
wherein the mounting subassembly comprises at least one first mounting arm and at least one second mounting arm extending between the vending machine and the panel subassembly;
wherein the at least one first mounting arm includes a pair of first mounting arms and the at least one second mounting arm includes a pair of second mounting arms; and
wherein respective machine ends of each of the pair of first mounting arms are pivotably mounted to the top of the vending machine about a first pivot axis, and respective machine ends of each of the pair of second mounting arms are pivotably mounted about a second pivot axis to the one of the sides of the vending machine down which the plurality of foldably interconnected PV panels extend in the stowed position.

US Pat. No. 10,116,230

METHODS, CIRCUITS AND ARTICLES OF MANUFACTURE FOR CONFIGURING DC OUTPUT FILTER CIRCUITS

Eaton Capital Unlimited C...

1. A method of operating an AC to DC converter circuit, the method comprising:changing a configuration of a DC output filter circuit by switching an inductive circuit element from being in series with a capacitive circuit element to being bypassed and to maintain the capacitive circuit element across an output of the DC output filter circuit, to reshape a current waveform in a rectifier circuit, included in the AC to DC converter circuit, based on an operating efficiency of the AC to DC converter circuit;
wherein changing a configuration of a DC output filter circuit comprises:
configuring the DC output filter circuit so that the current waveform includes a peak current over a time interval; and
changing the configuration of the DC output filter circuit to reduce the peak current and to extend the current waveform to a time beyond the time interval;
wherein configuring the DC output filter circuit comprises configuring the DC output filter circuit to include the capacitive circuit element, wherein changing the configuration of the DC output filter circuit comprises switching the inductive circuit element into series with the capacitive circuit element.

US Pat. No. 10,116,220

SYSTEMS AND METHODS FOR PROTECTING POWER CONVERSION SYSTEMS UNDER OPEN AND/OR SHORT CIRCUIT CONDITIONS

On-Bright Electronics (Sh...

1. A system for protecting a power converter, the system comprising:an off-time signal generator configured to receive a first comparison signal and generate an off-time signal based at least in part on the first comparison signal, the first comparison signal being associated with a sensing signal and a first threshold signal, the sensing signal being associated with at least a primary current flowing through a primary winding and a switch of a power converter, the power converter being associated with a switching frequency;
wherein the off-time signal generator is further configured to, in response to the first comparison signal indicating that the sensing signal associated with at least the primary current flowing through the primary winding and the switch of the power converter is larger than the first threshold signal in magnitude, generate the off-time signal to keep the switch to be turned off for at least a predetermined period of time, the predetermined period of time extending beyond at least a beginning of a next switching period corresponding to the switching frequency.

US Pat. No. 10,116,219

APPARATUS AND EFFICIENCY POINT TRACKING METHOD FOR HIGH EFFICIENCY RESONANT CONVERTERS

Futurewei Technologies, I...

1. A system comprising:a first converter comprising:
a first input stage coupled to a power source, wherein the first input stage comprises a plurality of power switches;
a first resonant tank coupled to the plurality of power switches;
a first transformer coupled to the first resonant tank;
a first output stage coupled to the first transformer;
a first detector configured to receive a first efficiency point tracking indicator obtained from the first converter; and
a first control circuit configured to receive a first efficiency point tracking signal from the first detector and adjust a first switching frequency of the first converter based upon the first efficiency point tracking signal; and
a second converter having an second input stage connected in parallel with the first input stage of the first converter, wherein the second converter comprises:
a second resonant tank coupled between a second input stage and a second transformer;
a second detector configured to receive a second efficiency point tracking indicator obtained from the second converter; and
a second control circuit configured to receive a second efficiency point tracking signal from the second detector and adjust a second switching frequency of the second converter based upon the second efficiency point tracking signal, wherein the second switching frequency is different from the first switching frequency.

US Pat. No. 10,116,214

DC-DC CONVERTER WITH DIGITAL CURRENT SENSING

Chaoyang Semiconductor Ji...

1. A method of determining output inductor current for a DC-DC switching regulator comprising:converting an output voltage from the DC-DC switching regulator to a digital value of the output voltage using an Analog to Digital (A/D) convertor;
determining an indication of a capacitor current value based on the the digital value of output voltage from the A/D converter using current determination circuitry;
storing the indication of the capacitor current in a first latch when a high side switch in the DC-DC switching regulator is closed and current is being provided from a high voltage source connected to the high side switch or when a low side switch in the DC-DC switching regulator is closed and the DC-DC switching regulator is providing current from a low voltage source connected to the low side switch;
storing the indication of the capacitor current in a second latch when a bypass switch coupling ends of the output inductor and an output capacitor in the DC-DC switching regulator is closed and the DC-DC switching regulator is providing current from a capacitor in the DC-DC switching regulator;
summing the capacitor current values stored in the first latch and the second latch using a summer to determine an indication of output inductor current for the DC-DC switching regulator.

US Pat. No. 10,116,213

SEMICONDUCTOR MODULE AND ELECTRIC POWER CONVERSION APPARATUS

DENSO CORPORATION, Kariy...

1. An electric power conversion apparatus comprising:an IGBT made of a silicon semiconductor; and
a MOSFET made of a wide-bandgap semiconductor having a wider bandgap than the silicon semiconductor,
wherein
the IGBT and the MOSFET are connected in parallel to each other to form a semiconductor element pair,
a surface area of the IGBT is greater than a surface area of the MOSFET,
in a low-temperature state in which temperature of the semiconductor element pair is lower than in a high-temperature state, on-resistance of the MOSFET is lower than on-resistance of the IGBT at a given electric current, and
in the high-temperature state in which the temperature of the semiconductor element pair is higher than in the low-temperature state, the on-resistance of the IGBT is lower than the on-resistance of the MOSFET at the given electric current.

US Pat. No. 10,116,206

LOOP COMPENSATION CIRCUIT AND SWITCHING POWER SUPPLY CIRCUIT

Shenzhen China Star Optoe...

6. A switching power supply circuit, wherein the switching power supply circuit comprises a voltage generation circuit and a loop compensation circuit, and the loop compensation circuit comprises a voltage detection circuit, a control chip and a RC circuit, wherein:the voltage detection circuit is coupled to the voltage generation circuit, and employed to detect a variation of an output voltage of the voltage generation circuit;
the control chip is respectively coupled to the voltage detection circuit and the RC circuit, and employed to detect a response speed of the loop compensation circuit and to adjust a parameter of the RC circuit according to the response speed of the loop compensation circuit and the variation of the output voltage of the voltage generation circuit for adjusting the response speed of the loop compensation circuit;
wherein the RC circuit comprises a resistance circuit, a capacitance circuit and a switching circuit, wherein the switching circuit is respectively coupled to the control chip, the resistance circuit and the capacitance circuit, and employed to be on or off according to a control signal outputted by the control chip to adjust a resistance value of the resistance circuit and a capacitance value of the capacitance circuit;
wherein the resistance circuit comprises at least two resistances, and the capacitance circuit comprises at least two capacitances, and the switching circuit comprises at least two switching transistors;
at least one resistance in the at least two resistances is coupled to at least one switching transistor in the switching circuit in series or in parallel; at least one capacitance in the at least two capacitances is coupled to at least one switching transistor in the switching circuit in series or in parallel;
wherein the control chip comprises a control circuit and a PWM output circuit, wherein the control circuit is coupled to the voltage detection circuit, the RC circuit and the PWM output circuit, and employed to detect the response speed of the loop compensation circuit, and to control a Pulse Width Modulation PWM signal outputted by the PWM output circuit according to response speed of the loop compensation circuit and a variation of the output voltage;
the PWM output circuit comprises at least two PWM output ends, and the at least two PWM output ends are coupled to the at least two switching transistors, and employed to respectively output PWM signals to the at least two switching transistors for controlling the at least two switching transistors to be on or off; and
wherein the resistance circuit comprises a first resistance, a second resistance and a third resistance, and the switching circuit comprises a first switching transistor and a second switching transistor, wherein:
the first resistance and the first switching transistor are connected in parallel and are coupled between the control circuit and one end of the second resistance in series;
the third resistance and the second switching transistor are coupled between the control circuit and the other end of the second resistance in series;
the first switching transistor and a second switching transistor are respectively coupled to the at least two PWM output ends.

US Pat. No. 10,116,133

ELECTRICAL MEANS TO LIMIT CURRENT IN BATTERY OPERATED PATIENT-CONNECTED MEDICAL DEVICES

KONINKLIJKE PHILIPS N.V.,...

1. A system for electrically limiting leakage current in a patient-connected medical device, comprising:a first set of one or more switching devices that selectively connect a first power output of a battery compartment of the patient-connected medical device with a first power input of electronic components of the patient-connected medical device controlled directly by a first polarity of input voltage from the battery compartment; and,
a second set of one or more switching devices different from the first set of one or more switching devices that selectively connect a second power output of the battery compartment of the patient-connected medical device with a second power input of the electronic components controlled directly by a second polarity of the input voltage, wherein the first polarity is opposite the second polarity;
wherein the first and second sets of one or more switching devices are disposed on opposing sides of the battery compartment.

US Pat. No. 10,116,064

MILLIMETER-WAVE ANTENNA DEVICE AND MILLIMETER-WAVE ANTENNA ARRAY DEVICE THEREOF

NATIONAL CHUNG SHAN INSTI...

1. A millimeter-wave antenna device, comprising:a millimeter-wave substrate with through holes penetrating disposed therein and aligned in a column direction and a microstrip antenna structure formed from two metal layers disposed on and below the millimeter-wave substrate, respectively; and
a coaxial cable connector bases having a recess for holding a coaxial cable connector, wherein an internal conductor and an external conductor of the coaxial cable connector are exposed from an opening disposed at a bottom of the recess, and at least a bump portion is disposed at the coaxial cable connector bases and outside the opening of the recess;
wherein, when a top surface of the coaxial cable connector bases is coupled to a bottom surface of the millimeter-wave substrate, the internal conductor and the external conductor which are exposed from the coaxial cable connector bases are electrically connected to the microstrip antenna structure, and the at least a bump portion protrudes into the through holes, respectively, to thereby fix the coaxial cable connector bases in place;
wherein a metal layer at a middle region of the through holes and on an upper surface of the millimeter-wave substrate functions as a first metal layer of the microstrip antenna structure, and the first metal layer is disposed without going beyond the through holes.

US Pat. No. 10,116,061

BEAM STEERABLE COMMUNICATION APPARATUS

1. A beam steerable communication apparatus comprising:a focusing element with a focal plane,
a plurality of antenna elements disposed on the focal plane of the focusing element,
a beamforming network which has a plurality of antenna ports and a plurality of beamforming ports,
at least one radio frequency transceiver capable to control a phase of carrier frequency signals on its independent output, and
a baseband modem,
wherein, in said apparatus:
each antenna port of the beamforming network is coupled to at least one antenna element,
each beamforming port of the beamforming network is coupled to an independent output of a corresponding one of the at least one radio frequency transceiver, and
wherein:
a phase distribution formed on the beamforming ports is determined by baseband modem control commands to the at least one radio frequency transceiver, and
the beamforming network is adapted to combine or distribute signal power on all beamforming ports from or to at least one antenna port in accordance with said phase distribution,
wherein each radio frequency transceiver includes at least a phase shifter, a Tx/Rx switch, LNA, PA, up and down-conversion mixers, LO generation circuit, receive power combining and transmit power distribution devices.

US Pat. No. 10,116,037

ELECTRONIC DEVICE PROVIDED WITH AN INTEGRATED CONDUCTOR ELEMENT AND FABRICATION METHOD

STMicroelectronics (Alps)...

1. A method for fabricating an electronic device, comprising:producing a hole extending through a primary encapsulation block of a primary electronic device comprising a support plate, an integrated circuit chip mounted on a mounting face of the support plate and said primary encapsulation block extending over the integrated circuit chip and around the integrated circuit chip on said mounting face of the support plate, the encapsulation block having a front face parallel to the support plate, said hole at least partially revealing an electrical contact;
forming a conductive element to include a main portion and a secondary portion with a bend in the conductive element present between the main and secondary portions;
installing the formed conductive element in a position such that the main portion is carried by a front face of the primary encapsulation block and the secondary portion extends into said hole; and
electrically connecting the secondary portion to said electrical contact.

US Pat. No. 10,116,031

VERTICAL-TRANSITION STRUCTURE

NATIONAL TAIPEI UNIVERSIT...

1. A vertical-transition structure comprising:a microstrip line, comprising a substrate with an upper surface and a lower surface opposite to the upper surface, a signal line laid on the upper surface of the substrate and a ground plane laid on the lower surface of the substrate, wherein a first through hole is created next to the microstrip line and near one end of the signal line, and the first through hole penetrates through the substrate and the ground plane, and a configuration of the first through hole defines a first geometric center;
a metallic ring, placed underneath the microstrip line, and having a second through hole; and
a coaxial connector, having a center conductor, a dielectric body and an external conductor, wherein a portion of the external conductor is a mounting wall for the purpose of mechanical assembly, the center conductor comprises a first part and a second part, the first part of the center conductor is surrounded by the dielectric body, which fills the space between the first part of the center conductor and the external conductor, the second part of the center conductor extends out of the mounting wall, passing through the second through hole of the metallic ring first and then passing through the first through hole next to the microstrip line, wherein the position of the center conductor within the first through hole is eccentric with respect to the first geometric center, and at last the center conductor is connected to the signal line, and an extension direction of the center conductor is perpendicular to a longitudinal direction of the signal line;
wherein the second through hole has an inner wall, a configuration of the second through hole defines a second geometric center, wherein the second part of the center conductor of the coaxial connector passes the second geometric center of the second through hole but does not contact the inner wall of the second through hole; and
wherein the second part of the center conductor is an extended portion, the extended portion has a cross section with an area, the area of the cross section is smaller than an area enclosed by an edge of the first through hole, wherein the first through hole has an inner wall comprising a first inside wall portion and a second inside wall portion, the first inside wall portion is opposite to the second inside wall portion and is next to the end of the signal line, wherein the first geometric center is located at the center of the area enclosed by the edge of the first through hole, and the extended portion of the center conductor abuts against the first inside wall portion of the first through hole and then is connected to the end of the signal line and is far from the second inside wall portion, so as to create an eccentric structure within the first through hole.

US Pat. No. 10,116,019

ENERGY STORAGE ASSEMBLY, TEMPERATURE CONTROL DEVICE, AND MOTOR VEHICLE

AUDI AG, Ingolstadt (DE)...

1. A temperature control device for controlling at least one electrical energy store of a plurality of electrical energy stores of an energy storage assembly, with a thermally conductive spacer element being arranged between at least two electrical energy stores and having at least one area to separate the at least two electrical energy stores, said temperature control device comprising:a first heat pipe assembly including at least one heat pipe;
a second heat pipe assembly including at least one heat pipe;
a heat sink, said at least one heat pipe of the first heat pipe assembly having a condensation zone, in which a contained gaseous working medium can be condensed, said condensation zone being thermally coupled to the heat sink;
a heat source, said at least one heat pipe of the second heat pipe assembly having an evaporation zone, in which a contained liquid working medium can be evaporated, said evaporation zone being thermally coupled to the heat source,
wherein the at least one heat pipe of the first heat pipe assembly is thermally coupled with the heat sink and not any heat source, and the at least one heat pipe of the second heat pipe assembly is thermally coupled with the heat source and not any heat sink,
wherein the at least one heat pipe of the first heat pipe assembly and the at least one heat pipe of the second heat pipe assembly are thermally coupled to the spacer element, and
wherein the at least one heat pipe of the first heat pipe assembly is, at least substantially, thermally decoupled from the at least one heat pipe of the second heat pipe assembly when the first heat pipe assembly and the second heat pipe assembly are not directly physically in contact.

US Pat. No. 10,116,011

SWITCHING DEVICE FOR AN ELECTROCHEMICAL ENERGY STORE AND ENERGY STORAGE SYSTEM

Airbus Defence and Space ...

1. A switching device for an electrochemical energy store, with: a film transistor device, which includes at least one organic transistor and which is attachable in planar manner to at least one electrode of the electrochemical energy store, and which is controllable by an external voltage source and is configured as a controllable electrical resistor in series with an in internal resistance of the electrochemical energy store.

US Pat. No. 10,116,006

SPIRALLY WOULD NON-AQUEOUS ELECTROLYTE SECONDARY BATTERY HAVING INSULATING MEMBERS

Murata Manufacturing Co.,...

1. A battery, comprising:an electrode assembly which includes
a positive electrode including a cathode active material layer and a positive electrode current collector,
a negative electrode including an anode active material layer and a negative electrode current collector,
a separator,
a first insulating member including at least a material different from the separator, and
a second insulating member,
wherein the electrode assembly has a winding start end at an innermost end of the electrode assembly and a winding terminal end at an outermost circumferential end of the electrode assembly, respectively,
wherein the first insulating member is attached to the winding start end of a first exposed portion of the positive electrode current collector at the innermost end of the electrode assembly,
wherein the second insulating member is attached to the winding terminal end of a second exposed portion of the negative electrode current collector at the outermost circumferential end of the electrode assembly, and
wherein a positive electrode terminal and a negative electrode terminal are disposed at the winding start end.

US Pat. No. 10,115,969

BATTERY, ELECTRODE, BATTERY PACK, ELECTRONIC DEVICE, ELECTRIC VEHICLE, POWER STORAGE DEVICE, AND POWER SYSTEM

Murata Manufacturing Co.,...

1. A battery comprising:a positive electrode; and
a negative electrode,
wherein at least one electrode of the positive electrode and the negative electrode includes
a current collector,
a mixture layer over one main surface of the current collector, the mixture layer including a gap through which a part of the current collector is exposed,
a lead bonded to an exposed surface of the current collector exposed through the gap, and
a protective layer configured to protect the current collector, wherein the protective layer includes at least one of a resin material and a carbon material, and the protective layer is provided away from edges of the current collector and is over the exposed surface of the current collector and the protective layer interposes between an end part of the lead and the exposed surface of the current collector,
wherein the end part of the lead includes an entire end edge portion and two side edge portions of the lead, and the protective layer separates the entire end edge portion of the lead from the exposed surface of the current collector,
wherein the entire end edge portion of the lead is not in contact with the exposed surface of the current collector and at least a portion of the two side edge portions is in contact with the exposed surface of the current collector, and
wherein at least one end portion of the protective layer is positioned over the mixture layer.

US Pat. No. 10,115,953

ENERGY STORAGE APPARATUS

GS YUASA INTERNATIONAL LT...

1. An energy storage apparatus, comprising:one or more energy storage devices;
a component on which bus bars are arranged, the component comprising an insulating material;
a wiring connection component for connecting a first wiring and a second wiring, the first wiring being connected to at least one of the one or more energy storage devices; and
an attachment portion to which the wiring connection component is detachably attached,
wherein the energy storage apparatus is disposed in an energy storage pack in which an other energy storage apparatus is disposed,
wherein the wiring connection component connects the first wiring, which is connected to the wiring connection component, and the second wiring, which is connected to the wiring connection component and to the other energy storage apparatus, and
wherein the wiring connection component includes:
a connector to which the first wiring is connected;
a connector holder for holding the connector; and
a main body to which the connector holder is detachably attached.

US Pat. No. 10,115,945

HEARING AID BATTERY PACKAGING

SPECTRUM BRANDS, INC., M...

1. A battery package, comprising:a card;
a cover attached to the card, the cover including an opening and a door wherein the door is movable between an open position to provide access to the opening and a closed position in which the door closes the opening;
a tray positioned between the card and the cover, the tray including a plurality of receptacles;
a plurality of batteries, each battery positioned within one of the plurality of receptacles; and
a plurality of tabs, each tab removably attached to one of the batteries, wherein each tab is positioned between the cover and the battery to which the tab is attached;
wherein the tray is rotatable relative to the card and the cover to selectively align one of the receptacles with the opening in a battery removal position; and
wherein with the door in the open position, the tab attached to the battery in the receptacle in the battery removal position is accessible through the opening via an arc of access of at least 90 degrees.

US Pat. No. 10,115,940

RECHARGEABLE BATTERY

SAMSUNG SDI CO., LTD., Y...

1. A rechargeable battery, comprising:an electrode assembly to be charged and discharged;
a case including the electrode assembly;
a cap plate closing and sealing an opening of the case; and
an electrode terminal connected to the electrode assembly and provided in a terminal hole of the cap plate, wherein the cap plate includes:
a welded portion on an inner surface of the cap plate facing the electrode assembly and welded to the opening of the case;
an adhesive portion on the inner surface of the cap plate and recessed in a lateral direction relative to an edge of the cap plate, the adhesive portion recessed to accommodate the welded portion by a thickness of the case, the adhesive portion thicker than the welded portion to protrude inward and having a lateral surface contacting an inner surface of the opening; and
a separated portion on the inner surface of the cap plate and connected to the adhesive portion in the lateral direction, further recessed in a thickness direction of the case, and separated from the inner surface of the opening, wherein
the welded portion is on an end portion of the opening and forms a welding line in a lateral direction of the case,
the adhesive portion and the welded portion form a first step, and
the separated portion and the welded portion form a second step that is connected to the first step in a planar direction.

US Pat. No. 10,115,913

DISPLAY APPARATUS

SAMSUNG DISPLAY CO., LTD....

1. A display apparatus, comprising:a substrate including a bending area between a first area and a second area and bent about a bending axis;
a display over an upper surface of the substrate in the first area; and
a protective film over a lower surface of the substrate, the protective film including a first protective film base over the lower surface of the substrate and corresponding to at least a part of the first area and a first adhesive layer between the substrate and the first protective film base,
wherein the first protective film base includes a first thick portion having a first thickness and a first thin portion having a second thickness less than the first thickness and closer to the bending area than the first thick portion, and
wherein, in the first adhesive layer, a thickness of a portion corresponding to the first thin portion is greater than a thickness of a portion corresponding to the first thick portion.

US Pat. No. 10,115,904

TRANSPARENT RESIN COMPOSITION FOR ORGANIC ELECTROLUMINESCENT ELEMENT SEALING, RESIN SHEET FOR ORGANIC ELECTROLUMINESCENT ELEMENT SEALING, AND IMAGE DISPLAY DEVICE

FURUKAWA ELECTRIC CO., LT...

1. A transparent resin composition for organic electroluminescent element sealing, comprising:a thermoplastic resin comprising a hydride of a styrene-based A-B-A triblock body;
a tackifying resin which is at least one selected from the group consisting of a hydride of a C5-based petroleum resin, a hydride of a C9-based petroleum resin, and a hydride of a petroleum resin obtained by copolymerizing a C5-based petroleum resin and a C9-based petroleum resin; and
an organometallic compound comprising an ester bond and represented by Formula (1),
where R1, R2, R4, and R6 each represents an organic group comprising an alkyl group, an aryl group, a cycloalkyl group, or an acyl group each having a carbon number of 1 or more and 8 or less; R3 and R5 each represents an organic group comprising an alkyl group, an aryl group, an alkoxy group, a cycloalkyl group, or an acyl group each having a carbon number of 1 or more and 8 or less; M represents a trivalent metal atom; and R1 to R6 are identical organic groups or different organic groups,wherein
the transparent resin composition has a light transmittance of 85% or higher for light having a wavelength of 550 nm at a thickness of 0.1 mm, and
the transparent resin composition satisfies a relationship: AM/Y<162, where A (mg CH3ONa/g) represents an acid value of the transparent resin composition excluding the organometallic compound, M represents a weight average molecular weight of the organometallic compound, and Y represents a weight ratio of the organometallic compound with respect to 100 parts by weight of the resin components.

US Pat. No. 10,115,885

FLUIDIC ASSEMBLY PROCESS USING PIEZOELECTRIC PLATES

eLux, Inc., Vancouver, W...

1. A method for fabricating a thin-film electronic device employing a piezoelectric plate, the method comprising:providing a plurality of piezoelectric plates, each piezoelectric plate having a polygon shape and comprising a piezoelectric layer, a first electrode overlying a first surface of the piezoelectric layer, and a second electrode overlying a second surface of the piezoelectric layer;
forming a piezoelectric plate suspension;
providing a substrate comprising a plurality of electronic devices, each electronic device including a top surface well;
flowing the piezoelectric plate suspension over the substrate; and,
in response to the piezoelectric plate suspension flow, capturing piezoelectric plates in the top surface wells.

US Pat. No. 10,115,884

FLEXIBLE DISPLAY

BOE Technology Group Co.,...

1. A flexible display, comprising:a flexible display panel;
an electroactive polymer layer disposed on a side of the flexible display panel that faces away from a displaying surface of the flexible display panel; and
a first electrode layer and a second electrode layer which are disposed on the electroactive polymer layer;
wherein the electroactive polymer layer is capable of deforming according to an voltage applied across the first electrode layer and the second electrode layer, and
wherein the first electrode layer and the second electrode layer are located on a side of the electroactive polymer layer that faces towards or away from the flexible display panel, and the first electrode layer and the second electrode layer are disposed in a same layer and spaced from each other.

US Pat. No. 10,115,882

THERMOELECTRIC CONVERSION ELEMENT AND THERMOELECTRIC CONVERSION MODULE

FUJIFILM Corporation, Mi...

1. A thermoelectric conversion element comprising:a first substrate having a high thermal conduction portion which has a thermal conductivity higher than a thermal conductivity of other regions in at least a portion in a plane direction;
a thermoelectric conversion layer formed on the first substrate;
a pressure sensitive adhesive layer formed on the thermoelectric conversion layer;
a second substrate formed on the pressure sensitive adhesive layer, having a concave portion, which at least partially overlaps the high thermal conduction portion in the plane direction and is on the pressure sensitive adhesive layer side, and made of a metal material; and
an electrode pair connected to the thermoelectric conversion layer such that the thermoelectric conversion layer is interposed between the electrodes in the plane direction.

US Pat. No. 10,115,595

METHOD OF MANUFACTURING SEMICONDUCTOR DEVICE AND SEMICONDUCTOR DEVICE

SUMITOMO HEAVY INDUSTRIES...

1. A method of manufacturing a semiconductor device comprising:ion-injecting a dopant into a semiconductor layer formed of a group III-V compound semiconductor containing nitrogen as a Group V element;
performing a first activation annealing on the semiconductor layer having the ion-injected dopant using a heat-treating furnace under temperature conditions of 700° C. to 900° C.; and
performing a second activation annealing by allowing a pulsed laser beam to be incident on the semiconductor layer after the first activation annealing is performed,
wherein annealing is performed in a nitrogen atmosphere during the performing of the second activation annealing.

US Pat. No. 10,115,532

CAPACITOR WITH ELECTRODES MADE OF AN INTERCONNECTED CORRUGATED CARBON-BASED NETWORK

The Regents of the Univer...

1. An energy storage device comprising: a first electrode; and a second electrode separated from the first electrode by a dielectric wherein at least one of either the first electrode or the second electrode is made of an interconnected corrugated carbon-based network (ICCN) having a plurality of expanded and interconnected carbon layers, wherein an oxygen content of the expanded and interconnected carbon layers is at most about 5%.

US Pat. No. 10,115,527

THIN FILM DIELECTRIC STACK

BlackBerry Limited, Wate...

1. A method for fabricating a thin film capacitor, the method comprising:determining a first temperature according to a material of a first electrode layer and according to a determination of a hillock temperature above which hillocks form on the material, wherein the first temperature is below the hillock temperature;
determining a second temperature according to the material of the first electrode layer and according to the determination of the hillock temperature, wherein the second temperature is below the hillock temperature;
depositing a first dielectric layer on the first electrode layer utilizing a first process that is performed at the first temperature;
depositing a second dielectric layer on the first dielectric layer utilizing a second process that is performed at the second temperature and that forms a randomly-oriented grain structure for the second dielectric layer;
depositing a third dielectric layer on the second dielectric layer utilizing a third process that is performed at a third temperature and that forms a columnar-oriented grain structure for the third dielectric layer, wherein the third temperature is higher than the first temperature; and
depositing a second electrode layer on the third dielectric layer to form the thin film capacitor, wherein the first and third processes result in an average grain size of the first dielectric layer being smaller than an average grain size of the third dielectric layer.

US Pat. No. 10,115,288

AUTOMATIC BATTERY FLUID REMINDER SYSTEM FOR VEHICLES WITH FLOODED LEAD ACID BATTERIES AND METHOD THEREOF

INGERSOLL-RAND COMPANY, ...

1. A battery fluid level monitoring system comprising:a battery having an internal fluid;
a fluid level monitoring system in operative communication with the battery, wherein the fluid level monitoring system calculates consumption of the internal fluid based on a parameter,
wherein the fluid level monitoring system determines a level of the internal fluid based on the consumption of the internal fluid and compares the level with a predetermined level,
wherein when the level of the internal fluid is equal to or less than the predetermined level the fluid monitoring system communicates a warning; and
a battery charger in operative communication with the battery, and wherein when the level of the internal fluid is greater than the predetermined level the fluid level monitoring system instructs the battery charger to begin charging the battery, and
wherein the fluid level monitoring system measures a duration of the warning and compares the duration with a predetermined duration, wherein when the duration of the warning is greater than the predetermined duration the fluid level monitoring system alters a charge cycle of the battery to reduce the consumption of the internal fluid.

US Pat. No. 10,115,277

SYSTEMS AND METHODS FOR GEOFENCE SECURITY

GEOFRENZY, INC., Tiburon...

1. A method for enforcing at least one rule within a geofence comprising:defining at least one geofence using a multiplicity of geographic designators;
assigning a multiplicity of unique internet protocol (IP) addresses to the multiplicity of geographic designators defining the at least one geofence such that each geographic designator is assigned a unique IP address;
storing the multiplicity of geographic designators and the multiplicity of unique IP addresses in a database of geofences, wherein at least one of the multiplicity of unique IP addresses is a unique identifier of the at least one geofence, wherein the multiplicity of unique IP addresses are IPv6 addresses;
a fencing agent of an unmanned aerial vehicle (UAV) identifying the at least one geofence, wherein the fencing agent identifies at least one rule associated with the at least one geofence and the UAV implements the at least one rule;
wherein the UAV automatically stops implementing the at least one rule associated with the at least one geofence and automatically implements at least one second rule associated with a second geofence upon the UAV physically entering the second geofence;
wherein the UAV includes a camera, wherein the at least one rule includes the UAV identifying at least one restricted object detected by the camera and obstructing the at least one restricted object in real-time and/or obstructing the at least one restricted object in photographs and/or videos produced by the camera; and
wherein obstructing the at least one restricted object in real-time and/or obstructing the at least one restricted object in the photographs and/or the videos produced by the camera is performed by blurring, blacking out, or distorting the at least one restricted object.

US Pat. No. 10,115,272

ELECTRONIC GAME AND METHOD FOR PLAYING A GAME BASED UPON REMOVAL AND REPLACING SYMBOLS IN THE GAME MATRIX

IGT, Las Vegas, NV (US)

1. A gaming system comprising:a processor; and
a memory device that stores instructions that, when executed by the processor, cause the processor to:
responsive to a placement of a wager, for a play of a game:
randomly select at least two of a plurality of symbols,
cause a display of the randomly selected symbols at a plurality of symbol display positions,
determine whether said displayed randomly selected symbols form any of a plurality of winning symbol combinations, and
responsive to determining that the displayed randomly selected symbols form at least one of the winning symbol combinations, for each formed winning symbol combination:
independent of any player input to reposition any of the displayed randomly selected symbols, remove at least one of the displayed randomly selected symbols that forms that winning symbol combination, and
for each removed symbol:
 select one of the plurality of symbols as a replacement for that removed symbol, and
 cause a display of that selected symbol.

US Pat. No. 10,115,182

DEPTH MAP SUPER-RESOLUTION PROCESSING METHOD

GRADUATE SCHOOL AT SHENZH...

1. A depth map super-resolution processing method, comprising:firstly, performing image acquisition on the same scene in a first position and a second position, and respectively acquiring a first original image and a second original image; acquiring a low resolution depth map of the first original image;
secondly, performing the following processing:
1) dividing the low resolution depth map into multiple depth image blocks;
2) respectively performing the following processing on the depth image blocks obtained in step 1);
21) performing super-resolution processing on a current block with multiple super-resolution processing methods, to obtain multiple initial high resolution depth image blocks having the resolution the same as that of the first original image;
22) traversing the multiple initial high resolution depth image blocks obtained in step 21), respectively combining corresponding image blocks in the first original image which correspond to the current block, and synthesizing multiple image blocks corresponding to the second original image by using an image synthesis technology according to a relative position relationship between the first position and the second position, which are defined as multiple synthesized image blocks;
23) traversing the multiple synthesized image blocks obtained in step 22), respectively calculating a matching degree between each synthesized image block and a corresponding block in the second original image which corresponds to the current block, determining the synthesized image block with the highest matching degree, and determining a high resolution depth image block corresponding to the synthesized image block with the highest matching degree as an ultimate high resolution depth image block of the current block; and
3) integrating the high resolution depth image blocks of the depth image blocks into one image according to positions of the depth image blocks in the low resolution depth map, to obtain a super-resolution processing map of the low resolution depth map.

US Pat. No. 10,115,179

AGGREGATING AND DISPLAYING SOCIAL NETWORKING SYSTEM USER INFORMATION VIA A MAP INTERFACE

Facebook, Inc., Menlo Pa...

1. A method comprising:generating a map interface for presentation to a viewing user of a social networking system, the map interface identifying a representative geographic location associated with an aggregated content item, the viewing user, and an action performed by a user connected to the viewing user via the social networking system, generating the map interface comprising:
determining a threshold distance based on a zoom level of the map interface;
determining the aggregated content item by combining one or more pairs of content items, wherein for each of the one or more pairs of content items, a distance between the geographic locations associated with each content item of the pair is less than the threshold distance;
determining the representative geographic location of the aggregated content item as a weighted aggregate of geographic locations associated with content items aggregated to form the aggregated content item, wherein the weighted aggregate weighs a geographic location based on an affinity of the viewing user with the content item associated with the geographic location, the affinity of the viewing user with the content item determined based at least on past interactions of the viewing user;
selecting one or more representative content items from the aggregated content item for generation of an information display for presentation in association with the representative geographic location, the selecting comprising:
retrieving one or more content items included in the aggregated content item, wherein each retrieved content item has a content type;
selecting one or more content items from the retrieved content items to include a specified amount of content items having a particular content type;
ranking the selected content items based on a measure of affinity between the viewing user and each of the selected content item; and
selecting the one or more representative content items from the selected content items based on the ranking;
generating the information display based on the one or more representative content items; and
sending the information display for presentation to the viewing user in association with the representative geographic location.

US Pat. No. 10,115,129

DEAL ALLOCATION PLATFORM

GROUPON, INC., Chicago, ...

1. A method of determining an adjustment to a number of consumers presented, via a user interface on a display, each of a first deal and a second deal, in real-time, via a reallocation process performed in real-time, configured to reduce impact of the reallocation, the method comprising:determining, via a processor, from a set of consumers, information indicative of each of the set of consumers being stored in a database, a first group of consumers identified as most likely to purchase a first deal of a set comprised of at least the first deal and a second deal;
determining, via the processor, from the set of consumers, a second group of consumers identified as most likely to purchase the second deal of the set comprised of at least the first deal and the second deal,
wherein the first deal is associated with a minimum number and a maximum number, the minimum number being a minimum number of consumers to which the first deal is presented, and the maximum number being a maximum number of consumers to which the first deal is presented;
wherein the second deal is associated with a second number, the second number being a minimum number of consumers to which the second deal is presented;
determining, via the processor, based on a shortage of the first group of consumers compared to the minimum number of consumers to which the first deal is presented, a shortage of the second group of consumers compared to the second number of consumers to which the second deal is presented, or a surplus of the first group of consumers compared to the maximum number of consumers to which the first deal is presented, that one or more consumers are to be reallocated;
analyzing, using a cost function stored at a server, iteratively on a consumer by consumer basis, costs associated with reallocating consumers from the second group of consumers to the first group of consumers, to correct for the shortage of the first group of consumers compared to the minimum number of consumers to which the first deal is presented, costs associated with reallocating consumers from the first group of consumers to the second group of consumers, to correct for the shortage of the second group of consumers compared to the second number of consumers to which the second deal is presented, and costs associated with reallocating of consumers from the set of consumers, from the first group of consumers to the second group of consumers, to correct for the surplus of the first group of consumers compared to the maximum number of consumers to which the first deal is presented,
the cost function comprising each of a first determination, a second determination, and a third determination, the first determination configured to determine which one or more consumers from the first group of consumers, the first group of consumers having been identified as more likely to purchase the first deal, to reallocate from the first group of consumers to the second group of consumers in an instance in which the first group of consumers comprises greater than the first number of consumers, the first number of consumers being the minimum number of consumers to which the first deal is presented, to meet the second number of consumers, the second number of consumers being the minimum number of consumers to which the second deal is presented; and a second determination, the second determination determining which one or more consumers from the second group of consumers, the second group of consumers having been identified as more likely to purchase the second deal, to reallocate to the first group of consumers in an instance in which the second group of consumers comprises greater than the second number of consumers, the second number of consumers being the minimum number of consumers to which the second deal is presented to meet the first number of consumers, the first number of consumers being the minimum number of consumers to which the first deal is presented; and the third determination configured to determine which one or more consumers from the first group of consumers, the first group of consumers having been identified as more likely to purchase the first deal, to reallocate from the first group of consumers to the second group of consumers in an instance in which the first group of consumers comprises greater than the maximum number of consumers, the maximum number of consumers being the maximum number of consumers to which the first deal is presented, to meet without exceeding the maximum number of consumers to which the first deal is presented,
wherein the cost function is calculated, via the processor, by:
in an instance in which the shortage exists,
iteratively, starting with a consumer having a smallest delta between expected revenue upon acceptance of the second deal versus acceptance of the first deal, and continuing until a determination that upon reallocation of the particular consumer, the shortage no longer exists, determining a change in expectation of revenue due to a reallocation of a particular consumer from receiving the second deal to receiving the first deal;
determining a change in expectation of acceptance due to the reallocation of the particular consumer from receiving the second deal to receiving the first deal; and
in an instance in which the surplus exists,
iteratively, starting with a consumer having a smallest delta between expected revenue upon acceptance of the first deal versus acceptance of the second deal, and continuing until a determination that upon reallocation of the particular consumer, the surplus no longer exists, determining a change in expectation of revenue due to a reallocation of a particular consumer from receiving the first deal to receiving the second deal;
determining a change in expectation of acceptance due to the reallocation of the particular consumer from receiving the first deal to receiving the second deal;
reallocating storage, at the database, of information associated with each consumer identified in the iterative process based on analyzing the cost function and minimizing an aggregate cost of reallocation;
finalizing, upon a determination of which one or more consumers are to be reallocated based on the cost function, the first group of consumers and the second group of consumers; and
presenting, via a display, the first deal to the first group of consumers and the second deal to the second group of consumers,
wherein, now, upon reallocation, the first deal is presented to no less than the minimum number of consumers and no more than the maximum number of consumers, and the second deal is presented to no less than the second number, being representative of the minimum number associated with the second deal.

US Pat. No. 10,115,091

METHOD AND APPARATUS FOR PROVIDING A GIFT USING A MOBILE COMMUNICATION NETWORK AND SYSTEM INCLUDING THE APPARATUS

SK PLANET CO., LTD., Seo...

1. A system for providing a gift icon using a communication network, the system comprising:a user terminal configured to:
receive product information about products,
select a product provided by the received product information,
transmit selecting information about the selected product, and
receive responding information about a selection of a terminal to receive the selected product, the responding information comprising:
reception information identifying whether the terminal receives a gift icon corresponding to the selected product, wherein the gift icon includes a usage period identifying a valid usage period for the gift icon, and
status information identifying a usage status of the gift icon; and
a gift provision apparatus configured to:
provide the product information about products to the user terminal,
receive the selecting information from the user terminal,
provide the gift icon corresponding to the selected product to the terminal,
receive, from the terminal, a redemption signal corresponding to the gift icon,
wherein the redemption signal includes the usage period,
determine whether a usage period has elapsed based on the usage period, and
when the usage period is determined to have elapsed, transmit a prohibition message to the terminal, and
manage downloading and redemption of the gift icon.

US Pat. No. 10,115,082

SYSTEMS AND DEVICES CONTROLLED RESPONSIVE TO DATA BEARING RECORDS

DADESYSTEMS, INC., Miami...

1. Apparatus operative to cause financial transfers responsive to data included on data bearing records in the form of financial checks, comprising:at least one computer, wherein the at least one computer includes at least one processor circuit and is operative to cause
data corresponding to a bar code to be sent to a payee terminal operated by a check payee having a payee account, wherein the payee terminal is remote from the at least one computer, wherein the payee terminal includes a display and is operative to cause a visual image including the bar code to be output through the display,
wherein the at least one computer includes at least one computer data store including payee account data corresponding to the payee account,
wherein the bar code corresponds to at least one identifier,
wherein the bar code is configured to be used to produce bar code digital image data corresponding to the bar code when captured from the display of the payee terminal by a digital camera of a mobile device, wherein the mobile device includes
the digital camera,
at least one manual input device,
a mobile display,
a wireless communication interface,
at least one mobile processor circuit,
at least one mobile data store in operative connection with the at least one mobile processor circuit, wherein the at least one mobile data store includes mobile processor executable instructions,
wherein the mobile device is configured to be operated by the check payee to capture digital check image data corresponding to a visual image of at least one side of a financial check, wherein the check includes visible indicia corresponding to the check payee, a check payor account, and a check amount,
wherein the mobile device is configured to
determine the at least one identifier from the bar code digital image data,
communicate the digital check image data and data corresponding to the at least one identifier to the at least one computer,
wherein the at least one computer is operative responsive at least in part to the at least one identifier to cause the check amount to be credited to the payee account.

US Pat. No. 10,115,077

SYSTEM FOR FACILITATING MANAGEMENT AND ORGANISATIONAL DEVELOPMENT PROCESSES

Gaiasoft IP Limited, Lon...

1. An organizational management system for providing an electronic user interface to access digital information resources over a computer network, the system comprising:an input device;
a digitized personal profile of a user of the system including security privileges of the user;
a graphical user interface configured to display an interactive digital scorecard comprising a plurality of indicators organized according to a hierarchy of intent and associated with an entity, wherein a first indicator of the plurality of indicators represents a level of maturity of a process based on a maturity model format that defines a plurality of maturity levels and includes electronic links to associated knowledge; and
a processor coupled to the input device and the graphical user interface, the processor being configured to:
provide, responsive to receiving a change to a definition of the maturity model format of the first indicator, an update to the interactive scorecard of the graphical user interface;
receive a selection of an indicator from the input device at the updated graphical user interface;
identify, in response to the selected indicator, digital information resources accessed by the electronic links based on the digitized personal profile of the user, the digital information resources providing knowledge associated with the selected indicator; and
provide, using the updated graphical user interface, the user with access to the digital information resources, wherein access to the digital information resources is based on the content of the digitized personal profile of the user and the selected indicator.

US Pat. No. 10,115,062

SYSTEM AND METHOD FOR FACILITATING DEVELOPMENT OF CUSTOMIZED WEBSITE PROJECTS

1175856 ONTARIO LTD., Ca...

1. A computer-implemented method for facilitating development of two or more customized website projects over a network, comprising:for each customized website project, receiving electronic data in functional design modules which can be utilized by a website developer to create a customized website, the functional design modules comprising:
a creative concept module requesting information related to: a business description, a marketing activity, a selling proposition, an internet marketing activity, a reference, a comment, and a logo;
a research and analysis module requesting information related to: client research comprising key decision makers, company size, news events affecting the company, and key clients; market research comprising target market, key industry terminology and trends, key competitors, and industry challenges; Internet research comprising host-developed websites in the same industry, current client website and its effectiveness, news events regarding how the Internet is affecting the client's industry; and documentation of the research;
an Internet business analysis module requesting information related to Internet formatting, Internet business practices, and desired Internet features;
a functional requirements module requesting information related to a required technical product and a needed quantity;
a website plan module requesting information related to a site plan;
a page information module requesting meta tag information;
a database information module requesting information related to a database to use as a guideline;
a flash design module requesting information related to multiple, distinct sequences to appear in different sections of the customized website;
a launching module placing the customized website live on a server and registering the customized website with search engines to optimize traffic levels such that the customized website is ranked high within search engine listings, the search engines comprising major search engines, community and industry-specific search engines, and hub-websites;
automating access to the electronic data in the functional design modules by a computer over the network;
automating obtaining at least one of the at least two customized website projects from the website developer, the website developer using the functional design report to create the at least one of the at least two customized website projects; and
filtering the at least two customized website projects by at least one of: active status, accepted status, rejected status, submitted status, and saved status; and
launching the customized website for the at least one of the at least two customized website projects, wherein the launching comprises:
reviewing connectivity of client systems;
activating the customized website;
populating the customized website with production data;
registering the customized website with search engines;
training the client about the customized website; and
review marketing related to the customized website.

US Pat. No. 10,115,049

RADIO FREQUENCY IDENTIFICATION CAPSULE

Ent. Services Development...

1. A capsule comprising:a substrate layer;
a radio frequency identification layer on the substrate layer, the radio frequency identification layer comprising a radio frequency identification tag formed from nanoparticle ink, wherein the radio frequency identification tag comprises:
silver nanoparticle connectors applied by a print head of a three-dimensional printer, and
at least one inductor formed from a strontium ferrite nanoparticle ink; and
a protective layer surrounding the radio frequency identification layer, wherein at least one of the substrate layer and the protective layer comprises a polycarbonate ink applied by a print head of the three-dimensional printer.