US Pat. No. 10,113,480

TRUNNION FOR HIGH-PRESSURE TURBINE, AND TURBOJET ENGINE INCLUDING SUCH A TRUNNION

SAFRAN AIRCRAFT ENGINES, ...

1. A trunnion for high-pressure turbine, intended to be arranged between a low-pressure turbine shaft and an inner surface of a seal support of a low-pressure turbine, the trunnion comprising a drop-launching extension extending facing a flared portion of the inner surface of the seal support, such that when the trunnion is driven in rotation around the low-pressure turbine shaft, oil is projected by centrifugal effect from the drop-launching extension towards the flared portion of the inner surface of the seal support, the trunnion further comprising a recess arranged in an outer surface of the trunnion, the recess stopping penetration of the oil between the trunnion and the seal support and causing detachment of the oil towards the inner surface of the seal support by centrifugal effect, wherein the drop-launching extension has an outer surface tilted relative to an axis of rotation of the trunnion, to guide the oil towards the recess by centrifugal effect when the trunnion is driven in rotation.

US Pat. No. 10,113,461

DELIVERY MODULE FOR USE IN A SYSTEM FOR PURIFYING THE EXHAUST GASES OF A COMBUSTION ENGINE

PLASTIC OMNIUM ADVANCED I...

1. A liquid delivery module comprising:a base plate positioned through an opening made in a wall of a liquid tank;
a pump assembly configured to pump liquid from the base plate and to deliver the liquid to a supply line, via a hydraulic connector; and
a cover adapted to be fixed to the base plate;
wherein the pump assembly is mounted outside the tank and at least a part of the hydraulic connector is attached to or mounted inside the cover,
wherein the hydraulic connector is molded from one piece with the cover, by injection-molding of a plastic, and
wherein the pump assembly is mounted within a dry area defined between the cover and the base plate.

US Pat. No. 10,113,459

INERTIAL GAS-LIQUID IMPACTOR SEPARATOR WITH FLOW DIRECTOR

Cummins Filtration IP Inc...

1. An inertial gas-liquid impactor separator for removing liquid particles from a gas-liquid stream comprising a housing having an inlet for receiving a gas-liquid stream and an outlet for discharging a gas stream, at least one nozzle in said housing receiving said gas-liquid stream from said inlet and accelerating said gas-liquid stream through said at least one nozzle, an inertial impactor collector in said housing in the path of said accelerated gas-liquid stream and causing liquid particle separation, and a flow director directing flow through said housing from said inlet to said outlet along a flow path from upstream to downstream, said flow director comprising a resiliently biased plunger having a valve face engageable with a valve seat, at least one of said valve face and said valve seat having a self-seating tolerance-accommodating configuration.

US Pat. No. 10,113,355

SOUNDPROOF DOOR FOR USE IN REDUCTION OF SOUND TRANSMITTED FROM ONE SIDE OF THE DOOR TO THE OTHER SIDE

NAN YA PLASTICS CORPORATI...

9. A soundproof door assembly for use in reduction of sound transmitted from one side of the door to the other side, having an STC number greater than of STC 30 determined in accordance with ASTM E413-10 and E90-09, comprising a soundproof door having a thickness of 30-70 mm, which comprisingtwo door skins, one formed as a front door skin and the other formed as a rear door skin for the soundproof door respectively;
a quadrilateral frame, constituted by a top rail member, a bottom rail member, a left stile member and a right stile member to seal the perimeter of the door skins; one or more reinforced members in parallel set up alongside one or more inner sides of the quadrilateral frame; and
a multiple-layered core to form a concrete inner portion of the door, which comprising; two spaced hard-soundproofing cores, to block sound with high frequency over 500 Hz, each formed as a single-layered soundproofing core having a thickness of 3-12 mm and made of calcium silicate board, silicon magnesium board, glass fiber composite board or ceramic composite board; and
a soft-soundproofing core, to block sound with high frequency beneath 500 Hz, interleaved in between the spaced hard-soundproofing cores to constitute with a sandwich structure, and the soft-soundproofing core is made of rock wool fiber board, glass fiber board, closed cell polyurethane foaming board, opened cell polyurethane foaming board, expandable polystyrene foaming board or expandable polyethylene foaming board;
a reinforced member positioned adjacent and extending parallel to a side of the soft-soundproofing core, and disposed and extending between the hard-soundproofing cores;
a doorframe, being a stationary quadrilateral door frame positioned proximately the soundproof door to support the soundproof door; and
one or more door hinges used to control the soundproof door capably to swing relative to the doorframe; and
a loop of soft packing strip, mounted on the quadrilateral door frame of the doorframe to tightly contact onto the door skin of the soundproof door if closed;
wherein the quadrilateral door frame of the doorframe is made from hard polyvinyl chloride (PVC) board, foamed PVC board, PVC composite extrusion board.

US Pat. No. 10,113,342

LATCH ASSEMBLY

INTEVA PRODUCTS, LLC, Tr...

1. A latch assembly, comprising:a chassis;
a latch bolt, movably mounted to the chassis for movement between a closed position for retaining a striker in the latch assembly and an open position for releasing the striker from the latch assembly;
a pawl rotatably mounted to the latch assembly via a pawl pivot pin for rotation between an engaged position wherein the pawl retains the latch bolt in the closed position and a disengaged position wherein the pawl is disengaged from the latch holt such that the latch can move to the open position; and
wherein the pawl rotates about and contacts a surface of the pawl pivot pin, the surface of the pawl pivot pin including a first arcuate portion and a second arcuate portion, wherein a radius of the first arcuate portion is smaller than a radius of the second arcuate portion such that friction between the pawl and the pawl pivot pin is reduced during rotation of the pawl about the pawl pivot pin.

US Pat. No. 10,113,341

MOTOR VEHICLE LOCK WITH A POSITION SECURING SYSTEM

Kiekert Aktiengesellschaf...

1. A latch with a locking mechanism that includes a catch and a pawl for locking the catch and optionally including an anti-theft device, the latch comprising:a position securing system comprising:
an actuating lever coupled to one of the locking mechanisms or the anti-theft device;
a pin movable between a first position where either the locking mechanism or anti-theft device is locked and a second position when either the locking mechanism or anti-theft device is unlocked, wherein the pin is coupled to the actuating lever;
a pincer spring with a first spring leg and a second spring leg that act on opposite sides of the pin, wherein the pincer spring resists moving the pin between the first and second positions; and
a housing comprising a first wall and a second wall that act as stops which limit the movement of the first and second spring legs caused by moving the pin between the first and second positions, wherein the first leg spring has a first free end and the second leg spring has a second free end, wherein the free ends are fixed to the housing.

US Pat. No. 10,113,321

DECKING SUPPORT SYSTEM

1. A decking support system including:a plurality of decking support elements, each decking support element including a first decking support engagement feature and a second decking support engagement feature,
a plurality of connection elements, wherein at least one of the plurality of connection elements includes a first side including a first connection element engagement structure and a second side including a second connection element engagement structure, wherein the first connection element engagement structure includes a first connection feature adapted to co-operate with said first decking support engagement feature of a decking support element, and a second connection feature adapted to co-operate with said second decking support engagement feature of a decking support element, wherein the first connection feature includes at least one wall extending outwardly and away from said first side, and a groove positioned in said at least one wall; and
wherein a first of said plurality of decking support elements is adapted to be engaged with a second of said plurality of decking support elements by the at least one of said plurality of connection elements.

US Pat. No. 10,113,239

CUTTING TOOL

KYOCERA CORPORATION, Kyo...

1. A cutting tool comprising:a base including cemented carbide containing W, C, Co, Cr, Si and Fe; and
a coating layer comprising a Ti-based layer including at least a layer of Ti(Cx1Ny1Oz1) (0?x1?1, 0?y1?1, 0?z1?1, x1+y1+z1=1), an Al2O3 layer, and an outermost layer of Ti(Cx3Ny3Oz3) (0?x3?1, 0?y3?1, 0?z3?1, x3+y3+z3=1), which are laminated in order from the base side on a surface of the base, wherein a content of Cr contained at a thickness-center position of a first Ti-based layer of the Ti-based layer on a side closer to the base is lower than a content of Cr contained in the base, and higher than a content of Cr contained at a thickness-center position of the Al2O3 layer, and a content of Cr contained at a thickness-center position of the outermost layer is higher than the content of Cr contained at the thickness-center position of the Al2O3 layer in a glow-discharge emission spectrometry (GDS analysis).

US Pat. No. 10,113,120

PROCESSING FLUID FROM A WELL

STATOIL PETROLEUM AS, St...

1. Apparatus for processing fluid from a well, the apparatus comprising:a first wall portion adjacent a first region;
a second wall portion adjacent a second region;
said first and second regions arranged to let fluid pass therethrough;
the apparatus further comprising:
a first heat exchanger which includes said first wall portion, said first heat exchanger being arranged to heat said first wall portion to release wax from said first wall portion into said fluid at said first region; and
a second heat exchanger which includes said second wall portion, said second heat exchanger being arranged in a first configuration to cool said fluid at said second region during said heating of the first wall portion to cause wax from said fluid to deposit on said second wall portion, wherein said second heat exchanger is operable in said first configuration to cool said fluid at said second region, and in a second configuration, different from said first configuration, to heat said second wall portion to release wax from the second wall portion into said fluid; and
an outlet arranged to receive therein said fluid from said first and second regions,
wherein the first heat exchanger and the second heat exchanger are disposed in a parallel configuration.

US Pat. No. 10,113,109

OXO- AND HYDROXO-BASED COMPOSITE INORGANIC LIGANDS FOR QUANTUM DOTS

Lumileds LLC, San Jose, ...

1. A particulate luminescent material comprising quantum dots with a capping agent coordinating to the quantum dots, wherein the capping agent comprises a zincate ion (Zn(OH)42?), and the particulate luminescent material comprises particles having an inorganic matrix hosting the quantum dots with inorganic capping agents.

US Pat. No. 10,113,013

CATALYST COMPONENTS FOR THE POLYMERIZATION OF OLEFINS

Basell Poliolefine Italia...

1. A solid catalyst component for the polymerization of olefins comprising Mg, Ti and an electron donor of the formula (I):
where each Q is a group —COOR1 in which R1 is selected from C1-C15 hydrocarbon groups, optionally containing a heteroatom selected from the group consisting of a halogen, P, S, N, and O; or a group —CON(R2)2 in which R2 groups, equal to or different from each other, are selected from hydrogen or R1 groups which are optionally fused together to form one or more cycles; and A is a bivalent bridging group with the proviso that the Q groups cannot be simultaneously a group —COOR1 or —CON(R2)2.

US Pat. No. 10,112,917

THERAPEUTIC COMPOUNDS

ARIZONA BOARD OF REGENTS ...

1. A compound of formula (I), or a salt thereof:wherein:R1 is H or (C1-C6)alkyl;
the bond represented by ---- is a single bond or a double bond;
ring A is optionally substituted with one or more groups independently selected from halo, hydroxy, nitro, cyano, —NRaRb, (C1-C6)alkyl, (C2-C6)alkenyl, (C2-C6)alkynyl, (C3-C6)cycloalkyl, (C1-C6)alkoxy, (C1-C6)alkoxycarbonyl, and (C1-C6)alkanoyloxy, wherein each (C1-C6)alkyl, (C2-C6)alkenyl, (C2-C6)alkynyl, (C3-C6)cycloalkyl, (C1-C6)alkoxy, (C1-C6)alkoxycarbonyl, and (C1-C6)alkanoyloxy, is optionally substituted with one or more groups independently selected from halo, hydroxy, nitro, cyano, (C1-C6)alkoxy, —NRaRb, and oxo (?O); and
Ra and Rb are each independently H or (C1-C6)alkyl; or Ra and Rb taken together with the nitrogen to which they are attached form a ring selected from aziridine, azetidino, pyrrolidino, and morpholino.

US Pat. No. 10,112,914

POLYMORPHS OF A MPGES-1 INHIBITING TRIAZOLONE COMPOUND

GLENMARK PHARMACEUTICALS ...

1. A crystalline form of N-(4-chloro-3-(5-oxo-1-(4-(trifluoromethyl)phenyl)-4,5-dihydro-1H-1,2,4-triazol-3-yl)benzyl)pivalamide (Compound formula II), structurally represented as

US Pat. No. 10,112,901

METHOD FOR PREPARING DABIGATRAN ETEXILATE INTERMEDIATE, AND INTERMEDIATE COMPOUND

SHANGHAI INSTITUTE OF PHA...

1. A preparation method of a dabigatran etexilate intermediate 4, comprising: reacting a compound 3 with a C1-C3 alkyl alcohol solution of methylamine in an organic solvent, wherein the organic solvent is a erotic organic solvent or an aprotic organic solvent; and
wherein, X=chlorine, bromine, or iodine.

US Pat. No. 10,112,894

CYCLIC PROCESS FOR PRODUCING TAURINE

VITAWORKS IP, LLC, North...

1. A process for producing taurine from aziridine, comprising:(a) adding gaseous aziridine or a solution of aziridine to a solution of ammonium bisulfite, or ammonium sulfite, or a mixture of ammonium bisulfite and ammonium sulfite to undergo a ring-opening reaction of aziridine to form ammonium taurinate;
(b) decomposing ammonium taurinate to taurine and ammonia by heating and removing ammonia to obtain a crystalline suspension of taurine; and
(c) separating taurine by means of solid-liquid separation to provide a mother liquor.

US Pat. No. 10,112,893

GUANIDINIUM COMPOUNDS

NUtech Ventures, Lincoln...

1. A compound of formula (I):
wherein:
G is -L-NH—C(—NH2)(?NH2)Y;
R is independently selected from the group consisting of halogen, C1-C6 alkyl and C1-C6 alkyloxy;
X is optionally substituted aryl;
Y is absent or is an anion selected from the group consisting of bicarbonate, halide, aryl carboxylate, alkyl carboxylate, phosphate, phosphonate, phosphonite, azide, thiocyanate, cyanate, phenoxide, arylsulfonate, alkylsulfonate, trifluoromethanesulfonate, thiolate, and stabilized enolate;
L is absent or is an optionally substituted linker selected from the group consisting of alkyl, alkenyl, heteroalkyl, alkylcarbonyl, heteroalkylcarbonyl, cycloalkyl, heterocycloalkyl, or aryl;
n is 0-4; and
m is 1-2.

US Pat. No. 10,112,859

MODULAR FLUID PURIFICATION SYSTEM AND COMPONENTS THEREOF

SELECTO, INC., Suwanee, ...

1. A purification system comprising:a purification head assembly detachably connected to a sump, comprising:
a plurality of fluid inlets in fluid communication with the sump;
a plurality of fluid outlets in fluid communication with the sump;
a first clip for securing a pair of flow conduits selected from a group consisting of a plurality of inlet flow conduits and a plurality of outlet flow conduits to the fluid inlets and fluid outlets of the purification head assembly, comprising:
a main body section extending longitudinally from a first end portion to a second end portion and having a middle portion therebetween;
a first flexible extending section and a second flexible extending section extending laterally from the first and second end portions, respectively, of the main body section substantially normal thereto;
a central extending section extending from the middle portion of the main body section substantially normal thereto having two arcuate sides extending laterally from the main body section, and a straight edge extending longitudinally at an end therebetween;
wherein the first flexible extending section and the central extending section define a first opening being semicircular and adapted to receive an outer surface of one of the pair of the flow conduits having a circular cross-section and the second flexible extending section and the central extending section define a second opening being semicircular and adapted to receive an outer surface of the other of the pair of the flow conduits having a circular cross-section and the curvature of each of the openings matches an outer curvature of each of the flow conduits;
wherein the first flexible extending section extends longitudinally away from and arcuately back toward the central extending section and radially outwardly from the first opening to define a first width and extending to a first tip having a laterally extending straight edge while maintaining the first width to the straight edge of the first tip, and the second flexible extending section extends longitudinally away from and arcuately back toward the central extending section and radially outwardly from the second opening to define a second width and extending to a second tip having a laterally extending straight edge while maintaining the second width to the straight edge of the second tip;
wherein the first flexible extending section, the second flexible extending section, and the central extending section have a sufficiently small thickness to be received by a clip insertion slot in the purification head assembly of the purification system by insertion into the clip insertion slot, and to be removed from the clip insertion slot in the purification head assembly by simply pulling on the main body.

US Pat. No. 10,112,836

CONTINUOUS NANOSYNTHESIS APPARATUS AND PROCESS

The Regents of The Univer...

11. A nanosynthesis apparatus, comprising:an outer tube having an internal surface and a longitudinal axis;
a substrate support surface at least partially disposed within the outer tube and opposing the internal surface of the outer tube across a gap having opposite ends and circumscribing the substrate support surface;
a deposition fluid source in fluid communication with the gap and operable to provide a deposition fluid to the gap such that the deposition fluid flows along the gap in a direction from one of the opposite ends toward the other of the opposite ends, wherein the deposition fluid comprises a constituent to be deposited on a growth substrate in the gap;
a heater arranged to heat at least a portion of the gap;
a feed system arranged to provide the growth substrate in the gap and onto the substrate support surface at an angle with respect to the longitudinal axis of the outer tube such that a length of the growth substrate wraps around and is in physical contact with the substrate support surface and extends between the ends of the gap, whereby the growth substrate is exposed to the deposition fluid flowing along the gap;
an inner tube that includes the substrate support surface, the deposition fluid source being in fluid communication with the inside of the inner tube; and
an aperture extending through the inner tube at a location between the ends of the gap, wherein the deposition fluid source is in fluid communication with the gap via the inner tube and the aperture such that the deposition fluid flows along only a portion of the gap.

US Pat. No. 10,112,825

SEMICONDUCTOR STRUCTURE AND MANUFACTURING METHOD FOR THE SAME

UNITED MICROELECTRONICS C...

1. A semiconductor structure, comprising a micro-electro-mechanical system (MEMS) region comprising:a sensing membrane;
a metal ring defining a cavity under the sensing membrane; and
a dielectric structure comprising an upper dielectric portion on the metal ring, wherein the cavity comprises an upper cavity portion defined by the upper dielectric portion, the upper cavity portion widens gradually along a direction away from the metal ring.

US Pat. No. 10,112,760

PACKAGED ORAL CARE IMPLEMENT AND PACKAGE

Colgate-Palmolive Company...

1. A packaged oral care implement comprising;a blister package comprising:
a receiving cavity;
a panel, the panel comprising a tear-away portion and a base portion, the tear-away portion comprising an edge protruding outwardly a first distance from the base portion;
a protuberance extending from an inner surface of the tear-away portion; and
the edge protruding outwardly a second distance from the base portion when a force is applied to an outer surface of the tear-away portion as a result of the protuberance acting as a fulcrum, the second distance greater than the first distance: and
an oral care implement positioned within the receiving cavity.

US Pat. No. 10,112,757

INSULATION PACKAGING SYSTEM

Johns Manville, Denver, ...

1. An insulation packaging system, comprising:a plurality of insulation packages comprising first ends and second ends, wherein the plurality of packages define an axis;
a first film configured to wrap around the axis to compress and couple the plurality of insulation packages together; and
a second film configured to wrap around the first and second ends of the plurality of insulation packages, wherein the second film comprises a stretch film, the stretch film including a longitudinal length and a lateral width that is perpendicular to the longitudinal length, wherein the second film is configured to wrap around the first and second ends of the plurality of insulation packages along the longitudinal length, and wherein the lateral width is sufficient such that wrapping the second film around the first and second ends of the plurality of insulation packages a single time entirely covers the first and second ends of the plurality of insulation packages;
wherein the first and second films are different films.

US Pat. No. 10,112,717

PIVOT BIN ASSEMBLY WITH TWO PART PIVOT AXLE

1. An aircraft storage bin comprising:an upper housing that includes first and second side panels,
a bucket that includes a bottom and first and second sides, wherein the bucket cooperates with the upper housing to define a bin interior,
a first clevis assembly that includes a first inner plate and a first outer plate, wherein the first inner plate and first outer plate extend between the first side panel and the first side wall, wherein the first inner plate includes a first outer protrusion and the first outer plate includes first inner protrusion, wherein the first inner protrusion and first outer protrusion cooperate to form a first pivot axle, and
a second clevis assembly that includes a second inner plate and a second outer plate, wherein the second inner plate and second outer plate extend between the second side panel and the second side wall, wherein the second inner plate includes a second outer protrusion and the second outer plate includes second inner protrusion, wherein the second inner protrusion and second outer protrusion cooperate to form a second pivot axle,
wherein the first and second pivot axles are axially aligned along a pivot axis, and wherein the bucket pivots about the pivot axis with respect to the upper housing between an open position and a closed position.

US Pat. No. 10,112,697

AIRCRAFT WITH THRUST VECTORING TAIL

SIKORSKY AIRCRAFT CORPORA...

1. An aircraft, comprising:an airframe having an upper section and a tail section;
a main rotor assembly operably disposed at the upper section and including a main rotor that is rotatable about a rotational axis defined through the airframe;
one or more tail rotor assemblies operably disposed on the tail section and respectively including one or more articulated propellers with thrust vectoring capability that are each independently rotatable about a respective variable rotational axis; and
not more than one controllable wing extending outwardly from a side of the aircraft.

US Pat. No. 10,112,680

THERMALLY ENHANCED HUB MOTOR

Future Motion, Inc., San...

1. An electric vehicle comprising:a frame;
a wheel assembly including a rotatable ground-contacting element;
a hub motor configured to rotate the ground-contacting element to propel the electric vehicle, the hub motor including:
a rotor,
a stator disposed concentrically within the rotor, such that the rotor is configured to rotate about the stator,
an axle portion formed as a single piece and coupled to the frame, the axle portion having a central shaft extending axially from a mandrel fixed concentrically within the stator, a plurality of ribs extending toward the central shaft from an inner surface of the mandrel, an outer surface of the mandrel in direct contact with the stator;
wherein the axle portion consists of a single material having a thermal conductivity substantially higher than the stator, and the mandrel is connected to the central shaft by a plurality of connection members that are unitary with the mandrel and the central shaft.

US Pat. No. 10,112,640

STEERING COLUMN ASSEMBLY HAVING A RESTRICTION ASSEMBLY

STEERING SOLUTIONS IP HOL...

1. A steering column assembly, comprising:a mounting bracket having a first arm and a second arm;
a jacket assembly movable relative to a steering column axis, the jacket assembly being operatively connected to the first arm and the second arm; and
a restriction assembly operatively connected to the jacket assembly and the mounting bracket, the restriction assembly being configured to inhibit movement of the jacket assembly relative to the mounting bracket, the restriction assembly comprising:
a first strap mounted to the first arm, the first strap defining a plurality of first locking teeth,
a second strap disposed on the first arm, the second strap defining a plurality of second locking teeth arranged to selectively engage the plurality of first locking teeth and defining a plurality of third locking teeth disposed opposite the plurality of second locking teeth,
a first bracket disposed on the first arm, and
a cam member pivotally connected to the first bracket, the cam member having a plurality of complementary engagement members configured to selectively engage the plurality of third locking teeth.

US Pat. No. 10,112,639

VEHICLE STEERING ARRANGEMENT AND METHOD OF MAKING SAME

STEERING SOLUTIONS IP HOL...

1. A steering arrangement for a vehicle, comprising:a steering wheel; and
at least one human machine interface configured to allow a human to steer the vehicle, the human machine interface being a component separate from the steering wheel, the at least one human machine interface in operable communication with a steer-by-wire system of the vehicle, the steering wheel in operable communication with the steer-by-wire system of the vehicle, the steering wheel and the at least one human machine interface independently rotatable relative to each other.

US Pat. No. 10,112,506

VEHICLE SEAT

TS Tech Co., Ltd., Saita...

1. A vehicle seat, comprising:a cushion frame configured as a framework of a seating portion of the vehicle seat;
a height device that connects the cushion frame and a vehicle body floor such that the cushion frame is movable up and down relative to the vehicle body floor; and
a side cover that covers the cushion frame and the height device from an outside of the cushion frame and the height device in a seat width direction;whereinthe height device includes an operation lever for moving up and down the cushion frame, the operation lever being attached to a supporting shaft that protrudes outward from a lateral surface of the cushion frame in the seat width direction to be rotatable around the supporting shaft, and
a positioning member that is separate from the side cover is provided on a surface of the side cover to position the operation lever, and
the positioning member is attached to the side cover while being supported by the side cover.

US Pat. No. 10,112,504

FOLDING SEAT

GRAMMER AG, Amberg (DE)

1. A vehicle seat comprising:a backrest;
a seat part; and
a seat part substructure, the seat part substructure being mounted such that it can swivel about a first swivel axis arranged in a width direction of the seat in order to move the seat part substructure together with the seat part from a sitting position into an upright position, wherein a lower region of the backrest with respect to a height direction of the seat and at least one of a rear region of the seat part and of the seat part substructure with respect to a longitudinal direction of the seat are interconnected in the sitting position by at least one releasable connection means and are not interconnected in the upright position, wherein the first swivel axis is fixed in a rotational manner to the seat part substructure, wherein the at least one releasable connection means is connected to the seat part, and wherein the seat part with the at least one releasable connection means is moveable with respect to the seat part substructure at least in the longitudinal direction of the seat.

US Pat. No. 10,112,411

TRANSFER APPARATUS

CANON FINETECH NISCA INC....

1. A transfer apparatus comprising:a transfer section that transfers a transfer surface of a transfer or protective film to one surface or both surfaces of a card-shaped recording medium;
a reverse section that reverses a front side and a backside of the recording medium in two-sided transfer;
a correction section that corrects a curl of the recording medium with the transfer surface transferred in the transfer section; and
a control section that controls the correction section,
wherein the control section controls the correction section so that a correction amount for the recording medium with the transfer surface firstly transferred to one surface in two-sided transfer is smaller than a correction amount for the recording medium with the transfer surface transferred to one surface in one-sided transfer; and
wherein the control section controls the correction section so that respective correction amounts to one and opposite surfaces for the recording medium in two-sided transfer are smaller than the correction amount for the recording medium to the one surface in one-sided transfer.

US Pat. No. 10,112,337

VOLUME CONTROLLED BLOWING-AIR FEED

KHS CORPOPLAST GMBH, Ham...

1. A method for controlling a blow-molding machine for producing a container of thermoplastic material, the method comprising the steps of:introducing a blowing gas for blow-molding the container into a thermally conditioned preform, while the preform is held in a blow mold of the blow-molding machine, including introducing the blowing gas during a preblowing phase into the preform so that the thermally-conditioned material of preform approaches walls of the blow mold; introducing the blowing gas during a following finish-blowing phase into the preform so that the thermally-conditioned material of the preform is pressed into contours of the walls of the blow mold; controlling a volumetric flow rate of the blowing gas at least during the preblowing phase by an adjustable flow-control valve, the flow control valve being controllable by a control unit that generates a control signal for setting the flow-control valve; and adjusting the flow-control valve as a function of the control signal, wherein the flow-control valve has a closing body that is movable between an open position and a closed position, wherein the controlling of the volumetric flow rate includes moving the closing body of the flow-control valve back and forth between the open and closed positions at an adjustable frequency to adjust the volumetric flow.

US Pat. No. 10,112,331

TOGGLE LEVER CLAMPING UNIT FOR AN INJECTION MOULDING MACHINE

1. A toggle lever clamping unit for an injection moulding machine, said toggle lever clamping unit comprising:a fixed platen;
a movable platen movable in relation to the fixed platen;
a support plate;
a toggle lever mechanism arranged between the support plate and the movable platen and operatively connected with both the support plate and the movable platen;
a cross clamp operatively connected with the toggle lever mechanism and movable along a machine longitudinal axis;
an electric drive operatively connected with the cross clamp for moving the cross clamp; and
a hydraulic drive operatively connected with the cross clamp, said hydraulic drive including a piston cylinder system which is operated by a pressure fluid and comprises a cylinder defined by a length and a piston rod defined by a length, with the lengths of the cylinder and the piston rod being coordinated with one another such that the hydraulic drive follows a travel path of the cross clamp as the movable platen travels between an open position of the clamping unit, in which the toggle lever mechanism is swung in, and a closed position in which the toggle lever mechanism assumes a predeterminable extended position and a clamping force is built up.

US Pat. No. 10,112,301

AUTOMATIC CALIBRATION METHOD FOR ROBOT SYSTEMS USING A VISION SENSOR

Tyco Electronics (Shangha...

1. An automatic calibration method for a robot system, comprising:calibrating a sensor and a sensor coordinate system of the sensor with respect to a world coordinate system;
controlling a robot under the guidance of the sensor to move a point of a tool mounted on the robot to reach a same target point with a plurality of different poses, the point of the tool being in a tool coordinate system; and
calculating a transformation matrix tcpTt of the tool coordinate system with respect to a tool center point coordinate system based on pose data of the robot at the same target point.

US Pat. No. 10,112,286

KNIFE SHARPENING SHEATH AND METHOD FOR MAKING THE SAME

LIFETIME BRANDS, INC., G...

1. A knife sheath comprising:a first side;
a second side opposite said first side;
an open end formed by the two opposing sides, said open end configured to receive a knife into the sheath formed by the two opposing sides;
a first opening in first side;
a second opening in the second side opposite said first opening, each of said first and second openings having a post separating each of the first and second openings into a proximal portion and a distal portion; and
a knife sharpening cartridge configured to extend through both of said proximal portions and secure to both of said posts to fix the knife sharpening cartridge to the opposing sides.

US Pat. No. 10,112,211

PAINTING APPARATUS COMPRISING AN AIR BAG

NIRLAT LTD, Kibbutz Nir ...

1. A faucet inserted into a paint port of a painting apparatus to control flow of paint removed from the painting apparatus, the faucet comprising:an external mold rotatably insertable into the paint port; wherein said external mold comprises one or more grooves enabling the rotatable insertion of the faucet into the paint port;
a faucet conduit comprising a conduit cavity and a conduit opening which is perpendicular to the conduit cavity;
an internal mold insertable into the external mold, said internal mold comprises an internal opening, wherein the internal opening is perpendicular to the conduit cavity;
a faucet valve to control flow of paint from the paint apparatus, said faucet valve comprises a faucet lever to control the flow of paint through the faucet conduit;
wherein the conduit cavity is configured to facilitate paint flow to the faucet valve, and wherein the conduit opening becomes aligned with the internal opening upon rotation of the faucet lever; and
a removable portion to prevent the faucet lever from opening the faucet valve prior to a first use of the painting apparatus, said faucet lever controls flow of paint through the faucet valve; wherein said removable portion is molded to be a part of the internal mold, said removable portion is shaped as an arch and prevents the faucet lever from moving, forcing the faucet lever to stay on one side of the removable portion;
wherein the faucet valve includes a clasp to prevent a paint tube from slipping off of the faucet valve.

US Pat. No. 10,112,204

PORTABLE PRESSURIZED SPRAYER

ForeFront Product Design,...

1. A method for spraying a liquid, the method comprising:releasably connecting a housing of a detachable electric pump module to a sprayer tank with a connector of the sprayer tank and without transferring liquids from an interior of the sprayer tank to the detachable electric pump module, wherein the sprayer tank holds a liquid for spraying and the housing can be connected or disconnected while the sprayer tank is pressurized;
actuating an electric pump positioned within the housing of the detachable electric pump module to pump gas through a check valve of the connector into the sprayer tank to force the liquid through a spray nozzle, the detachable electric pump module automatically maintaining a flow of the liquid through the spray nozzle;
monitoring a pressure within the sprayer tank to determine when the pressure exceeds a predetermined limit using an automatic switch assembly; and
switching the electric pump off after the pressure within the sprayer tank exceeds the predetermined limit using the automatic switch assembly,
wherein the connector automatically prevents over pressurization and relieves excess pressure when the pressure within the sprayer tank exceeds the predetermined limit, and automatically resets after normal operating pressure is resumed, independent of whether the housing of the detachable electric pump module is connected to the sprayer tank or disconnected from the sprayer tank.

US Pat. No. 10,112,153

THIN FILM COMPOSITE MEMBRANE STRUCTURES

3M Innovative Properties ...

1. A thin film composite membrane structure comprising: a selective membrane layer for ion rejection attached to a hydrophilic support layer, the hydrophilic support layer comprising a multi-zone microfiltration membrane that is asymmetric comprising:a porous support material; and
at least two microfiltration zones, where a first zone comprises a first membrane and a second zone that is attached to the first zone and that coats at least a portion of the depth of the porous support material;
wherein the first zone comprises a pore size that is smaller than a pore size of the second zone; and the pore size of the second zone is greater than the pore size of the first zone by a factor in the range of 1.1 to 500.

US Pat. No. 10,112,128

APPARATUS FOR SECURING UNDERDRAIN FILTER BLOCK

Xylem Water Solutions Zel...

1. An underdrain filter block for use in draining and backwashing a filtering media in a filter bed, the block comprising:a top wall;
a pair of side walls extending from the top wall;
a bottom wall extending between the pair of side walls; and
a transverse wall extending from one of the pair of side walls to the other of the pair of side walls,
wherein the top wall, the pair of side walls, and the transverse wall define an upper portion, wherein the pair of side walls, the transverse wall, and the bottom wall a lower portion, including a grout chamber positioned between the bottom wall and the transverse wall, wherein at least one of the bottom wall and said side walls contains an opening, and wherein the transverse wall forms a continuous imperforate barrier between the upper portion and the grout chamber;
wherein the top wall, the bottom wall, and the pair of side walls are defined by a first piece and the transverse wall is defined by a second piece; and
wherein side portions of the transverse wall are received by grooves defined by inner surfaces of each of the pair of side walls.

US Pat. No. 10,111,992

APPARATUS AND METHOD FOR DETERMINING THE LIQUID LEVEL OF SALVAGED BLOOD IN A BLOOD COLLECTION RESERVOIR OF AN AUTOLOGOUS BLOOD TRANSFUSION SYSTEM

Fresenius Kabi Deutschlan...

1. An autologous blood transfusion system for the recovery and washing of salvaged blood collected from a surgical site of a patient, comprising:a blood collection reservoir for storing the collected blood,
an optical detection setup for periodically detecting a liquid level of the salvaged blood in said blood collection reservoir and for outputting a corresponding output signal, and
a processor for determining the liquid level of the salvaged blood in said blood collection reservoir based on said output signal of said optical detection setup,
said optical detection setup comprising:
a plurality of light emitters disposed on a first side of said blood collection reservoir at different height levels for emitting light and
a plurality of light receivers disposed on a second side of said blood collection reservoir opposite to said first side for sensing light emitted by said light emitters and transmitted through said blood collection reservoir and for outputting said output signal; and
said processor further configured for:
identifying a conspicuous signal out of said output signals of said light receivers based on a comparison of output signals of at least two light receivers out of said plurality of light receivers, said conspicuous signal associated with an abnormal transmission change between the output signals of the at least two light receivers, the output signal of a first of the at least two light receivers being compared against the output signal of a second of the at least two light receivers and the first and second light receivers being directly adjacent,
varying a detection parameter of a light emitter and/or of a light receiver and/or of an amplifier associated with said conspicuous signal, and
repeating said step of determining the liquid level of the salvaged blood in said blood collection reservoir using said varied detection parameter.

US Pat. No. 10,111,867

PROCESS AND INTERMEDIATES FOR THE PREPARATION OF PERAMPANEL

MAPI PHARMA LTD., Ness Z...

1. A process for the preparation of 3-(2-cyanophenyl)-5-(2-pyridyl)-1-phenyl-1,2 dihydro-pyridin-2-one (Perampanel) represented by the structure of formula (1), and salts thereof,
comprising the following steps:
a). reacting a compound of formula (2) with a formylating agent to form a compound of formula (3)

wherein
Y is OR2 or NR3R4;
R1, R2, R3 and R4 are each independently a (C1-C4)-alkyl or an aryl; and
X is a group that can be converted to a CN group;
b). reacting compound (3) with aniline to form a compound of formula (4):

c). cyclizing the compound of formula (4) to form a compound of formula (5):
andd). converting compound (5) to 3-(2-cyanophenyl)-5-(2-pyridyl)-1-phenyl-1,2-dihydropyridin-2-one (1) (Perampanel).

US Pat. No. 10,111,866

COMPOUNDS AS REARRANGED DURING TRANSFECTION (RET) INHIBITORS

GlaxoSmithKline Intellect...

1. A compound which is N-(3-(2-(dimethylamino)ethoxy)-5-(trifluoromethyl)phenyl)-2-(4-(4-ethoxy-6-oxo-1,6-dihydropyridin-3-yl)-2-fluorophenyl)acetamide, represented by Formula (II):
or a pharmaceutically acceptable salt thereof.

US Pat. No. 10,111,811

AIR-COOLING MICRO DROP PILL CAPSULE PRODUCTION LINE

TASLY PHARMACEUTICAL GROU...

1. An air-cooling micro drop pill capsule production line comprising a drop pill system, an air-cooling circulation system and a control system,the drop pill system comprising a molten material tank and a dripper connected thereto, a vibration apparatus which drives the dripper to vibrate up and down is arranged between the molten material tank and the dripper, the vibration apparatus configured to generate a vibration shear force which cuts liquor flowing out from the dripper into drops, and forms drop pills after the drops fall into the air-cooling circulation system and are cooled,
an online monitoring apparatus arranged on the dripper, and comprising a pulse signal emission mechanism with an emission frequency which is the same as a vibration frequency of the vibration apparatus,
the control system configured to control and regulate a dropping parameter according to a monitoring result of the online monitoring apparatus,
the air-cooling circulation system comprising a cooling duct and a refrigerating apparatus connected to the cooling duct configured to refrigerate the cooling duct, wherein an interlayer is arranged outside the cooling duct and a lower part of the interlayer is configured to communicate with an interior of the cooling duct;
the refrigerating apparatus comprising a cooling air refrigerating apparatus and a cold trap refrigerating apparatus, wherein the cooling air refrigerating apparatus comprises a freezer, an air outlet of the freezer and a cooling air inlet of the cooling duct being communicated with each other such that cooling air rises circularly in an inner chamber of the cooling duct;
wherein the cold trap refrigerating apparatus comprises: a refrigerant storage tank containing a refrigerant, a refrigerator refrigerating the refrigerant in the refrigerant storage tank, and a heat exchanger, a refrigerant outlet of the refrigerant storage tank being connected to a refrigerant inlet arranged on an upper part of the interlayer such that the refrigerant is transferred into the interlayer through the refrigerant inlet, then transferred from the upper part of the interlayer to the lower part of the interlayer and then to the inner chamber of the cooling duct; the refrigerant configured to rise circularly together with the cooling air in the inner chamber of the cooling duct simultaneously, and then be discharged or recycled through a top of the cooling duct
the air-cooling circulation system further comprising a gas recycling apparatus including a first valve, a second valve, a gas recycling machine and a separator, one end of a duct controlled by the first valve being configured to communicate with the cooling duct, and another end thereof being configured to communicate with atmosphere; one end of a duct controlled by the second valve being configured to communicate with the cooling duct, and another end thereof being connected to the separator via the gas recycling machine;
the gas recycling machine further including a gas discharging pipe, a vortex blower, a gas recycling pipe and a gas recycling box, and when the second valve is opened, the vortex blower operates to extract gas in the cooling duct through the gas discharging pipe and to discharge gas collected by extraction into the gas recycling box through the gas recycling pipe.

US Pat. No. 10,111,806

DEVICE FOR DELIVERING MIST TO THE HUMAN FACE

KONINKLIJKE PHILIPS N.V.,...

1. A device for delivering mist to a person's face when placed in a predetermined operational orientation on the face, said device comprising:a. a nozzle panel defining an outlet area including separate first and second zones, wherein the second zone excludes the first zone, (i) the first zone including an elongated central portion of the outlet area of the nozzle panel, having a principal vertical orientation, and configured to limit delivery of mist to a corresponding area of a person's face that includes forehead, nose and chin, and (ii) the second zone including first and second portions of the outlet area of the nozzle panel, respectively adjoining principal sides of the elongated central portion of the first zone, and configured to limit delivery of mist to corresponding areas on left and right sides of the person's face that include left and right cheeks;
b. at least one nozzle disposed within the nozzle panel in the first zone and adapted to emit a first nebulized water mist having a first temperature via the elongated central portion of the outlet area of the nozzle panel in the first zone, whereby delivery of the first mist is limited to the corresponding area of the person's face; and
c. at least second and third nozzles disposed within the nozzle panel in the second zone and adapted to emit, simultaneously with the emitting of the first mist, respective second and third nebulized water mists via the first and second portions of the outlet area of the nozzle panel in the second zone, whereby delivery of the second and third mists is limited to the corresponding areas on the left and right sides of the persons' face, said second and third nozzles being adapted to simultaneously emit the respective second and third mists at a second temperature that is higher than the first temperature.

US Pat. No. 10,111,797

DEVICE FOR HEIGHT ADJUSTMENT OF AN OPERATING TABLE

MAQUET GMBH, Rastatt (DE...

1. A device for height adjustment of an operating table, including a lifting carriage which is movable relative to a chassis of the operating table, including a primary guide having a first longitudinal axis (L1) about which the lifting carriage is rotatable, including a secondary guide having a second longitudinal axis (L2), and including a guide which is connected to the chassis of the operating table and which has a contact area in which the guide contacts the secondary guide in a contact area of the secondary guide, wherein the primary guide and the secondary guide serve for guiding a lifting motion of the lifting carriage within an adjustment range of the lifting carriage parallel to the first longitudinal axis (L1), wherein a plane (E) extending perpendicular to the first longitudinal axis (L1) and through the guide has a first point of intersection (S1) with the first longitudinal axis (L1) and a second point of intersection (S2) with the second longitudinal axis (L2), wherein the position (P1, P2) of the second point of intersection (S2) changes by a displacement distance during the lifting motion of the lifting carriage within the adjustment range thereof, and wherein the connection between the guide and the chassis permits a compensating motion of the guide such that the contact area of the guide is shiftable by said displacement distance.

US Pat. No. 10,111,791

BED DEVICE

PARAMOUNT BED CO., LTD., ...

1. A bed device comprising:an input terminal capable of receiving an operation input;
a controller configured to connect to the input terminal and to control a movement of the bed in accordance with the operation input; and
a detector configured to detect a position of a user on the bed, wherein
when the operation input is received, if at least part of the detected position of the user is on a first area, the first area being defined on the bed, the controller is configured to temporarily restrict the movement of the bed corresponding to the operation input, and the controller notifies an alert in accordance with notifying information associated with the first area and the bed movement content, and
upon receipt of a confirmation of the alert notification, the controller is configured to remove the temporary restriction and move the bed in correspondence with the operation input.

US Pat. No. 10,111,787

APPARATUS FOR A DIAPER, A SYSTEM, A DIAPER AND A METHOD OF MANUFACTURING AN ELECTRODE

Agency for Science, Techn...

1. An apparatus for a diaper, the apparatus comprising:a plurality of electrodes; and
an electronic device coupled to at least two electrodes of the plurality of electrodes;
the at least two electrodes of the plurality of electrodes being operable to generate a potential difference when electrically connected together by ionized liquid, and the electronic device being operable to generate an alarm signal when the potential difference is generated, wherein the plurality of electrodes comprise at least two arc-shaped electrodes together forming at least a portion of a circle, and a further electrode being positioned inside the circle.

US Pat. No. 10,111,774

APPARATUS AND METHODS FOR TREATMENT OF OBSTRUCTIVE SLEEP APNEA UTILIZING CRYOLYSIS OF ADIPOSE TISSUES

Cryosa, Inc., Folsom, LA...

1. A method for treating obstructive sleep apnea in a subject, the method comprising steps of:contacting a target surface of an oropharyngeal tissue or an underlying tissue in a subject with obstructive sleep apnea with a cooling surface or a cooling fluid;
cooling the target surface of the oropharyngeal tissue or the underlying tissue in the subject with obstructive sleep apnea for a time sufficient to cause cryolysis of adipose tissue within the oropharyngeal tissue; and
reducing a volume of the adipose tissue within the oropharyngeal tissue.

US Pat. No. 10,111,772

GASTRIC TUBES AND METHODS OF USE

Covidien LP, Mansfield, ...

1. A gastric tube for use in a bariatric surgical procedure, comprising:an elongate tube including an outer surface defining a groove in the outer surface, the groove extending along a length of the elongate tube and including:
a proximal portion extending along a proximal end portion of the elongate tube and having a first dimension; and
a distal portion extending along a distal end portion of the elongate tube and having a second dimension, different than the first dimension of the proximal portion; and
a movable component supported in the groove of the elongate tube and movable between an unexpanded configuration in which the movable component is disposed within the groove and an expanded configuration in which at least a portion of the movable component extends outwardly from the outer surface of the elongate tube, wherein the movable component has a distal end that is fixedly coupled to the distal end portion of the elongate tube.

US Pat. No. 10,111,757

DEVICES AND METHODS FOR SPINAL STABILIZATION AND INSTRUMENTATION

Cogent Spine, LLC, San D...

1. A device sized to be at least partially implanted within an intervertebral disc space, the device comprising:a first member that comprises:
(i) a first top surface and an opposing first bottom surface that are connected by at least a first side surface;
(ii) a first internal channel extended along an axis extended from said first top surface to the opposing first bottom surface;
(iii) a first front surface and a first back surface, the first member extended from said first front surface to the first back surface along a first longitudinal axis; and
(iv) a second internal channel extended from said first back surface to intersect said first internal channel;
a second member that comprises:
(i) a second top surface and an opposing second bottom surface that are connected by at least a second side surface; and
(ii) a second front surface and a second back surface, the second member extended along a second longitudinal axis from the second front surface to the second back surface; and
a linkage that comprises:
(i) a first portion that is configured to be at least partially received within said first internal channel of the first member, and is sized to translate therein; and
(ii) a second portion extended away from the first portion along a third longitudinal axis of the linkage, said second portion being at least partially received within said second internal channel of the first member;
wherein the device is configured to transition from a first configuration to a second configuration, the first configuration comprising:
(i) said first back surface of the first member positioned to face said second front surface of the second member; and
(ii) the third longitudinal axis of the second portion of the linkage positioned to be at least one of parallel or colinear to said first longitudinal axis of the first member; and
the second configuration comprising:
(i) the third longitudinal axis of the second portion of the linkage positioned non-parallel and non-colinear to said first longitudinal axis of the first member; and
wherein said transition between the first configuration and the second configuration produces movement of said linkage relative to said first member, said movement comprising:
(i) a rotation of said first portion of the linkage around the axis that extends from said first top surface to said opposing first bottom surface of the first member; and
(ii) a translation of the first portion of the linkage within said first internal channel of the first member.

US Pat. No. 10,111,756

MESH SPACER HYBRID

Spineology Inc., St. Pau...

1. An implant for performing an intervertebral fusion on adjacent vertebral bodies in a patient, and for being located entirely in a space between opposing end plates of the adjacent vertebral bodies, the implant comprising:a first intervertebral spacer body, defining a top side oriented to contact a first one of the opposing end plates when the implant is implanted in the space between opposing end plates and an opposing bottom side oriented to contact a second one of the opposing end plates when the implant is implanted in the space between opposing end plates;
a second intervertebral spacer body; and
a porous and expandable enclosed container, the container having a first end and a longitudinally opposing second end,
wherein the first end of the container is coupled to the first intervertebral spacer body and the second end of the container is coupled to the second intervertebral spacer body,
wherein the container is at least partially exposed between the first intervertebral spacer body and the second intervertebral spacer body to the opposing end plates when the implant is implanted in the space between opposing end plates, and
wherein the first intervertebral spacer body defines a non-circular outer perimeter in a cross-section taken perpendicular to its longitudinal axis.

US Pat. No. 10,111,742

STENT-GRAFT HAVING SUPPORTED TRANSITION STENT AND METHOD

MEDTRONIC VASCULAR, INC.,...

1. A stent-graft comprising:a graft material comprising:
a main body;
a first leg;
a second leg; and
a transition region where the first leg and the second leg meet the main body;
a main body transition stent coupled to the main body;
a transition stent support coupled to the graft material, a transition apex of the main body transition stent being interposed between the transition stent support and the graft material, the transition apex being aligned with the transition region; and
a first leg transition stent coupled to the first leg directly adjacent to the main body transition stent.

US Pat. No. 10,111,738

POLYHYDROXYALKANOATE MEDICAL TEXTILES AND FIBERS

Tepha, Inc., Lexington, ...

1. A knitted mesh comprising oriented polymeric monofilament fibers, wherein the polymer consists of P4HB homopolymer and wherein the fibers are produced by a method comprising drying the polymer, extruding the polymer at a temperature between 100° C. and 220° C., allowing the polymer time to crystallize, and then drawing the polymer to stretch ratios from 6 to 11× at a temperature above the polymer's glass transition temperature.

US Pat. No. 10,111,733

DEVICE, SYSTEM AND METHOD FOR PROSTHODONTIC RESTORATION

ABRACADABRA IMPLANTS LTD,...

1. A dental implant abutment assembly for forming an individually customized dental implant abutment mounted on a dental implant anchor adapted to be implanted and having an internal connection platform, wherein the abutment assembly is individually customizable, the abutment assembly including:a. an adjustable abutment pivot provided for coupling to the dental implant anchor, wherein said customized dental implant abutment is centered around said adjustable abutment pivot; said adjustable abutment pivot having an apical end and an occlusal end;
i. said apical end defines a pivot mounting member for mounting and securely coupling said pivot with the dental implant anchor with at least one coupling portion selected from the group consisting of: threading, Morse angle, friction fit, snap fit, and any combination thereof; said pivot mounting member comprising a tooling interface provided to facilitate maneuvering said pivot with optional tools;
ii. said occlusal end extending from and continuous with said pivot mounting member forming a pivot projection, said pivot projection is a malleable rod characterized in that said rod may be individually customized to provide a desired vertical dimension in the vertical plane relative to said mounting member and a desired angle in any direction in the occlusal plane; said pivot projection further comprises a plurality of adjustable portions and engaging portions along the length of said pivot projection; said adjustable portions are disposed between said engaging portions, said adjustable portions are provided to adjust the length and angular position of said pivot projection relative to said apical end of said pivot; said engaging portions feature external threading having the same thread parameters; and
b. an interface member, the interface member provided for coupling with the implanted dental implant anchor along the implant's internal connection platform, the interface member is a hollow tubular member featuring a non-customizable distal portion and a customizable proximal portion forming a lumen defined along its length between the distal portion and proximal portion; wherein said lumen is configured to receive said adjustable abutment pivot and filling material:
i. the distal portion defining a non-customizable anchor coupling interface having an external surface for matching and internally fitting within the implant anchor's internal connection platform;
ii. the proximal portion having an elevated rim configured to be customizable so as to assume a shape, angle and vertical dimension according to an individual's gingival morphology wherein once customized said elevated rim defines a trans-gingival collar of the abutment assembly and an upper end thereof defining a shoulder on which a restoration is supported;said abutment assembly is characterized in that all of its members are customizable by a practitioner, according to an individual's gingival morphology and prosthodontic requirements of a patient, wherein said customization is provided at a proximal or occlusal end of said abutment assembly members, wherein the proximal and occlusal ends are customized to be provided with at least one of a desired surface, angle, or vertical dimension.

US Pat. No. 10,111,732

SELF-LIGATING BRACKET

American Orthodontics Cor...

1. A self-ligating bracket comprising:a bracket body having a mesial side opposed from a distal side and a labial side opposed from a lingual side, the bracket body comprising an arch wire slot that extends across the bracket body from the mesial side to the distal side and extends lingually into the bracket body from the labial side; and
a spring clip comprising a distal arm comprising a distal arm body and a distal finger and a mesial arm comprising a mesial arm body and a mesial finger, wherein the distal finger and the mesial finger are located lingual of the distal arm body and the mesial arm body in a different plane from the distal arm body and the mesial arm body, the spring clip is slidably secured to the bracket body and movable between a closed position and an open position;
wherein in the closed position, the distal finger and the mesial finger are positioned at least partially within the arch wire slot to occlude the arch wire slot; and
wherein in the open position, the distal arm and the mesial arm are deformed to move the distal finger and the mesial finger labially and out of the arch wire slot.

US Pat. No. 10,111,728

PARTIAL SURGICAL GUIDE

Trophy, Marne la Vallee ...

1. A method for forming a surgical guide for drilling of a dental patient, comprising:mounting a block of machinable material having a prescribed shape to a holder;
rotating the block of machinable material by the holder about a rotation axis to a first angular position;
drilling a drill guiding hole through the block of machinable material using a drilling tool having a drilling tool axis that is orthogonal to the rotation axis, wherein the drill guiding hole is centered about a guide axis that is substantially orthogonal to the rotation axis;
repositioning the block of machinable material by the holder and forming a first planar surface of the surgical guide from the block of machinable material using the drilling tool, wherein the first planar surface is oblique to the guide axis;
repositioning the block of machinable material to orient the first planar surface orthogonal to the drilling tool axis;
forming a hole pattern having two or more positioning holes in the first planar surface using the drilling tool, wherein the hole pattern corresponds to a pin pattern in a tray that is positionally registered to a dental arch of the patient; and
repositioning the block of machinable material by the holder and forming a second planar surface of the surgical guide from the block of machinable material using the drilling tool to complete the surgical guide, wherein the second planar surface is parallel to the first planar surface,
where the holder is configured to move the block of machinable material with respect to the drilling tool when forming the surgical guide only along each of orthogonal axes X, Y, and Z, and where the rotation axis is the X-axis, and where the rotation of the holder with respect to the drilling tool is only around the X axis.

US Pat. No. 10,111,725

MASSAGE TOOL CASE

15. An instrument assisted soft tissue mobilization (IASTM) system comprising:a first substantially flat massage tool;
a case comprising a structure with a top surface, the top surface having a first recess shaped to receive and situate the first substantially flat tool in a horizontal position relative to the top surface, and the structure including a first slot having a top opening width that is larger than a bottom width of the first slot to receive and situate the substantially flat tool in an angled position extending away from the top surface;
a box separated into a first cavity and a second cavity, the first cavity configured to accept the structure, the structure inserted therein;
an accessory;
an additional structure configured to fit in the second cavity and inserted therein, the additional structure having a top surface with a third recess shaped to receive and situate the accessory, the accessory inserted into the third recess;
a lid divided into a first section, a second section, and a third section,
a rear top edge of the box hingedly attached to an inner edge of the first section of the lid, an outer edge of the first section of the lid hingedly attached to an inner edge of the second section of the lid, and an outer edge of the second section of the lid hingedly attached to an inner edge of the third section of the lid,
the first section of the lid and the third section of the lid each having a length about equal to a height of the box, and the second section of the lid having a length about equal to a difference between the length of the box and the height of the box,
the lid configured to have an open position with the first section of the lid folded against a back wall of the box, and the second section of the lid and the third section of the lid folded against a bottom surface of the box, and
the lid further configured to have a closed position with the first section of the lid and the second section of the lid laying over a top of the box, and the third section of the lid folded against a front wall of the box and held in place by a magnetic attraction between magnetic material in the third section of the lid and magnetic material in the front wall of the box.

US Pat. No. 10,111,714

ADHESIVE OBJECTS FOR IMPROVING IMAGE REGISTRATION OF INTRAORAL IMAGES

Align Technology, Inc., ...

1. A method comprising:receiving, by a processing device, data from an intraoral scan of a patient responsive to performance of the intraoral scan being performed by an intraoral scanner, the data comprising a plurality of intraoral images of a dental site;
receiving, by the processing device, an indication that at least two intraoral images of the plurality of intraoral images comprise a representation of less than an entirety of a non-rigid adhesive object that was affixed to the dental site at a target area, wherein the non-rigid adhesive object has known properties comprising a known two-dimensional (2D) surface pattern and at least one of a known thickness, a known size, a known shape or a known color, wherein the non-rigid adhesive object provides a reference point for image registration, wherein the at least two intraoral images comprise a first intraoral image comprising a representation of a first portion of the known 2D surface pattern that is not shown in a second intraoral image and the second intraoral image comprising a representation of a second portion of the known 2D surface pattern that is not shown in the first intraoral image, the first intraoral image being non-contiguous with the second intraoral image, and wherein the non-rigid adhesive object partially deforms based on a shape of the target area, wherein partial deformation of the non-rigid adhesive object deforms at least one of the known shape or the known 2D surface pattern;
performing, by the processing device, pattern recognition to identify the non-rigid adhesive object having the known 2D surface pattern in the at least two intraoral images;
extrapolating a shape and orientation of the non-rigid adhesive object in the first intraoral image based on the representation of the first portion;
performing, by the processing device, image registration between the at least two intraoral images using the non-rigid adhesive object identified in the at least two intraoral images, wherein the image registration between the first intraoral image and the second intraoral image is performed using the extrapolated shape and orientation of the non-rigid adhesive object in the first intraoral image;
generating a three-dimensional model of the dental site based on the image registration;
determining a surface of a base of the non-rigid adhesive object that has been partially deformed based on the known properties of the non-rigid adhesive object and the partial deformation of the non-rigid adhesive object;
subtracting the representation of the non-rigid adhesive object from the three-dimensional model based on the known properties of the non-rigid adhesive object; and
interpolating a surface of a portion of the dental site where the non-rigid adhesive object was located based on a) data for other portions of the dental site and b) the surface of the base of the non-rigid adhesive object.

US Pat. No. 10,111,707

RENAL NEUROMODULATION FOR TREATMENT OF HUMAN PATIENTS

Medtronic Ardian Luxembou...

1. A method, comprising:intravascularly positioning a catheter in a reduced profile delivery configuration at a treatment site within a renal artery of a human patient and adjacent to renal nerves;
at the treatment site, transforming an expandable member at a distal portion of the catheter between the reduced profile delivery configuration and a treatment configuration,
wherein, in the treatment configuration, the expandable member is sized and shaped to place a plurality of electrodes arranged thereabout into apposition with an inner wall of the renal artery of the patient;
selectively energizing a first electrode group of the expandable member to deliver a bipolar energy field to the renal nerves; and
selectively energizing a second electrode group at the distal portion of the catheter to deliver a unipolar energy field to the renal nerves,
wherein delivering the bipolar energy field and the unipolar energy field modulates neural signaling along the renal nerves, and
wherein modulating neural signaling along the renal therapeutically beneficial reduction in blood pressure of the patient.

US Pat. No. 10,111,700

SURGICAL INSTRUMENTS INCLUDING 3D INJECTION MOLDED ELECTRICAL CIRCUITS AND CONNECTIONS

COVIDIEN LP, Mansfield, ...

1. An end effector assembly comprising:a first jaw member including a first electrically conductive plate; and
a second jaw member including a second electrically conductive plate, the first and second jaw members being operably moveable relative to one another between an open position and a clamped position wherein the first and second electrically conductive plates oppose each other, the first and second electrically conductive plates being configured to conduct energy through tissue clamped therebetween, the first jaw member further including:
a first insulative spacer having a rib and a conductive strip, the rib extending from a surface of the first insulative spacer towards the first electrically conductive plate, the conductive strip integrally formed on a surface of the rib contacting the first electrically conductive plate, the conductive strip configured to transmit a first electrical potential to the first electrically conductive plate.

US Pat. No. 10,111,694

PEDICLE SCREW ASSEMBLY AND METHOD OF ASSEMBLY

SKELETAL DESIGN PARTNERSH...

1. A pedicle screw assembly, comprising:a bone fastener having a head at a proximal end and a threaded portion extending between the proximal end and a distal end;
a compression member having a cylindrical outer surface and a conical inner surface;
a locking member having an outer surface adapted to mate with the conical inner surface of the compression member, wherein the outer surface of the locking member has a proximal portion and a distal portion with at least one of a circumferential flange and a circumferential groove, the proximal portion of the locking member further comprising a plurality of vertical slots, the slots extending from the outer surface to the inner surface and from a top of the proximal portion down to at least one of the circumferential flange and the circumferential groove in the distal portion, the slots being disposed around an outer circumference of the proximal portion, and wherein the locking member further comprises a relief extending from the outer surface to the inner surface and from a top of the proximal portion to a bottom of the distal portion; and
a receiving housing having a central bore extending from a proximal end to a distal end, wherein the distal end comprises a first opening sized to receive the head of the bone fastener and the proximal end comprises a second opening sized to receive the locking member and the compression member, wherein the receiving housing further comprises an intermediate portion extending between the proximal end and the distal end, and wherein the intermediate portion further comprises a retention mechanism extending from the intermediate portion of the receiving housing inwardly towards the central bore;
wherein the compression member is positioned below the retention mechanism and an uppermost surface of the compression member engages a bottommost surface of the retention mechanism of the receiving housing.

US Pat. No. 10,111,693

ORTHOPEDIC EXTERNAL COMPRESSION PLATE

1. An orthopedic locking plate unit for connecting and compressing fractured bone without direct contact and friction between the locking plate unit and the fractured bone, wherein the locking plating plate unit comprises:a locking plate, an external apparatus and a holder, the locking plate including a plurality of circular locking holes and at least one elongated hole, the at least one elongated hole provided on at least one side of the locking plate, and the holder being placed at the at least one elongated hole;
wherein said holder is configured to hold the locking plate above the fractured bone for enabling movement of the locking plate in a horizontal direction;
wherein said holder is in a dumbbell shape and comprises a hole throughout a length of the holder at a centre thereof for receiving a drill bit or tap and a longitudinal slit throughout a radius at an outer surface thereof for facilitating press fit and release; and
wherein the external apparatus includes a compression unit, a fixing unit and a box.

US Pat. No. 10,111,664

CLOSURE SYSTEM AND METHODS OF USE

INTEGRATED VASCULAR SYSTE...

1. A closure component configured to cooperate with tissue and be delivered from an elongate member, the closure component comprising:at least two distally extending legs;
a narrow region proximal the at least two distally extending legs; and
a fastener disposed relative to the at least two distally extending legs with a portion of the fastener extending distally beyond the narrow region in a pre-deployed configuration, the fastener configured to direct opposing legs of the at least two distally extending legs inwardly towards one another;
wherein the closure component has a deployed configuration where the opposing legs of the at least two distally extending legs are directed inwardly towards one another to engage and cooperate with the tissue and a portion of the closure component at the narrow region has fractured under strain to separate the closure component from the elongate member.

US Pat. No. 10,111,648

PROCEDURAL SHEATH ADAPTER FOR VASCULAR CLOSURE DEVICE

TERUMO PUERTO RICO, LLC, ...

1. A sheath adapter configured for use between a tissue puncture closure device and a procedural sheath, the procedural sheath adapted for insertion into a tissue puncture, and the tissue puncture closure device adapted for partial insertion into the procedural sheath and sealing of the tissue puncture, the sheath adapter comprising:a sheath connection portion positioned at a distal end of the sheath adapter, the sheath connection portion including at least one latch member configured to releasably mount the sheath adapter to the procedural sheath by extending into a recess of the procedural sheath;
a closure device connection portion of the body positioned at a proximal end of the sheath adapter, the distal end and the proximal end being opposite ends of the sheath adapter with respect to a central axis of the adapter, said central axis extending between the distal end and the proximal end, the proximal end defining a proximal end wall which faces a direction along the central axis away from the distal end, said proximal end wall, as viewed in a cross-section taken along the central axis, extending perpendicular to the central axis;
the closure device connection portion having at least one connection aperture opening on the proximal end wall and sized to releasably mount the sheath adapter to the tissue closure device by receiving a sheath connection member of the tissue closure device, the at least one connection aperture having a closed perimeter within the closure device connection portion and being disposed radially inward, with respect to the central axis, of the at least one latch member;
an open aperture opening on the proximal end wall and configured to receive passage of a carrier tube of the tissue puncture closure device through the sheath adapter.

US Pat. No. 10,111,647

APPARATUS AND METHOD FOR GENERATING ULTRASONIC IMAGE

SAMSUNG ELECTRONICS CO., ...

1. An apparatus for generating an ultrasonic image, comprising:an ultrasonic transducer which has an ultra-wideband frequency transfer characteristic;
a pulse generator which generates a plurality of ultrasonic pulses, wherein each pulse of the plurality of ultrasonic pulses has a different respective center frequency within a frequency band of the ultrasonic transducer, wherein the pulse generator comprises a plurality of bandpass filters;
a controller which controls the pulse generator to:
generate a first ultrasonic pulse using a first bandpass filter of the plurality of bandpass filters, wherein the first ultrasonic pulse corresponds to a first focal point at a first depth,
generate a second ultrasonic pulse using a second bandpass filter of the plurality of bandpass filters, wherein the second ultrasonic pulse corresponds to a second focal point at a second depth different than the first depth, and the second ultrasonic pulse is orthogonal to the first ultrasonic pulse;
an ultrasonic transducer configured to simultaneously transmit the first ultrasonic pulse and the second ultrasonic pulse; and
a processor configured to generate, based on reflected signals corresponding to the first ultrasonic pulse and the second ultrasonic pulse, the ultrasonic image.

US Pat. No. 10,111,602

APPARATUS FOR USE FOR PROVIDING INFORMATION ON AT LEAST ONE MUSCLE IN A PATIENT

UNIVERSITY OF SOUTHAMPTON...

1. An apparatus for providing information on at least one muscle in a patient, which apparatus comprises:(i) a signal generator configured to provide measurement-enabling signals for the at least one muscle;
(ii) first contact electrodes configured to enable the measurement-enabling signals from the signal generator to be received by the patient;
(iii) a measurement sub-system configured to measure a parameter of the at least one muscle, the parameter being affected by the measurement-enabling signals, and the parameter relating to at least one electrical property that is indicative of changes solely in muscle impedance caused by movement of the at least one muscle; and
(iv) a garment which is for being worn over the at least one muscle in the patient and which garment comprises an array of separate electrically conducting areas that conduct transversely through the garment, each of the separate electrically conducting areas being separated by non-electrically conducting areas or by lower electrically conducting areas,
(v) wherein the first contact electrodes are securely positionable on the garment at a predetermined precise position for obtaining the measured parameter and with the first contact electrodes being in contact with the separate electrically conducting areas in the garment that are over the predetermined position.

US Pat. No. 10,111,457

TOBACCO MATERIAL AND TREATMENT THEREOF

British American Tobacco ...

1. A process for treating tobacco material wherein the treated tobacco material has an aerobic plate count of up to about 1000 CFU/g, the process comprising securing tobacco material within a moisture-retaining material and exposing the tobacco material to an ambient processing temperature of at least about 45° C. whilst secured within the moisture-retaining material, wherein the tobacco material has a packing density on a dry matter weight base of between about 200 kg/m3 and about 500 kg/m3 at the start of the process and has a moisture content of between about 10% and 15.5% before and during treatment.

US Pat. No. 10,111,376

SEED DEPTH AUTO-LEARN SYSTEM ASSOCIATED WITH A SEED DEPTH DEVICE FOR AN AGRICULTURAL PLANTER

STEERING SOLUTIONS IP HOL...

1. A seed depth device for an agricultural planter comprising:an electric motor;
an actuator driven by the electric motor and constructed and arranged to move between a home position and a full extension position;
a first stop proximate to the actuator when in the home position;
at least one controller including a computing processor and a computer readable storage medium configured to control the electric motor; and
a seed depth auto-learn system at least in-part stored and executed by the at least one controller, the seed depth auto-learn system configured to learn the home position based at least in-part on the actuator stalling upon the first stop, wherein the seed depth auto-learn system includes a positive direction stall module configured to;
initiate a first positive motion of the seed depth device in a positive direction for a predetermined first distance,
determine if the seed depth device is stalled,
initiate a second positive motion in the positive direction for a predetermined second distance if not stalled,
determine if the seed depth device is stalled, and
record an unverified home position after the seed depth device has stalled.
US Pat. No. 10,115,948

SEPARATOR FOR A NON-AQUEOUS SECONDARY BATTERY AND NON-AQUEOUS SECONDARY BATTERY

TEIJIN LIMITED, Osaka (J...

1. A separator for a non-aqueous secondary battery, comprising:a porous substrate, and
an adhesive porous layer that is coated on one side or both sides of the porous substrate, contains (1) the following polyvinylidene fluoride resin A and (2) the following polyvinylidene fluoride resin B, and has a porosity of from 30% to 52% and an average pore size of from 36 nm to 100 nm:
(1) polyvinylidene fluoride resin A selected from the group consisting of vinylidene fluoride homopolymers, and vinylidene fluoride copolymers containing structural units derived from vinylidene fluoride and structural units derived from hexafluoropropylene, a total content of structural unit derived from hexafluoropropylene in each of the vinylidene fluoride copolymers being 1.5 mol % or less of a total content of structural unit in each of the vinylidene fluoride copolymers; and
(2) polyvinylidene fluoride resin B selected from the group consisting of vinylidene fluoride copolymers containing a structural unit derived from vinylidene fluoride and a structural unit derived from hexafluoropropylene, a total content of structural unit derived from hexafluoropropylene in each of the vinylidene fluoride copolymers being greater than 1.5 mol % of a total content of structural unit in each of the vinylidene fluoride copolymers,
wherein, in the adhesive porous layer, a content of the polyvinylidene fluoride resin A is from 15 parts by mass to 40 parts by mass, and a content of the polyvinylidene fluoride resin B from 60 parts by mass to 85 parts by mass, when a total amount of the polyvinylidene fluoride resin A and the polyvinylidene fluoride resin B is taken as 100 parts by mass.
US Pat. No. 10,111,868

ANTINEOPLASTIC COMBINATIONS CONTAINING HKI-272 AND VINORELBINE

WYETH LLC, New York, NY ...

1. A method for treating a neoplasm in a patient in need thereof, consisting of administering to the patient:i) 100-300 mg of (E)-N-{4-[3-chloro-4-(2-pyridinylmethoxy)anilino]-3-cyano-7-ethoxy-6-quinolinyl}-4-(dimethylamino)-2-butenamide, or a pharmaceutically acceptable salt thereof; and
ii) vinorelbine, or a pharmaceutically acceptable salt thereof;wherein the neoplasm:a) overexpresses or amplifies HER-2; and
b) is selected from the group consisting of prostate cancer, myeloma, head and neck cancer, transitional cell carcinoma, and small cell and large cell neuroendocrine carcinoma of the uterine cervix.
US Pat. No. 10,112,910

CATALYSIS OF DIKETOPIPERAZINE SYNTHESIS

MannKind Corporation, We...

1. A method for the synthesis of N-protected 3,6-bis[4-aminoalkyl]-2,5-diketopiperazine comprising:a. a step for catalyzing a dehydrative cyclocondensation reaction of an amino acid having a free ?-amine group and a protected amine group, and
b. collecting the N-protected 3,6-bis[4-aminoalkyl]-2,5-diketopiperazine on a filter.
US Pat. No. 10,113,180

WHEAT STEM RUST RESISTANCE GENE

Commonwealth Scientific a...

1. A transgenic plant which has integrated into its genome a transgene comprising an exogenous polynucleotide encoding an Sr33 polypeptide, the polypeptide comprising an amino acid sequence which is at least 95% identical to the sequence set forth as SEQ ID NO: 1, wherein the polynucleotide is operably linked to a promoter capable of directing expression of the polynucleotide in a cell of the plant.
US Pat. No. 10,113,952

COMBINED VIBRATIONAL SPECTROSCOPY AND LASER INDUCED BREAKDOWN SPECTROSCOPY FOR IMPROVED MINERALOGICAL AND GEOCHEMICAL CHARACTERIZATION OF PETROLEUM SOURCE OR RESERVOIR ROCKS

Ingrain, Inc., Houston, ...

1. A method for determining mineralogy or geochemistry of a sample of a petroleum source or reservoir rock, comprising:a) obtaining one set of spectral data comprising vibrational spectral data on the sample;
b) obtaining another set of spectral data comprising LIBS spectral information on the sample, or a second sample of the petroleum source or reservoir rock that has a similar composition and structure;
c) obtaining mineralogical information or geochemical information on the sample using the two sets of spectral data
d) obtaining spatial information on the sample, using a vibrational spectroscopy measurement device or a LIBS measurement system; and
e) determining spatially resolved geochemical information for the sample using the mineralogical information or geochemical information and the spatial information.
US Pat. No. 10,113,203

DIAGNOSIS KIT AND CHIP FOR BLADDER CANCER USING BLADDER CANCER SPECIFIC METHYLATION MARKER GENE

GENOMICTREE, INC., Daeje...

1. A method for detecting CpG methylation of PENK (proenkephalin gene), the method comprising the steps of:(a) isolating a genomic DNA from a clinical sample;
(b) treating the genomic DNA from step (a) with bisulfite; and
(c) determining hypermethylation of the CpG of the PENK gene in the bisulfite-treated genomic DNA from step (b) by using primer(s) to amplify a methylated CpG of the bisulfite-treated PENK gene, wherein the primer(s) for amplifying a methylated CpG of PENK comprises sequence(s) selected from the group consisting of SEQ ID NOs: 43-44, 46-185, 187-298, 300-341, 343-468, 470-579, 581-704, 706-841, 843-976, 978-1097, 1099-1210, 1212-1221.
US Pat. No. 10,111,932

COAGONISTS OF GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AND NEUROPEPTIDE Y2 RECEPTOR

Syracuse University, Syr...

1. A composition for simultaneously treating obesity and insulin deficiency, comprising a peptide sequence selected from the group consisting of HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3), HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4), IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2 (SEQ ID NO: 15), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2 (SEQ ID NO: 16), and HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY (SEQ ID NO: 17).
US Pat. No. 10,113,222

ALUMINIUM ALLOY WHICH IS RESISTANT TO INTERCRYSTALLINE CORROSION

Hydro Aluminium Rolled Pr...

1. Aluminium alloy consisting of alloy components, which have the following composition in % by weight:2.91%?Mg?4.5%,
0.5%?Mn?0.8%,
0.05%?Cu?0.30%,
0.05%?Cr?0.30%,
0.05%?Zn?0.9%,
Fe<0.40%,
Si<0.25%,
Ti<0.20%,the balance Al and impurities individually less than 0.05% and in total a maximum of 0.15% and wherein the following applies to the alloy components Zn, Cr, Cu and Mn:(2.3* %Zn+1.25* %Cr+0.65* %Cu+0.05* %Mn) +2.4?%Mg and
(2.3* %Zn+1.25* %Cr+0.65* %Cu+0.05* %Mn) +1.4?%Mg.
US Pat. No. 10,112,992

ANTIGENS ASSOCIATED WITH ENDOMETRIOSIS, PSORIATIC ARTHRITIS AND PSORIASIS

Philogen S.P.A., Siena (...

1. A method of delivering a molecule to the neovasculature of endometriotic tissue in a human or animal, said molecule being conjugated to a specific binding member which binds the ED-A isoform of fibronectin to form a conjugate and the method comprises administering the conjugate to the human or animal, wherein the specific binding member is an anti-EDA antibody or antigen binding fragment thereof comprising a heavy chain variable (VH) domain and a light chain variable (VL) domain, wherein(i) the heavy chain variable (VH) domain comprises heavy chain CDR1, CDR2 and CDR3 amino acid sequences in SEQ ID NO: 16; and
(ii) the light chain variable (VL) domain comprises the light chain CDR1, CDR2 and CDR3 amino acid sequences in SEQ ID NO: 78.
US Pat. No. 10,113,266

TREATMENT OF FILAMENTS OR YARN

E I DU PONT DE NEMOURS AN...

1. A method for treating a filament or yarn comprising:(a) forming a first mixture of reagents comprising first multi-functional isocyanate oligomers and first multi-functional epoxy oligomers, wherein the ratio of total isocyanate groups to total epoxy groups in the first mixture is in the range of from 0.8 to 1.2,
(b) dipping a filament or yarn into the first mixture of reagents,
(c) removing solvent from the dipped filament or yarn,
(d) dipping the filament or yarn from step (c) into a catalyst whereby the first isocyanate oligomers and the first epoxy oligomers form a network on the surface of the filament or yarn,
(e) forming a second mixture of reagents comprising second multi-functional isocyanate oligomers and second multi-functional epoxy oligomers, wherein the ratio of total isocyanate groups to total epoxy groups in the second mixture is in the range of from 0.8 to 1.2,
(f) dipping the filament or yarn of step (d) into the second mixture of reagents, and
(g) dipping the filament or yarn from step (f) into a catalyst whereby the second isocyanate oligomers and the second epoxy oligomers react to crosslink and form a network on the outer surface of the network formed by the first epoxy and first isocyanate oligomers of step (d), with the proviso that the double bonds present in the second epoxy and second isocyanate oligomers do not participate in the crosslinking reaction.
US Pat. No. 10,113,054

MOLDED ARTICLE COMPRISING POLYAMIDE RESIN COMPOSITION

ASAHI KASEI KABUSHIKI KAI...

1. A molded article comprising a polyamide resin composition comprising a polyamide resin and at least one alkali metal and/or alkaline earth metal element mixed therein, wherein(the average concentration of alkali metal and/or alkaline earth metal elements in a region within a depth of 3 ?m from the surface of the polyamide resin composition of the molded article)/(the average concentration of alkali metal and/or alkaline earth metal elements in a region of the polyamide resin composition of the molded article except for the region within a depth of 3 ?m from the surface of the polyamide resin composition of the molded article)>2.
US Pat. No. 10,111,814

DESENSITIZING TOOTHPASTE

NATIONAL TAIPEI UNIVERSIT...

1. A desensitizing toothpaste, comprising:DP-bioglass powder comprising 8.4% of Na2O, 40.6% of CaO, 39% of SiO2, and 12% of P2O5 based on total weight of the DP-bioglass, wherein the desensitizing toothpaste comprises 5% to 40% by weight of the DP-bioglass powder based on total weight of the desensitizing toothpaste;
a thickening agent which accounts for 1% to 5% of the total weight of the desensitizing toothpaste;
a humectant which accounts for 25% to 35% of the total weight of the desensitizing toothpaste;
a surfactant which accounts for 1% to 5% of the total weight of the desensitizing toothpaste;
phosphoric acid which accounts for 0.001% to 2% of the total weight of the desensitizing toothpaste; and
sodium dihydrogen phosphate which accounts for 0.001% to 2% of the total weight of the desensitizing toothpaste,
wherein the DP-bioglass powder is prepared by a process consisting essentially of the following steps: (a) heating evenly mixed material powder of Na2O, CaO, SiO2, and P2O5 to obtain molten glass; (b) quenching the molten glass in water to obtain DP-bioglass; and (c) grinding the DP-bioglass.

US Pat. No. 10,117,129

METHOD AND APPARATUS FOR BROADCASTING USING CHANNEL INFORMATION

Samsung Electronics Co., ...

1. An electronic device, comprising:a wireless communication module; and
a processor configured to:
transmit a broadcasting signal using at least one first channel predetermined among a plurality of channels, through the wireless communication module,
identify at least one channel used to transmit at least one signal by at least one external device, using the wireless communication module,
determine whether the at least one channel overlaps the at least one first channel,
determine at least one second channel among a remainder of the plurality of channels when the at least one channel overlaps the at least one first channel, and
transmit another broadcasting signal using the at least one second channel, through the wireless communication module.

US Pat. No. 10,117,122

TELECOMMUNICATIONS APPARATUS AND METHODS

SONY CORPORATION, Tokyo ...

1. A terminal device configured to operate in a wireless network configured to support communications with terminal devices using a primary component carrier operating on radio resources within a first frequency band and a secondary component carrier operating on radio resources within a second frequency band, wherein the wireless network supports a connected mode of operation in which terminal devices receive user-plane data from the wireless network using the primary and/or secondary component carrier and an idle mode of operation in which terminal devices do not receive user-plane data from the wireless network, the terminal device comprising:circuitry configured to
receive first Radio Resource Control (RRC) signaling transmitted from the wireless network to the terminal device over the radio resources within the first frequency band, the first RRC signaling indicating a measurement configuration for making measurements of radio channel conditions for radio resources within the second frequency band, wherein the first frequency band is a licensed frequency band in the wireless network and the second frequency band is an unlicensed frequency band in the wireless network;
identify the measurement configuration for making the measurements of radio channel conditions for radio resources within the second frequency band based on the first RRC signaling received from the wireless network, wherein the measurement configuration relates to at least measuring a signal strength received by the terminal device on the radio resources within the second frequency band;
measure radio channel conditions for radio resources within the second frequency band in accordance with the measurement configuration;
determine if the measurement of the signal strength comprising measurement of radio channel conditions meets a trigger criterion, and each time the trigger criterion is met, transmitting a measurement report to the network infrastructure equipment indicating that the trigger criterion has been met.

US Pat. No. 10,117,119

REDUNDANT LINKS FOR RELIABLE COMMUNICATION

1. A transmitting electronic device, comprising:an input port configured to receive information associated with a data stream;
a first interface circuit configured to communicatively couple to a first antenna and to communicate first packets between the transmitting electronic device and a receiving electronic device via a first channel using a wireless-local-area-network (WLAN) communication protocol, wherein the first packets include the information associated with the data stream;
a second interface circuit configured to communicatively couple to a second antenna and to communicate second packets between transmitting electronic device and the receiving electronic device via a second channel using the WLAN communication protocol, wherein the second packets include the information associated with the data stream and the second channel is different than the first channel;
wherein, in a first operating mode, the second packets are communicated concurrently with the first packets; and
wherein, in a second operating mode, the transmitting electronic device is configured to determine a distance to the receiving electronic device and an associated phase distortion for one of the first channel and the second channel, including determining a first estimate of the distance based on a received signal strength and refining the first estimate of the distance using one or more of an angle of arrival (AOA), a round trip time (RTT) and a time of arrival (TOA), while the information is communicated using the other of the first channel and the second channel.

US Pat. No. 10,117,116

SYSTEM AND METHOD SUPPORTING DELIVERY OF NETWORK ACCESSIBLE SERVICES TO CONNECTED DEVICES OF A LOCAL ENVIRONMENT

1. A system, comprising:a processing system including a processor; and
a memory that stores executable instructions that, when executed by the processing system, facilitate performance of operations, comprising:
monitoring, on-premises, a control channel of a service provider network, wherein the control channel comprises control messages that facilitate network access by a plurality of connected devices to a plurality of subscribed service functions that facilitate a delivery of subscribed services to the plurality of connected devices by way of a core portion of the service provider network, wherein the plurality of connected devices are on-premises equipment;
monitoring, on-premises, a data channel managed by the service provider network and separate from the control channel, wherein the data channel facilitates an exchange of user data between the plurality of connected devices, the core portion of the service provider network and the plurality of subscribed service functions;
discovering the on-premises equipment based on the monitoring of the control channel;
facilitating establishing local network connectivity between the processing system and the on-premises equipment; and
facilitating establishing a common communication channel between the processing system and the core portion of the service provider network, wherein the delivery of subscribed services is based on the exchange of the user data via the common communication channel.

US Pat. No. 10,117,112

AVOIDANCE OF INTERFERENCE IN WIRELESS COMMUNICATIONS

Higher Ground LLC, Palo ...

1. A method, comprising:determining, by a terminal of a first wireless communication network, a protection zone for each of a plurality of unintended receivers of a second wireless communication network, wherein a protection zone defines a geographical area where transmission by the terminal might interfere with operation of a corresponding unintended receiver;
determining, by the terminal at a time of an attempted transmission to an intended receiver in the first wireless communication network, a current location of the terminal;
determining, by the terminal, whether the current location is within any protection zone of the plurality of unintended receivers;
performing the transmission by the terminal in response to the current location not being within any protection zone of the plurality of unintended receivers;
performing, by the terminal in response the current location being within a protection zone of one or more of the plurality of unintended receivers, a local assessment of interference to the one or more unintended receivers;
performing the transmission by the terminal in response to the local assessment of interference concluding that there would be no interference with any of the one or more unintended receivers; and
preventing the transmission by the terminal in response to the local assessment of interference concluding that there would be interference with any of the one or more unintended receivers.

US Pat. No. 10,117,106

BACKOFF MECHANISM TECHNIQUES FOR SPATIAL REUSE

QUALCOMM Incorporated, S...

1. A method for wireless communication, comprising:receiving, at a first device, a packet;
decoding at least a portion of a preamble of the packet to determine whether the packet is sent by a member of an overlapping basic service set (OBSS), wherein the decoding comprises:
identifying a sequence in the preamble of the packet;
determining whether the sequence matches a sequence for packets intended for members of a BSS associated with the first device; and
determining that the packet is sent by the member of the OBSS in response to a determination that the match fails;
deferring a backoff operation in response to a start of the decoding; and
resuming the backoff operation in response to the determination that the packet is sent by the member of the OBSS, wherein the backoff operation is resumed before an end of the packet.

US Pat. No. 10,117,097

SHORT-RANGE CROSS-DEVICE AUTHORIZATION

United Services Automobil...

1. A computer-implemented method performed by a first computing device, the method comprising:receiving, by the first computing device, one or more identification (ID) signals transmitted from one or more second computing devices over a wireless network, each of the one or more ID signals identifying a respective second computing device that is authorized to access a remote service;
presenting, by the first computing device, a user interface (UI) that identifies the one or more second computing devices transmitting the one or more ID signals;
receiving, by the first computing device, a selection of a second computing device through the UI and, in response to the selection, transmitting a request for an authorization token, the request transmitted from the first computing device to the second computing device over the wireless network;
receiving, by the first computing device, the authorization token that is sent to the first computing device in response to a confirmation, provided through a second UI executing on the second computing device, that the first computing device is to be granted authorization to access the remote service; and
transmitting, by the first computing device, the authorization token to the remote service to indicate that the first computing device is authorized to access the remote service.

US Pat. No. 10,117,095

QUANTIFIED IDENTITY

Cable Television Laborato...

1. A method for determining a quantified identity for a device comprising:receiving a quantified identity (QI) request from an identity requester, the QI request indicating an identity determined by the identity requester as being associated with the device proximate in time to issuance of the QI request;
determining a certificate uniquely associated with the identity;
identifying a predetermined set of identity elements associated with the identity, the predetermined set of identity elements each having been previously provided the certificate;
determining from a calculation table or a calculation algorithm a plurality of weight values to represent whether the predetermined set of identity elements are operating in a manner consistent with how the device associated with the identity would interact with the predetermined set of identity elements proximate in time to receipt of the QI request;
determining a quantified identity for the device as a function of the plurality of weight values, the quantified identity indicating whether the identity associated with the QI request is likely to be that of the device or another device posing as the device; and
determining a location of the device proximate in time to receipt of the QI request, including increasing one or more of the plurality of weight values used in determining the quantified identity if the location is within a wireless range of the identity requester and decreasing one or more of the plurality of weighted values used in determining the quantified identity if the location is beyond the wireless range of the identity requester.

US Pat. No. 10,117,093

CONTROL OF USER EQUIPMENT IDENTITY DEPENDENT SERVICE

Telefonaktiebolaget LM Er...

1. A method, performed in an identity mediator node, of controlling a user equipment (UE) identity (ID) dependent service for a UE in a radio base station (RBS) of a wireless network, the method comprising:receiving, from a Mobility Management Entity (MME), a UE ID report comprising a permanent UE ID for a particular UE, a serving RBS identity for an RBS serving the particular UE, and a temporary UE ID for the particular UE in relation only to the serving RBS and the MME;
storing, for the particular UE, a record associating the temporary UE ID, the serving RBS identity, and the permanent UE ID; and,
upon receiving an order to activate the UE ID dependent service for the permanent UE ID, retrieving the temporary UE ID and the serving RBS identity from the stored record and sending a request to the serving RBS to activate the UE ID dependent service for the particular UE, wherein the request includes the temporary UE ID for the particular UE.

US Pat. No. 10,117,089

QUALITY OF EXPERIENCE AWARE MULTIMEDIA ADAPTIVE STREAMING

Intel IP Corporation, Sa...

1. A server operable to provide hyper-text transfer protocol (HTTP) adaptive streaming, the server comprising:memory; and a processor coupled to the memory, configured to:
determine a bandwidth available to the server for transmitting HTTP adaptive streaming content to a plurality of clients;
receive HTTP requests from the plurality of clients for representations offered by the server in a manifest file for the HTTP adaptive streaming stored in the memory;
calculate an availability of each representation that is offered in the manifest file for the server, wherein the availability is calculated, at least in part, based on the determined bandwidth; and
communicate the availability of each representation from the server to the plurality of clients as a maximum download rate to each of the plurality of clients, to configure each client to request the representations from the server having a bitrate less than the maximum download rate.

US Pat. No. 10,117,087

TERMINAL CLUSTERING

FUJITSU LIMITED, Kawasak...

1. A method of joining a first cluster including a first cluster head, the method comprising:receiving a first cluster beacon from the first cluster head, the first cluster beacon associated with the first cluster, the first cluster beacon including first cluster control information, including a first status indicator configured to indicate, at least, that the first cluster is at a cluster size capacity or is not at the cluster size capacity, the first cluster control information further including a first time synchronization indicator configured to indicate, at least, whether the first cluster head is time-synchronized with a predetermined timing source external to the first cluster head;
receiving a second cluster beacon from a second cluster head, the second cluster beacon associated with a second cluster, the second cluster beacon including second cluster control information, including a second status indicator configured to indicate, at least, that the second cluster is at the cluster size capacity or is not at the cluster size capacity, the second cluster control information further including a second time synchronization indicator configured to indicate, at least, whether the second cluster head is time-synchronized with a predetermined timing source external to the second cluster head;
choosing to join the first cluster based at least in part on the first status indicator and the first time synchronization indicator of the first cluster control information and the second status indicator and the second time synchronization indicator of the second cluster control information; and
transmitting a request to join the first cluster to the first cluster head.

US Pat. No. 10,117,086

SHARING OF PROXIMATE DISCOVERY ANNOUNCEMENTS IN A WIRELESS COMMUNICATIONS NETWORK

QUALCOMM Incorporated, S...

1. A method for a mobile device to share a discovery, comprising:receiving a first announcement from an announcement device, wherein the first announcement is a public announcement associated with at least one of an identity, location, event or service, the identity, location, event or service being associated with the announcement device;
notifying a user of the mobile device of the first announcement;
after the notifying of the user, receiving a share instruction;
generating discovery sharing data based on the received first announcement in response to the share instruction;
transmitting the discovery sharing data to an external server;
receiving an update indicator from the external server indicating that metadata associated with the mobile device has been updated; and
generating a second announcement based on the update indicator.

US Pat. No. 10,117,085

DEPLOYMENT OF PROXIMITY BEACON DEVICES

Aerohive Networks, Inc., ...

1. A system comprising:a network device, coupled to a network of an enterprise via a first communication interface, including a second communication interface and configured to provide wireless access to the network of the enterprise for wireless local area network (WLAN) stations;
a network device-coupled proximity beacon transmitter (PBT) device physically connected to the network device via the second communication interface, including a PBT configuration datastore storing PBT parameters, a beacon content datastore storing proximity beacon content, and a PBT;
wherein, in operation, the PBT transmits proximity beacons comprising proximity beacon content, including at least one value associated with a context defined by the enterprise or an entity acting on behalf of the enterprise, from the beacon content datastore in accordance with the PBT parameters from the PBT configuration datastore to form a personal area network (PAN) of the enterprise detectable by a proximity beacon receiver (PBR) device with a proximity beacon interpretation engine configured to interpret the proximity beacon content and the at least one value to indicate actual proximity to the network device in the context defined by the enterprise or the entity acting on behalf of the enterprise, and the network device establishes a direct wireless connection with the PBR device that received the proximity beacons from the PBT, and provides additional content associated with the proximity beacons to the PBR device through the direct wireless connection.

US Pat. No. 10,117,082

WIRELESS TECHNOLOGY BRIDGING SYSTEM

PAYPAL, INC., San Jose, ...

1. A wireless communication system, comprising:a first wireless subsystem that is configured to receive wireless communications of a first wireless technology type;
a second wireless subsystem that is configured to send wireless communications of a second wireless technology type that are different than the wireless communications of the first wireless technology type; and
a bridging engine that is coupled to each of the first wireless subsystem and the second wireless subsystem, wherein the bridging engine is configured to:
convert a first wireless communication of the first wireless technology type, which was received through the first wireless subsystem, to a first wireless communication of the second wireless technology type; and
provide the first wireless communication of the second wireless technology type to the second wireless subsystem such that the second wireless subsystem sends the first wireless communication of the second wireless technology type to at least a first device.

US Pat. No. 10,117,080

APPARATUS AND METHOD OF DETERMINING AN OPEN STATUS OF A CONTAINER USING RFID TAG DEVICES

Walmart Apollo, LLC, Ben...

1. A radio frequency identification (RFID) device comprising:a first portion of a container, the container being in a closed orientation and configured to be moved into an open orientation by a user;
a second portion of the container removably coupled to the first portion;
a first RFID tag fixed to the first portion and configured to communicate only in a near field of RFID communication;
a conductive element implemented at the second portion and located in proximity to the first RFID tag when the container is in the closed orientation and configured to function as a far field antenna for the first RFID tag such that the first RFID tag is readable by an RFID reader in a far field of RFID communication when the container is in the closed orientation; and
a second RFID tag fixed to the first portion such that the second RFID tag is shielded by the second portion and is not readable by the RFID reader when the container is in the closed orientation;
wherein the first portion and the second portion are configured such that upon a user action to open the container at least a first amount, the first portion and the second portion move relative to each other decoupling the conductive element from the first RFID tag such that the first RFID tag is no longer readable in the far field indicating a first open status of the container; and
wherein the first portion and the second portion are further configured such that upon a user action to open the container at least a second amount, the first portion and the second portion move relative to each other such that the second RFID tag is no longer shielded and is readable by the RFID reader indicating a second open status of the container.

US Pat. No. 10,117,077

PACKET-BASED USAGE TRACKING FOR A WIRELESS DEVICE

TracFone Wireless, Inc., ...

1. A system for tracking usage of a wireless device, comprising:a tracking processor configured to be implemented in at least one of the following: a mobile network operator system and the wireless device;
the tracking processor further configured to receive a first data packet and a second data packet that each include an identifier of a first type of wireless service;
the tracking processor further configured to monitor information regarding the first data packet, wherein the information regarding the first data packet includes the identifier of the wireless device, the identifier of a first type of wireless service, and an amount of data for the first type of wireless service;
the tracking processor further configured to determine a first usage of the first type of wireless service based on information regarding the first data packet;
the tracking processor further configured to store the first usage of the first type of wireless service for the wireless device;
the tracking processor further configured to monitor information regarding the second data packet, wherein the information regarding the second data packet includes the identifier of the wireless device, the identifier of the first type of wireless service, and an amount of data for the first type of wireless service;
the tracking processor further configured to determine second usage of the first type of wireless service based on the information regarding the second data packet;
the tracking processor further configured to store the second usage of the first type of wireless service for the wireless device;
the tracking processor further configured to accumulate the first usage of the first type of wireless service and the second usage of the first type of wireless service as a total usage of the first type of wireless service for the wireless device; and
the tracking processor further configured to store the total usage of the first type of wireless service for the wireless device,
wherein the identifier of the first type of wireless service is included in the first data packet and the second data packet.

US Pat. No. 10,117,072

SYSTEM AND METHOD FOR EFFICIENT SHORT MESSAGE SERVICE DELIVERY USING PRIVATE SUBSCRIBER IDENTITY INFORMATION

Verizon Patent and Licens...

1. A device, comprising:one or more memories; and
one or more processors, communicatively coupled to the one or more memories, to:
receive, from a subscriber identity module (SIM) over-the-air (OTA) (SIM OTA) device, a short message peer-to-peer (SMPP) message,
the SMPP message including an international mobile subscriber identity (IMSI) associated with a user device, and
the SMPP message being associated with modifying a universal integrated circuit card (UICC) of the user device;
determine, using the IMSI associated with the user device and without using a mobile station international subscriber directory number (MSISDN) of the user device, a network device to which the user device is connected; and
provide, to the network device, a short message service (SMS) message associated with modifying the UICC of the user device to permit the UICC of the user device to be modified.

US Pat. No. 10,117,067

LOCATION-BASED SELECTION OF A SATELLITE TRANSMITTER OF A VEHICLE

iHeartCommunications, Inc...

1. A method comprising:at a hub station, receiving data from a satellite antenna controller coupled to a vehicle, the satellite antenna controller coupled to a first frequency band satellite transmitter and to a second frequency band satellite transmitter of the vehicle, wherein the data includes a location of the vehicle;
transmitting the data to a system of a regulatory authority of a jurisdiction; and
based on determining that the location is within a threshold distance of a boundary of the jurisdiction, sending at least one command to the satellite antenna controller based on a requirement of the jurisdiction, wherein the at least one command indicates a selection of the first frequency band satellite transmitter or the second frequency band satellite transmitter.

US Pat. No. 10,117,066

SYSTEM AND METHOD FOR WIRELESS INTERFACE SELECTION AND FOR COMMUNICATION AND ACCESS CONTROL OF SUBSYSTEMS, DEVICES, AND DATA IN A VEHICULAR ENVIRONMENT

Cisco Technology, Inc., ...

1. A method comprising:intercepting a message in an on-board unit (OBU) of a vehicular network environment between a source and a receiver in the vehicular network environment;
verifying the source is authorized to send the message;
verifying the message is not altered;
evaluating a set of source flow control policies associated with the source; and
blocking the message if at least one policy of the set of source flow control policies indicates the message is not permitted, wherein the message is not permitted if a level of access assigned to the source in the set of source flow control policies does not match a level of access tagged on the message.

US Pat. No. 10,117,064

SYSTEMS AND METHODS FOR LEARNING WIRELESS TRANSCEIVER LOCATIONS AND UPDATING A SPATIALLY-DEPENDENT PATH-LOSS MODEL

Athentek Innovations, Inc...

1. A system to generate a spatially-dependent path-loss model associated with an indoor environment, the system comprising:wireless access points (APs) positioned throughout the indoor environment; and
a server comprising a processing unit, a memory unit, and a server communication unit, wherein the server communication unit is in communication with the wireless APs, wherein the processing unit is programmed to:
divide a coordinate-plane representing the indoor environment into non-overlapping tiles,
obtain AP transmit strengths of wireless signals generated by each of the wireless APs to the other wireless APs at a first frequency, wherein the AP transmit strengths are obtained from each of the wireless APs or a wireless signal-strength database,
obtain additional AP transmit strengths of wireless signals generated by each of the wireless APs to the other wireless APs at a second frequency different from the first frequency, wherein the additional AP transmit strengths are obtained from each of the wireless APs or the wireless signal-strength database,
obtain AP-to-AP received signal strength indicators (RSSIs) measured at each of the wireless APs from the wireless signals transmitted by the other wireless APs at the first frequency, wherein the AP-to-AP RSSIs are obtained from each of the wireless APs or the wireless signal-strength database,
obtain additional AP-to-AP RSSIs measured at each of the wireless APs from the wireless signals transmitted by the other wireless APs at the second frequency, wherein the additional AP-to-AP RSSIs are obtained from each of the wireless APs or the wireless signal-strength database,
calculate AP-to-AP distance vectors between each of the wireless APs,
construct a set of path-loss equations using the AP transmit strengths at the first frequency, the AP-to-AP RSSIs obtained at the first frequency, the AP-to-AP distance vectors, and a tile-specific path-loss coefficient for each of the tiles within the indoor environment,
construct another set of path-loss equations using the additional AP transmit strengths at the second frequency, the additional AP-to-AP RSSIs obtained at the second frequency, the AP-to-AP distance vectors, and another tile-specific path-loss coefficient for each of the tiles within the indoor environment,
solve the set of path-loss equations to yield a value for the tile-specific path-loss coefficient for each of the tiles within the indoor environment,
solve the other set of path-loss equations to yield a value for the other tile-specific path-loss coefficient for each of the tiles within the indoor environment, and
add AP-to-RP RSSIs to the wireless signal-strength database to update the wireless signal-strength database.

US Pat. No. 10,117,062

METHOD AND APPARATUS FOR VEHICULAR DEVICE-FUNCTION CONTROL

Ford Global Technologies,...

1. A system comprising:a processor configured to: transmit a series of impulses into a vehicle interior; receive data from a wearable-device receiver receiving the impulses, the data indicating arrival times and magnitudes of the impulses;
analyze the arrival times and magnitudes to determine a likely wearable device location; and
control a functionality aspect of a mobile device associated with the wearable device, based on the likely wearable device location;
wherein the processor is configured to determine one or more voxels in which the wearable device is likely located, the voxels having predefined associations to seating locations within the vehicle, and the determination based on a look-up of predefined expected signal values in a table predetermined for a vehicle model.

US Pat. No. 10,117,061

SYSTEMS AND METHODS TO TRACK MOVEMENT OF A DEVICE IN AN INDOOR ENVIRONMENT

Athentek Innovations, Inc...

1. A system to localize a device in an indoor environment, the system comprising:wireless signal transceivers positioned in the indoor environment, wherein the indoor environment contains one or more polygonal obstructions;
a server comprising a processing unit, a memory unit, and a server communication unit, and the processing unit is programmed to:
receive a signal strength profile, wherein the signal strength profile includes at least one of signal strengths of the wireless signal transceivers received at the device in the indoor environment and signal strengths of the device received at the wireless signal transceivers in the indoor environment;
determine a raw estimated location of the device in a coordinate plane representing the indoor environment by using a K-nearest neighbor (KNN) algorithm to compare the signal strength profile with reference profiles stored in a database;
calculate a straight-line path in the coordinate plane connecting the raw estimated location to an immediately preceding location of the device;
select the raw estimated location as the candidate location if the straight-line path does not intersect any of the polygonal obstructions in the coordinate plane using a polyxpoly( ) function as follows:
if isempty(polyxpoly[(x_old x_raw], [y_old y_raw], keepouts_x, keepouts_y))
[x_est, yet]=LPF(dt, x_old, y_old, e_raw, y_raw, p_gain, v_lim),
 wherein x_old and y_old represent the immediately preceding location,
 wherein x_raw and y_raw represent the raw estimated location, and
 wherein x_est and y_est represent the candidate location;
calculate a weighted-average location using the immediately preceding location and the candidate location; and
store the weighted-average location as a new location of the device in the indoor environment when a hypothetical velocity calculated using an elapsed time and a distance separating the immediately preceding location and the weighted-average location is less than or equal to a saturation velocity.

US Pat. No. 10,117,060

DETECTING HANDLING OF A DEVICE IN A VEHICLE

Allstate Insurance Compan...

1. A method comprising:determining, by a computing device, a change of an elevation of an apparatus;
determining, based on the change of the elevation of the apparatus, a time period;
determining, during the time period and based on acceleration measurements made by an accelerometer of the apparatus, an axis of gravity of the apparatus;
determining, based on orientation measurements made by a gyroscope of the apparatus, a rotation vector of the apparatus;
determining, based on the axis of gravity of the apparatus and the rotation vector of the apparatus, a rate of rotation of the apparatus perpendicular to the axis of gravity; and
responsive to a determination that the rate of rotation of the apparatus perpendicular to the axis of gravity exceeds a rotation rate threshold, determining, a frequency of handling events in which the apparatus is being used within a vehicle to adjust an insurance policy of the vehicle.

US Pat. No. 10,117,054

UNDESIRABLE ENCOUNTER AVOIDANCE

Microsoft Technology Lice...

1. A method of allowing a user to avoid unwanted encounters, the method comprising:determining whether an undesirable contact of the user has opted for sharing location information;
in response to determining that the undesirable contact has opted for sharing location information, collecting a location signal from the undesirable contact;
forecasting anticipated locations of the user over a period;
forecasting anticipated locations of the undesirable contact over the period based on the location signal of the undesirable contact;
determining a potential of encounter between the user and the undesirable contact based on analysis of anticipated locations of the user and the anticipated locations of the undesirable contact over the period; and
generating an undesirable encounter avoidance scheme based on the potential of encounter.

US Pat. No. 10,117,036

CALIBRATION METHOD AND CALIBRATION MODULE THEREOF FOR VIBRATION DEVICE

MediaTek Inc., Hsin-Chu ...

1. A calibration method for a vibration speaker, comprising:transmitting a plurality of vibration signals corresponding to a plurality of calibration frequencies to the vibration speaker and detecting a plurality of input currents or input power levels generated by an output stage of the vibration speaker corresponding to the plurality of calibration frequencies; and
determining a vibration point of a vibration unit of the vibration speaker according to the plurality of input currents or input power levels;
wherein the output stage is utilized for driving the vibration unit according to the plurality of vibration signals and comprises:
a first transistor, comprising a gate coupled to a first control voltage, a source coupled to a first voltage source, and a drain coupled to a first node that is coupled to the vibration unit;
a second transistor, comprising a gate coupled to a second control voltage, a source coupled to the first voltage source, and a drain coupled to a second node that is coupled to the vibration unit;
a third transistor, comprising a gate coupled to a third control voltage, a source coupled to a second voltage source, and a drain coupled to the first node; and
a fourth transistor, comprising a gate coupled to a fourth control voltage, a source coupled to the second voltage source, and a drain coupled to the second node.

US Pat. No. 10,117,033

HEARING PROSTHESIS HAVING AN IMPLANTABLE ACTUATOR SYSTEM

Cochlear Limited, Macqua...

1. An implantable device implantable in a recipient, comprising:a sealed housing;
an actuator assembly positioned in the housing and having at least one element displaceable relative to the housing; and
a displaceable material that is located between an interior wall of the device and a component of the actuator assembly, wherein the component of the actuator assembly is displaceable relative to the interior wall of the device, and wherein the displaceable material is displaced upon movement of at least a portion of the actuator assembly relative to the interior wall of the device, wherein
the device is configured to transfer vibrational energy from inside the housing to outside the housing via a solid transduction medium.

US Pat. No. 10,117,032

HEARING AID SYSTEM, METHOD, AND RECORDING MEDIUM

INTERNATIONAL BUSINESS MA...

1. A hearing aid system, comprising:a processor; and
a memory, the memory storing instructions to cause the processor to perform:
a cognitive state analysis circuit configured to analyze a cognitive state of a user;
a context analysis circuit configured to analyze a context of the user; and
an audio characteristic controller configured to control an audio characteristic of a hearing aid based on a joint assessment of a combined factor calculated by weighing together the cognitive state of the user and the context of the user,
wherein the context of the user and the cognitive state of the user are independent of each other, and
wherein the cognitive state includes at least one of:
a cohort condition; and
a cognitive level.

US Pat. No. 10,116,964

METHOD OF SUB-PREDICTION UNIT PREDICTION IN 3D VIDEO CODING

HFI INNOVATION INC., Zhu...

1. A method for three-dimensional or multi-view video encoding or decoding, the method comprising:receiving input data associated with a current texture PU (prediction unit) in a dependent view;
when a size of the current texture PU is not smaller than a threshold size and the current texture PU corresponds to a symmetric partition:
splitting the current texture PU into sub-PUs;
locating depth sub-blocks or texture sub-blocks in a reference view corresponding to the current texture PU using first derived DVs (disparity vectors); and
generating temporal prediction or inter-view prediction for the current texture PU using SPIVMP (sub-PU level inter-view motion prediction) or VSP (view synthesized prediction), the temporal prediction being based on motion information of the texture sub-blocks in the reference view, and the inter-view prediction being based on warped texture samples in the reference view using the depth sub-blocks;
when the current texture PU corresponds to an asymmetric partition:
locating a depth block or a texture block in the reference view corresponding to the current texture PU using a second derived DV; and
generating the temporal prediction or inter-view prediction for the current texture PU without using the SPIVMP or without using the VSP; and
encoding or decoding the current texture PU using the temporal prediction or the inter-view prediction.

US Pat. No. 10,116,896

DISPLAY APPARATUS AND CONTROL METHOD THEREOF

SAMSUNG ELECTRONICS CO., ...

1. A display apparatus comprising:a first signal transmission device comprising:
a first video cable configured to selectively transmit a first image signal transmitted by a first method and a second image signal transmitted by a second method;
an audio cable configured to transmit a sound signal, and
a first output connector connected to the first video cable and the audio cable;
a second signal transmission device comprising:
a second video cable configured to transmit a third image signal transmitted by the second method, and
a second output connector connected to the second video cable;
a receiver comprising a first input terminal to which the first output connector is configured to be connected, and a second input terminal to which the second output connector is configured to be connected; and
a controller configured to:
determine an image output mode based on whether the first output connector is connected to the first input terminal and whether the second output connector is connected to the second input terminal,
in response to determining that the first input terminal is connected to the first output connector and the second input terminal is not connected to the second output connector, determine the image output mode as a first mode to output a composite image by processing a composite signal, and
in response to determining that the first input terminal is connected to the first output connector and the second input terminal is connected to the second output connector, determine the image output mode as a second mode to output a component image by processing a plurality of component signals.

US Pat. No. 10,116,893

SELECTIVELY CONTROLLING A DIRECTION OF SIGNAL TRANSMISSION USING ADAPTIVE AUGMENTED REALITY

HIGHER GROUND LLC, Palo ...

1. A method comprising:(a) determining, by a communication device having an antenna, a direction to an intended transceiver, the direction being substantially in an actual direction to the intended transceiver;
(b) determining, by the communication device, a desired direction that is different from the direction to the intended transceiver;
(c) determining by the communication device, an anticipated direction to the desired direction;
(d) determining, by the communication device and based on the desired direction, parameters of expected energy values corresponding to a plurality of pre-defined antenna directions of the antenna around the desired direction;
(e) receiving, by the communication device using the antenna, a plurality of measured energy values corresponding to a plurality of antenna directions of the antenna around the anticipated direction;
(f) calculating, by the communication device, a directional offset using the parameters of expected energy values and the plurality of measured energy values;
(g) generating, by the communication device, an updated anticipated direction by updating the anticipated direction based on the calculated directional offset; and
(h) repeating steps (e) through (g) using the updated anticipated direction as the anticipated direction.

US Pat. No. 10,116,887

SOLID-STATE IMAGING DEVICE AND CAMERA

PANASONIC INTELLECTUAL PR...

1. A solid-state imaging device, comprising:a plurality of pixel circuits arranged in rows and columns;
a plurality of unit power supply circuits that generate a second power supply voltage from a first power supply voltage based on a reference voltage and supply the second power supply voltage to amplifier transistors provided in the plurality of pixel circuits; and
a regulator circuit that generates the reference voltage that is constant,
wherein each of the plurality of unit power supply circuits is provided for a corresponding one of the columns of the plurality of pixel circuits or for a corresponding one of the pixel circuits, and supplies the second power supply voltage to the amplifier transistors in the pixel circuits that belong to the corresponding one of the columns or to the amplifier transistor in the corresponding one of the pixel circuits.

US Pat. No. 10,116,789

MOBILE DEVICE LOCK-OUT SYSTEM

SafeRide Mobile, LLC, We...

1. A mobile electronic device comprising:a memory operable to store one or more modules;
a processor communicatively coupled to the memory, the processor operable to execute the one or more modules to:
detect a presence of a lock-out device, the lock-out device being built into a vehicle;
receive an indication that the vehicle is in motion, the vehicle including the mobile electronic device;
receive a predetermined selection of applications associated with the mobile electronic device; and
in response to receiving the indication that the vehicle is in motion and detecting the presence of the lock-out device,
cause the mobile electronic device to be at least partially inoperable by causing the predetermined selection of applications to be at least partially inoperable.

US Pat. No. 10,116,787

ELECTRONIC DEVICE, CONTROL METHOD, AND NON-TRANSITORY STORAGE MEDIUM

Kyocera Corporation, Kyo...

1. An electronic device comprising:a display;
a user interface;
a motion sensor; and
at least one controller that is configured to,
display a lock screen on the display;
detect a user touch operation on the user interface to cancel limitation of operations of the electronic device;
when the detected user touch is a registered finger touch, then display a first screen on the display in place of the lock screen; and
when the detected user touch is a registered thumb touch, then
determine a state of the electronic device based on an output of the motion sensor; and
when the determined state is a state of being held, then display a second screen, which is different from the first screen, in place of the lock screen.

US Pat. No. 10,116,737

OPTIMIZED CONSISTENT REQUEST DISTRIBUTION FOR BALANCED LOAD DISTRIBUTION IN A CONTENT DELIVERY NETWORK

Verizon Digital Media Ser...

1. A method comprising:receiving a plurality of requests over the Internet at a load distribution server allocating the plurality of requests across a plurality of distribution servers, the plurality of requests comprising a first set of requests directed to a first content type and a second set of requests directed to at least a different second content type, the load distribution server comprising a processor and memory storing an identifier identifying each server of the plurality of distribution servers, the processor:
producing a hash result for each server of the plurality of distribution servers, wherein said producing comprises hashing the identifier identifying each server of the plurality of distribution servers;
selecting a first load factor value for the first set of requests based on the first content type of the first set of requests, and a different second load factor value for the second set of requests based on the second content type of the second set of requests;
distributing the first set of requests across a first set of the plurality of distribution servers by adjusting the hash result produced for each server of the first set of distribution servers with the first load factor value and by selecting a server from the first set of distribution servers to receive each request from the first set of requests based on the hash result of each server of the first set of distribution servers as adjusted by the first load factor value, the first load factor value increasing selection precedence of any server of the first set of distribution servers over a different second set of the plurality of distribution servers; and
distributing the second set of requests across the second set of distribution servers by adjusting the hash result produced for the second set of distribution servers with the second load factor value and by selecting a server from the second set of distribution servers to receive each request from the second set of requests based on the hash result of each server of the second set of distribution servers as adjusted by the second load factor value, the second load factor value increasing selection precedence of any server of the second set of distribution servers over the first set of distribution servers.

US Pat. No. 10,116,729

DYNAMIC MEDIA TRANSFORMATION SERVICE IN A CDN

VERIZON DIGITAL MEDIA SER...

1. A method, comprising:configuring a network device in a content delivery network (CDN) with a plurality of visual presentation transformations the network device selectively applies during distribution of customer media, with application of each visual presentation transformation of the plurality visual presentation transformations changing presentation of the customer media on a display by changing a different visual property of the customer media;
receiving, at the network device from the customer, data associated with original customer media, wherein rendering the original customer media produces a first presentation on the display;
receiving, at the network device from the customer originating the original customer media, selection of a subset of visual presentation transformations from the plurality of media transformations that are to be applied to the original customer media prior to delivery;
receiving, at the network device from a client browser, a request for the original customer media;
applying, at the network device responsive to receipt of the request for the original customer media from the client browser, the subset of visual presentation transformations to the original customer media based on the selection of the subset of visual presentation transformations by the customer, wherein said applying generates modified customer media producing a second presentation on the display that is different than the first presentation of the original customer media; and
sending, from the network device to the client browser, the modified customer media in response to said request for the original customer media.

US Pat. No. 10,116,712

QUALITY OF EXPERIENCE BASED QUEUE MANAGEMENT FOR ROUTERS FOR REAL-TIME VIDEO APPLICATIONS

VID SCALE, INC, Wilmingt...

1. A node comprising a processor configured, at least in part, to:receive a first real-time video traffic flow, wherein a state variable is associated with the first real-time video traffic flow at the node, and wherein the first real-time video traffic flow comprises a plurality of packets and each packet comprises a lost packet indicator, wherein the lost packet indicators of the packets of the first real-time video traffic flow indicate whether the first real-time video traffic flow has experienced a packet loss;
receive a second real-time video traffic flow, wherein a state variable is associated with the second real-time video traffic flow at the node, and wherein the second real-time video traffic flow comprises a plurality of packets and each packet comprises a lost packet indicator, wherein the lost packet indicators of the packets of the second real-time video traffic flow indicate whether the second real-time video traffic flow has experienced a packet loss;
drop a first packet in the first real-time video traffic flow;
update the state variable associated with the first real-time video traffic flow at the node to indicate the dropped first packet; and
update the lost packet indicator for a second packet in the first real-time video traffic flow based on the updated state variable that indicates the dropped first packet.

US Pat. No. 10,116,684

AUTOMATICALLY DETECTING AND CORRECTING MISSING AND MISCONFIGURED SECURITY ATTRIBUTES

VERIZON DIGITAL MEDIA SER...

1. A method comprising:retrieving by a content distribution server, a packet encapsulating content of a particular content provider, wherein the particular content provider offloads said content to the content distribution server for delivery to a plurality of clients;
obtaining, in response to retrieving the packet, one or more of a first set of security options configured as default security options for two or more content providers, and a different second set of security options configured by the particular content provider;
verifying at the content distribution server, security of an original header of said packet based on one or more of the first set of security options and the different second set of security options, wherein a first security option of the second set of security options overrides a different value set for a similar security option in the first set of security options, and a second security option of the second set of security options sets a value for a security option not specified as part of the first set of security options;
modifying said packet with a modified header in response to changing said original header based on the original header violating at least one of the first set of security options and the second set of security options; and
serving the packet with the modified header to a client of the plurality of clients.

US Pat. No. 10,116,663

IDENTITY PROXY TO PROVIDE ACCESS CONTROL AND SINGLE SIGN ON

MOBILE IRON, INC., Mount...

1. A system, comprising:a processor configured to:
receive a request associated with a client app on a device to connect to the system, wherein the system is associated with a cloud-based service, wherein the system is remote from the cloud-based service;
establish a secure tunnel between the device and the system;
determine that the requesting client app is authorized to access the cloud-based service;
obtain a security token trusted by the cloud-based service;
provide the security token to the client app, wherein the security token is to be used by the client app to access to the cloud-based service and cached by the device, wherein the cached security token allows one or more other client apps on the device to be authenticated to one or more corresponding cloud-based services using the secure tunnel;
monitoring a compliance posture of the device; and
blocking access to the cloud-based service based at least in part on an indication that the compliance posture of the device has changed; and
a memory coupled to the processor and configured to provide the processor with instructions.

US Pat. No. 10,116,662

ON-DEMAND SECURITY POLICY ACTIVATION

AirWatch LLC, Atlanta, G...

1. A method comprising:receiving, using a first application at a mobile computing device, a user selection of a resource locator, wherein the resource locator comprises a reference to a resource;
determining, using the mobile computing device, whether the selected resource locator is associated with a security policy; and
in response to determining that the resource locator is associated with the security policy:
activating, in the mobile computing device, a profile identified by the security policy, wherein the profile allows access to the resource, referred to by the resource locator and selected using the first application, if the mobile computing device is connected to a Virtual Private Network (VPN) connection;
launching, at the mobile computing device, the VPN connection; and
accessing the resource referred to by the resource locator using the VPN connection.

US Pat. No. 10,116,644

NETWORK ACCESS SESSION DETECTION TO PROVIDE SINGLE-SIGN ON (SSO) FUNCTIONALITY FOR A NETWORK ACCESS CONTROL DEVICE

Pulse Secure, LLC, San J...

1. A method comprising:establishing, with a network access control (NAC) client executing on a client device, a network access session between a user of a network associated with the NAC client and the NAC device;
configuring, with the NAC client, the client device to resolve a hostname to an internet protocol (IP) address in response to establishing the network access session;
listening, with the NAC client, to the IP address;
receiving, with the NAC device, a security assertion request from a user agent executing on the client device, the security assertion request including a request for a security assertion to be made by the NAC device, the security assertion indicating that a user of the user agent has been authenticated by the NAC device;
sending, with the NAC device, a redirect to the user agent in response to receiving the security assertion request, the redirect including a session verification request that includes information indicative of the security assertion request, the redirect message specifying that the redirect message is to be redirected to the hostname;
resolving, with the client device, the hostname to the IP address;
forwarding, with the user agent executing on the client device, the session verification request included in the redirect to the IP address;
sending, with the NAC client, a session verification message to the NAC device in response to receiving the session verification request at the IP address, the session verification message including the information indicative of the security assertion request and session verification information that is indicative of a session that has been established between the user and the NAC device;
sending, with the NAC device, a security assertion responsive to the security assertion request to the NAC client in response to receiving the session verification information from the NAC client; and
forwarding, with the NAC client, the security assertion to the user agent executing on the client device.

US Pat. No. 10,116,631

SYSTEMS AND METHODS FOR MANAGED DATA TRANSFER

Open Text SA ULC, Halifa...

1. A system for managed file transfer, comprising:a server machine operating a managed file transfer server connected, over a network, to a plurality of location servers, the server machine operating the managed file transfer server to:
receive a request to send data to a recipient;
determine a location of the recipient;
determine a location server of the plurality of location servers that is closest to the location of the recipient; and
automatically initiate a server-to-server transfer to move the data to the location server that is closest to the location of the recipient;
wherein the request is received from a first location server operating at a first location, the location server that is closest to the location of the recipient is a second location server operating at a second location, and the server-to-server transfer is automatically initiated by the managed file transfer server to move the data from the first location server to the second location server, each of the first location server and the second location server being a subset of the managed file transfer server, the subset comprising a transfer server and a file server.

US Pat. No. 10,116,526

SYSTEMS AND METHODS FOR PROVIDING A SELF-ELECTING SERVICE

Ivanti, Inc., South Jord...

11. An apparatus, comprising:a processor of a first managed device configured to be included in a plurality of managed devices in a network segment, the processor configured to:
determine an election score for the first managed device using a set of election rules based on a type of a service, the election score for the first managed device indicating a capability of the first managed device to provide the type of the service relative to remaining managed devices from the plurality of managed devices;
send a first multicast message including the election score for the first managed device to a set of managed devices from the plurality of managed devices, such that each managed device from the set of managed devices, in response to receiving the first multicast message, (1) determines an election score for that managed device using the set of election rules, (2) compares the election score for the first managed device with the election score for that managed device, and (3) determines, based on the comparing of the election score for the first managed device and the election score for that managed device, to not provide the service on the network segment;
receiving, at the first managed device, a second multicast message from a second managed device from the plurality of network devices and including an election score for the second managed device;
in response to the receiving, compare the election score for the first managed device with the election score for the second managed device;
elect, based on the comparing of the election score for the first managed device with the election score for the second managed device, to provide the service on the network segment; and
provision the first managed device with the service; and
memory (1) in electronic communication with the processor and (2) storing the set of election rules.

US Pat. No. 10,116,450

MERKLE SIGNATURE SCHEME USING SUBTREES

ISARA Corporation, Water...

1. A method for cryptographic communications in a distributed computing system comprising multiple computational units, the method comprising:generating a cryptographic hash tree comprising multiple subtrees and storing the cryptographic hash tree in non-volatile memory, wherein generating the cryptographic hash tree comprises:
based on a cut-off level below a root node of the cryptographic hash tree, generating a plurality of subtree data units in the non-volatile memory, each subtree data unit representing nodes of a respective subtree of the cryptographic hash tree and a first authentication path portion comprising nodes outside the subtree, the subtrees of the cryptographic hash tree each comprising a respective subtree root node at the cut-off level below the root node of the cryptographic hash tree and lowest-level nodes of the cryptographic hash tree, the lowest-level nodes being based on respective verification keys for a one-time signature (OTS) scheme,
loading a first subtree data unit of the plurality of subtree data units from the non-volatile memory into a volatile memory of a first computational unit in the distributed computing system;
based on the first subtree data unit in the volatile memory of the first computational unit, by operation of one or more processors coupled to the volatile memory of the first computational unit, generating a first OTS using a first signing key associated with a first verification key, the first verification key being associated with a lowest-level node in a first subtree represented by the first subtree data unit;
generating a first digital signature of a message based on the first subtree data unit, the first digital signature comprising: the first OTS, the first verification key, the first authentication path portion associated with the first subtree, and a second authentication path portion comprising one or more nodes of the first subtree; and
transmitting the first digital signature based on the first subtree data unit, over a communication network, from the first computational unit to a recipient node, wherein the first digital signature based on the first subtree data unit is used by the recipient node to verify the sender of the message.

US Pat. No. 10,116,376

METHOD AND SYSTEM FOR RELAYING TELECOMMUNICATIONS SIGNALS

KATHREIN-WERKE KG, Rosen...

1. A system for relaying telecommunication signals, comprising:a central hub connectable to one or more base stations;
a plurality of remote units for relaying the telecommunication signals; and
a plurality of expansion units digitally connected to the central hub and connect-able to the plurality of remote units,
wherein at least one of the plurality of expansion units is provided with a plurality of coverage area modules, wherein one or more of the plurality of remote units is connected to a selected one of the plurality of coverage area modules, the selected one of the coverage area modules being adapted to relay same signals to the connected one or more of the plurality of remote units,
wherein a connection between the plurality of expansion hubs and the plurality of remote units is reconfigurable, and so that at least one of the remote units may be connected from a first selected one of the coverage area modules, to a second selected one of the coverage area modules.

US Pat. No. 10,116,375

LINK ACQUISITION IN WIRELESS COMMUNICATION SYSTEMS

Facebook, Inc., Menlo Pa...

1. A node for use in a wireless communication network, wherein the node comprises:a transceiver that transmits and receives packet data on a wireless communication frequency;
a plurality of antennas with which radio frequency signals are transmitted and received at the node;
a beamformer with which a transmit and receive direction can be changed by the node; and
a processor that is configured to execute instructions to identify one or more transmit and receive beamforming direction pairs between the node and a responder node in a point-to-point wireless communication network, wherein each transmit and receive beamforming direction pair includes a transmit beamforming direction of the node and a receive beamforming direction of the responder node, and wherein the receive beamforming direction is set by delaying and summing receive signals to direct a listening direction of the responder node by:
asynchronously transmitting training packets for a number of times in each of a number of transmit beamforming directions;
receiving an indication that the responder node has asynchronously detected a training packet and is synchronized to the node; and
once the node and the responder node are synchronized,
synchronously transmitting training packets from the node for a number of times in each of a number of possible transmit beamforming directions;
listening for feedback from the responder node that indicates that a training packet was received on a particular receive beamforming direction and listening direction of the responder node; and
using a transmit and receive beamforming direction pair with which a training packet was received by the responder node to transmit data packets to the responder node.

US Pat. No. 10,116,367

METHOD AND SYSTEM FOR MULTIPLE-HOP RELAYED DIRECTIONAL WIRELESS COMMUNICATION

SONY CORPORATION, Tokyo ...

1. An apparatus for wireless communication between stations (STAs) using directional transmission/reception, comprising:(a) a wireless communication station (STA) configured for mm-wave communication, in which said STA, and nearby STA instances of the apparatus are configured for performing sector sweep and feedback signaling to exchange antenna sector information;
(b) a transmitter of said wireless communication station (STA) configured for generating directional radio transmissions to other wireless radio communication devices which are in range;
(c) a receiver of said wireless communication station (STA) configured for receiving radio transmissions from other wireless radio communication devices;
(d) a computer processor coupled to said transmitter and said receiver for controlling communications between itself and other wireless radio communication devices;
(e) a non-transitory computer-readable memory storing instructions executable by the computer processor;
(f) wherein said instructions, when executed by the computer processor, perform steps comprising:
(i) exchanging quantized channel gain, or path loss, information of each antenna sector with one or more neighboring stations;
(ii) recording received quantized channel gain information from communication with neighboring stations;
(iii) generating route discovery messages to neighboring stations when establishing a multiple hop routing path from an originating station to a destination station; and
(iv) processing received route discovery messages by (A) determining link metrics with a neighboring station that generated the route discovery message, (B) considering interference impact when determining transmit antenna sector to a neighboring station as a potential next hop in the routing path; (C) propagating the route discovery message to a neighbor station if the station is not the destination station;
(v) wherein channel time utilization and impact to ongoing traffic at neighboring stations are utilized in determining interference impact when establishing the multiple hop routing path.

US Pat. No. 10,116,360

METHOD AND APPARATUS FOR UPLINK MULTI-USER TRANSMISSION IN A HIGH EFFICIENCY WIRELESS LAN

Newracom, Inc., Lake For...

1. A method for performing a frame exchange sequence including an uplink multi-user (UL MU) transmission by an access point (AP) in a wireless local area network, the method comprising:acquiring a transmission opportunity (TXOP) for initiating the frame exchange sequence;
determining whether a time required for the frame exchange sequence that excludes a control response frame exceeds a TXOP limit;
transmitting a trigger frame to one or more stations (STAs) when the time required for the frame exchange sequence was determined not to exceed the TXOP limit; and
when the time required for the frame exchange sequence was determined to exceed the TXOP limit:
adjusting a duration value of the UL MU transmission included in the trigger frame to meet the TXOP limit; and
transmitting the trigger frame with the adjusted duration value of the UL MU transmission to the one or more STAs.

US Pat. No. 10,116,359

EXPLICIT BEAMFORMING IN A HIGH EFFICIENCY WIRELESS LOCAL AREA NETWORK

Marvell World Trade Ltd.,...

1. A method for beamforming training, the method comprising:receiving, at a first communication device from a second communication device via a communication channel, a plurality of training signals;
determining, at the first communication device based on the plurality of training signals, a plurality of channel matrices corresponding to a plurality of orthogonal frequency division multiplexing (OFDM) tones;
generating, at the first communication device based on the plurality of channel matrices, feedback information for the plurality of OFDM tones, the feedback information including (i) steering matrix information for the plurality of OFDM tones and (ii) additional phase information corresponding to respective ones of the plurality of OFDM tones, the additional phase information for reducing phase discontinuity across the OFDM tones in steered transmissions that are to be subsequently transmitted from the second communication device to the first communication device, wherein the additional phase information corresponding to a particular OFDM tone of the plurality of OFDM tones is determined based on only a particular channel matrix of the plurality of channel matrices, the particular channel matrix corresponding to the particular OFDM tone; and
transmitting the feedback information from the first communication device to the second communication device, the feedback information to be used by the second communication device to
construct, based on the steering matrix information included in the feedback information, a plurality of steering matrices corresponding to the plurality of OFDM tones, wherein the plurality of OFDM tones are spaced according to a first tone spacing corresponding to a first number of OFDM tones in an OFDM symbol,
compensate, using the additional phase information included in the feedback information, the plurality of steering matrices to reduce phase discontinuities between the OFDM tones, and
steer, using the compensated steering matrices, at least one transmission via the communication channel from the second communication device to the first communication device, wherein steering the at least one transmission includes using the compensated steering matrices to steer at least one OFDM symbol that corresponds to a second tone spacing corresponding to a second number of OFDM tones, wherein (i) the second tone spacing is smaller than the first tone spacing and (ii) the second number of OFDM tones is greater than the first number of OFDM tones.

US Pat. No. 10,116,357

SYSTEM AND METHOD FOR MULTIPLE POINT TRANSMISSION IN A COMMUNICATIONS SYSTEM

FUTUREWEI TECHNOLOGIES, I...

1. A method for multiple point transmission operation for a user equipment (UE), the method comprising:informing, by a first transmission point to a second transmission point, to modify a bearer configuration associated with a bearer, the bearer split by a first packet data convergence protocol (PDCP) entity of the first transmission point and transferred by the first PDCP entity to a radio link control (RLC) entity of the second transmission point without going through any PDCP entity of the second transmission point, with the first PDCP entity operating at a PDCP layer and the RLC entity operating at an RLC layer; and
receiving, by the first transmission point from the second transmission point, a response indicating a modified configuration associated with the bearer.

US Pat. No. 10,116,354

HARVEST TAG DESIGN AND SYSTEMS

VIETAGZ, LLC, Sarasota, ...

1. An energy harvesting system comprising:(a) a harvesting tag comprising an antenna tuned for both solo performance and paired performance with at least one NFC tag and turned to operate within an electromagnetic field, wherein the antenna comprises an inductive coil and the electromagnetic field is a first inductive field generated by a NFC-enabled portable electronic device;
(b) a secondary hardware module adapted to receive an energy signal from the harvesting tag and generate an output, wherein
(i) the output is a first content type when the harvesting tag is not coupled with the at least one NFC tag,
(ii) the output is a second content type when the harvesting tag is coupled with the at least one NFC tag,
(iii) the secondary hardware module comprises a electroluminescent material,
(iv) the at least one NFC tag is configured to generate a second inductive field in response to the first inductive field, and
(v) the system further comprises software-controlled hardware that is coupled to the harvesting tag, wherein the software-controlled hardware is configured to control the energy signal from the harvesting tag to the electroluminescent material such that: (A) the energy signal has a first pattern when the harvesting tag is within the first inductive field generated by the NFC-enabled portable electronic device and not within the second inductive field generated by the at least one NFC tag, and (B) the energy signal has a second pattern when the harvesting tag is within the first inductive field and within the second inductive field.

US Pat. No. 10,116,353

CONTACTLESS COMMUNICATION DEVICE AND ELECTRONIC SYSTEM HAVING THE SAME

Samsung Electronics Co., ...

1. A contactless communication device, comprising:a transceiver configured to generate an antenna voltage based on a first electromagnetic wave received from a contactless communication reader; and
a contactless communication chip configured to,
generate a reference clock signal based on the antenna voltage, when the contactless communication chip operates in a card mode in response to a magnitude of the antenna voltage increasing to a card mode threshold,
adjust, while operating in the card mode, a trimming value stored in a register, a frequency of an internal clock signal being adjusted based on the trimming value,
generate the internal clock signal based on the trimming value such that a frequency of the internal clock signal is same as a frequency of the first electromagnetic wave, when the contactless communication chip switches from the card mode to a reader mode in response to the magnitude of the antenna voltage decreasing to a reader mode threshold, and
communicate, while the contactless communication chip operates in the reader mode, with a contactless communication card by emitting, via the transceiver, a second electromagnetic wave based on the internal clock signal.

US Pat. No. 10,116,352

COMMUNICATION SYSTEM, TRANSMISSION DEVICE, AND RECEPTION DEVICE

Mitsubishi Electric Corpo...

1. A communication system comprising:a transmission device configured to transmit data by control of current passing through a current loop, the current loop comprising a signal line and a common line connected in series; and
a reception device connected to the transmission device by the signal line, the common line, and a power line, and configured to receive the data by detection of current passing through the current loop,
wherein at least one of the transmission device or the reception device comprises a direct current power supply configured to
generate a direct current for serial communication from an alternating current power supplied from an alternating current power supply through the power line and the common line, and
supply the generated direct current through the current loop, and
wherein at least one of the transmission device or the reception device comprises an adjuster configured to adjust an impedance between the signal line and the common line based on a voltage between the signal line and the common line, and
the adjuster is a circuit connected to the signal line and the common line and configured to pass a current having a value equal to or lower than a reference current value from the signal line to the common line based on the voltage between the signal line and the common line.

US Pat. No. 10,116,351

POLLUTION DETECTION CIRCUIT FOR DATA LINES AND METHOD THEREOF

SEMICONDUCTOR COMPONENTS ...

1. A pollution detection circuit for data lines, comprising: an impedance detector configured for coupling to at least one data terminal and detecting an impedance of said data terminal for detecting the pollution at said data terminal or said data lines; a sample and hold circuit, of the impedance detector, to store a value of a signal on the at east one data terminal as a stored signal; the impedance detector configured to apply a detection current to the at least one data terminal to form a detection signal wherein the pollution is confirmed in response to a difference less than a threshold value between the stored signal and the detection signal.

US Pat. No. 10,116,348

HIGH-FREQUENCY POWER AMPLIFYING MODULE AND COMMUNICATION APPARATUS

MURATA MANUFACTURING CO.,...

1. A high-frequency power amplifying module for a communication device that simultaneously transmits and receives radio frequency signals in a first communication band and a second communication band, the high-frequency power amplifying module comprising:a first high-frequency power amplifier that amplifies radio frequency signals in the first communication band, the first high-frequency power amplifier comprising a second transmission filter configured to attenuate a transmission frequency of the second communication band; and
a second high-frequency power amplifier that amplifies radio frequency signals in the second communication band, the second high-frequency power amplifier comprising a first transmission filter, a second upstream amplifier, and a second downstream amplifier,
wherein the first communication band and the second communication band produce intermodulation distortion due to the transmission frequency of the first communication band and a transmission frequency of the second communication band, the intermodulation distortion having a frequency within a reception frequency band of the second communication band,
wherein the first transmission filter is configured to attenuate the transmission frequency of the first communication band,
wherein the second upstream amplifier amplifies a transmission signal in the second communication band,
wherein the first transmission filter is disposed between the second upstream amplifier and the second downstream amplifier,
wherein the second downstream amplifier amplifies a signal having passed through the first transmission filter,
wherein the first transmission filter, the second upstream amplifier, and the second downstream amplifier are mounted on a single board, and
wherein the first transmission filter and the second transmission filter are formed as a single high-frequency power amplifying module that is different from a high-frequency circuit that is coupled to the high-frequency power amplifying module.

US Pat. No. 10,116,342

APPARATUS AND METHOD FOR CONTROLLING SIGNAL GAIN IN WIRELESS TRANSMITTER

Samsung Electronics Co., ...

1. An apparatus for a transmitter, the apparatus comprising:a plurality of mixers respectively coupled with a baseband processor providing a baseband signal;
a plurality of variable gain amplifiers (VGAs) respectively coupled with the plurality of mixers;
a plurality of local oscillators (LOs) respectively coupled with the plurality of mixers, the plurality of LOs comprising a first LO for a gain greater than a first threshold and a second LO for a gain lower than a second threshold which is greater than the first threshold;
an antenna operatively coupled to each of the plurality of VGAs; and
a controller configured to, if a required gain of the transmitter is greater than the first threshold and is lower than the second threshold,
identify a signal path from a first signal path for a high performance mode and a second signal path for a low power consumption mode among a plurality of signal paths, each of the plurality of signal paths comprising each of the plurality of mixers, each of the plurality of VGAs, and each of the plurality of LOs, respectively,
wherein the antenna is configured to transmit an output signal generated by using the identified signal path from the baseband signal,
wherein the first signal path corresponds to the required gain and the first LO in the first signal path is configured to consume a first current quantity, and
wherein the second signal path corresponds to the required gain and the second LO in the second signal path is configured to consume a second current quantity less than the first current quantity.

US Pat. No. 10,116,341

POLAR TRANSMITTER WITH JOINED MODULATOR

Intel IP Corporation, Sa...

1. An apparatus including a polar transmitter joined with a modulator, and operable to transmit a signal over a wireless channel, the apparatus comprising:a circuit configured to, based on a type of modulator, a type of combiner and a channel frequency:
generate first and second streams of data from received data, each stream having at least some portion of the received data that is distinct from data included in the other stream, the type of combiner comprising a multiplicative or an additive combiner, and
generate a first analog signal based on the first stream and a supply voltage based on the second stream; and
an amplifier, coupled to the circuit, and configured to generate a Radio Frequency (RF) signal based on the supply voltage and the type of combiner.

US Pat. No. 10,116,338

MEASURING TRANSDUCER SUPPLY UNIT, SYSTEM FOR USE IN AUTOMATION TECHNOLOGY, AND METHOD FOR OPERATING SUCH A SYSTEM

4. A system for use in automation technology, that comprises at least the following:a superordinate unit;
at least one field unit;
a measuring transducer supply unit for use in automation technology;
a first two-wire line, which connects said measuring transducer supply unit with said at least one filed unit;
a second two-wire line, which connects said measuring transducer supply unit with said superordinate unit;
a superordinate unit that is connected through said measuring transducer supply unit to a field unit via a two-wire line; and
a mobile terminal having a unit that corresponds to said radio module for said wireless communications connection, wherein:
said measuring transducer supply unit comprises at least: one switch; one radio module; and one circuit;
said radio module can be activated and de-activated by said switch; said circuit realizes the conversion of signals between signals of two-wire lines and signals of said radio unit, so that the minimum of one field unit that is connected to the measuring transducer supply unit via said first two-wire line can be operated by means of said radio module using a wireless communications connection; and
so that said at least one field unit can be operated via said mobile terminal by means of said wireless communications connection between said measuring transducer supply unit and said mobile terminal by means of the connection between said measuring transducer supply unit and said at least one field unit via said first two-wire line.

US Pat. No. 10,116,335

DATA PROCESSING METHOD, MEMORY STORAGE DEVICE AND MEMORY CONTROL CIRCUIT UNIT

PHISON ELECTRONICS CORP.,...

1. A data processing method for encoding data stored in a rewritable non-volatile memory module, and the data processing method comprising:receiving first write data;
performing, by a first stage encoding circuit, a first stage encoding operation of a low-density parity-check (LDPC) code on the first write data so as to generate first transition data;
performing, by a second stage encoding circuit, a second stage encoding operation of the LDPC code on the first transition data so as to generate a first error correcting code (ECC), wherein the first ECC and the first write data is stored into the rewritable non-volatile memory module;
receiving second write data;
synchronously performing, by the first stage encoding circuit, the first stage encoding operation of the LDPC code on the second write data during a time period when the second stage encoding operation of the LDPC code on the first transition data is performed by the second stage encoding circuit; and
controlling a transmission path between the first stage encoding circuit and the second stage encoding circuit by a multiplexer,
wherein the first stage encoding operation is an encoding operation related to a first part of a parity check matrix, and the second stage encoding operation is an encoding operation related to a second part of the parity check matrix.

US Pat. No. 10,116,334

REED-SOLOMON CODE ENCODER AND DECODER

XILINX, INC., San Jose, ...

1. An integrated circuit (IC), comprising:an encoder circuit includes:
an encoding input configured to receive an input message including one or more data symbols, each data symbol having a data symbol width of N bits, wherein N is a positive integer;
an encoding unit configured to perform Reed-Solomon encoding to the one or more data symbols to generate one or more coding symbols, wherein the Reed-Solomon encoding uses a Galois field having an order that is less than 2N, the encoding unit comprising a first Galois field arithmetic operator configured to perform multiplication operations and division operations on field elements of the Galois field by retrieving pre-computed values from a storage; and
an encoding output configured to provide a coded message including the one or more data symbols and the one or more coding symbols,
wherein the order of the Galois field is equal to 2M,
wherein M is greater than two and less than N,
wherein the storage comprises:
a multiplication lookup table to store pre-computed values for the multiplication operations; and
a division lookup table to store pre-computed values for the division operations;
wherein each of the multiplication lookup table and the division lookup table has a size of less than M*2M*2 bits.

US Pat. No. 10,116,328

ENCODERS, DECODERS AND METHODS UTILIZING MODE SYMBOLS

Gurulogic Microsystems Oy...

1. An encoder for encoding input data to generate corresponding encoded data, characterized in that:the encoder is configured to:
(a) analyze the input data to identify at least one mode symbol therein;
(b) generate data values of at least a first type and a second typefrom the input data, wherein the data values of the first type include non-mode symbols, and the data values of the second type include runs of the at least one mode symbol, wherein the at least one mode symbol is a symbol that occurs most often in the input data and the non-mode symbols are symbols other than the at least one mode symbol, wherein the runs of the at least one mode symbol are indicative of occurrences of the at least one mode symbol before or after the non-mode symbols within the input data;
(c) generate information that is indicative of a count of the non-mode symbols in the input data and information that is indicative of the at least one mode symbol; and
(d) assemble or encode the information that is indicative of the at least one mode symbol, the information that is indicative of the count of the non-mode symbols, the data values of the first type including the non-mode symbols and the data values of the second type including the runs of the at least one mode symbol, to generate the encoded data.

US Pat. No. 10,116,325

DATA COMPRESSION/DECOMPRESSION DEVICE

Clarion Co., Ltd., Saita...

1. A data decompression device that decompresses compressed data including a plurality of compressed fixed-length records, comprising:a processor; and
a memory coupled to the processor;
wherein the compressed data includes a result acquired by dividing compression object data in units of a compression object block size and compressing the compression object data of each of a plurality of compression object blocks;
wherein the compression object block size is determined based upon a size of one of the plurality of compressed fixed-length records and specification information of the data decompression device, where
the specification information of the data decompression device includes a capacity of a cache memory of the data decompression device or a capacity of a main storage the data decompression device uses, and
the cache memory or the main storage is controlled not to replace contents therein during a decompression process of all columns of compressed columnar data of the plurality of compressed fixed-length records included in one compression object block;
wherein one or more compression object blocks are acquired based upon the compressed data; and
wherein the processor is programmed to decompress each of a plurality of columns of compressed columnar data of the plurality of compressed fixed-length records included in the one or more compression object blocks and restore the plurality of compressed fixed-length records.

US Pat. No. 10,116,322

RAIL ADAPTIVE DITHER

Raytheon Company, Waltha...

1. A method of converting an analog input signal to a linearized digital representation of the analog input signal, comprising:comparing a measure of the analog input signal to a threshold associated with a maximum dynamic range of a quantizer;
dynamically varying a maximum amplitude of a random, analog dither signal for perturbing quantization of the analog input signal in response to the comparison;
combining the dynamically varied dither signal and the analog input signal to obtain a dithered input signal; and
converting with the quantizer the dithered input signal into the linearized digital representation of the analog input signal.

US Pat. No. 10,116,320

PHOTOELECTRIC CONVERSION APPARATUS AND IMAGE CAPTURING SYSTEM

Canon Kabushiki Kaisha, ...

1. A photoelectric conversion apparatus comprising:a pixel configured to output a pixel signal;
and
an analog-to-digital (AD) converter configured to perform AD conversion by comparing a ramp signal with the pixel signal, wherein
the photoelectric conversion apparatus has a first operation mode where an imaging sensitivity level is a first sensitivity level and a second operation mode where the imaging sensitivity level is a second sensitivity level different from the first sensitivity level,
in the first operation mode, the AD converter performs, in a case where the pixel signal is in a first signal level, AD conversion on the pixel signal using a first ramp signal having a first slope, and
the AD converter performs, in a case where the pixel signal is in a second signal level having an amplitude greater than an amplitude of the first signal level, AD conversion on the pixel signal using a second ramp signal having a second slope greater than the first slope,
in the second operation mode,
the AD converter performs, in a case where the pixel signal is in a third signal level, AD conversion on the pixel signal using a third ramp signal having a third slope, and
the AD converter performs, in a case where the pixel signal is in a fourth signal level having an amplitude greater than an amplitude of the third signal level, AD conversion on the pixel signal using a fourth ramp signal having a fourth slope greater than the third slope, and
the fourth slope differs from the first slope and the second slope.

US Pat. No. 10,116,318

METHOD AND SYSTEM FOR ASYNCHRONOUS CLOCK GENERATION FOR SUCCESSIVE APPROXIMATION ANALOG-TO-DIGITAL CONVERTER (SAR ADC)

Infinera Corporation, Su...

1. An analog-to-digital converter (ADC) comprising:a comparator;
a first logic gate, operatively coupled to the comparator, to generate a first output signal based on an output of the comparator;
a second logic gate, operatively coupled to the first logic gate, to generate a second output signal indicative of timing reference of bit conversion;
a first memory element, operatively coupled to the second logic gate, to generate a third output signal indicative of a current state of a bit that is input for the second logic gate;
a second memory element, operatively coupled to the second logic gate, to generate a plurality of next state bits,
wherein the second logic gate determines the second output signal based on the first output signal and the third output signal,
a third logic gate, operatively coupled to the comparator and the first logic gate, to generate an asynchronous comparator clock signal that controls a precharge operation and an evaluation operation of the comparator; and
a digital-to-analog converter (DAC), operatively coupled to the comparator and the second memory element, to generate a reference voltage based on the plurality of next state bits,
wherein the third output signal is determined based on an inverse signal of the asynchronous comparator clock signal.

US Pat. No. 10,116,315

SYSTEM-ON-A-CHIP CLOCK PHASE MANAGEMENT USING FRACTIONAL-N PLLS

QUALCOMM Incorporated, S...

1. A fractional-N phase-locked loop (PLL), comprising:a phase control circuit configured to begin a phase accumulation responsive to an identified edge of a reference clock signal, wherein the phase control circuit is configured to receive a trigger signal that identifies the identified edge of the reference clock signal;
a feedback divider configured to divide an output clock signal by an integer divisor that is adjusted responsive to the phase accumulation to form a divided feedback clock signal; and
an oscillator configured to drive the output clock signal at an output frequency responsive to a control signal so that the output clock signal is phase aligned with the reference clock signal.

US Pat. No. 10,116,313

APPARATUS AND METHOD TO MITIGATE PHASE AND FREQUENCY MODULATION DUE TO INDUCTIVE COUPLING

Intel Corporation, Santa...

1. An apparatus comprising:a first clocking source having a first divider;
a second clocking source having a second divider, wherein the first and second clocking sources are close enough in proximity to one another such that they are inductively coupled to one another; and
calibration logic to monitor clock signals associated with the first and second clocking sources and to generate at least one calibration code to adjust at least one divider ratio of the first or second dividers according to the monitored clock signals; and
a sigma-delta modulator to receive the at least one calibration code from the calibration logic, wherein the at least one calibration code is generated according to the monitored clock signals.

US Pat. No. 10,116,309

CMOS OUTPUT CIRCUIT

Rohm Co., Ltd., Kyoto (J...

1. A CMOS output circuit comprising:a first P-MOSFET having a source connected to a power supply terminal, a drain connected to an output terminal, and a back gate connected to a first potential terminal;
a first N-MOSEFET having a drain connected to the output terminal, a source connected to a ground terminal, and a back gate connected to a second potential terminal;
a first potential switching portion arranged to switch whether to connect the first potential terminal to the power supply terminal or to the output terminal;
a second potential switching portion arranged to switch whether to connect the second potential terminal to the ground terminal or to the output terminal;
a first gate switching portion arranged to switch whether or not to short-circuit the gate of the first P-MOSFET to the first potential terminal;
a second gate switching portion arranged to switch whether or not to short-circuit the gate of the first N-MOSFET to the second potential terminal;
a first driver arranged to drive the gate of the first P-MOSFET in accordance with a first input signal;
a second driver arranged to drive the gate of the first N-MOSFET in accordance with a second input signal; and
a control portion arranged to control individual portions of the circuit when turning off both the first P-MOSFET and the first N-MOSFET, so as to connect the first potential terminal to one of the power supply terminal and the output terminal, which has a higher potential, to connect the second potential terminal to one of the ground terminal and the output terminal, which has a lower potential, to short-circuit the gate of the first P-MOSFET to the first potential terminal, and to short-circuit the gate of the first N-MOSFET to the second potential terminal.

US Pat. No. 10,116,304

GATE TRANSISTOR CONTROL CIRCUIT

1. A device for controlling a first control gate transistor, comprising:a second transistor and a third transistor series-connected between first and second terminals of application of a power supply voltage, the junction point of these transistors being connected to the gate of the first transistor,
a terminal of application of a digital control signal;
a circuit for generating an analog signal according to variations of the power supply voltage; and
for each of the second and third transistors, a circuit of selection of a control signal of the first transistor representative of said digital signal or of said analog signal, wherein the selection circuit selects a signal among said digital control signal and said analog signal such that one of the second and third transistors is controlled in a linear state while the other one of the second and third transistors is controlled in a saturated state.

US Pat. No. 10,116,302

SEMICONDUCTOR DEVICE

Mitsubishi Electric Corpo...

1. A semiconductor device, comprising:a low-side terminal having a low-side potential;
a high-side terminal having a high-side potential different from the low-side potential;
a main output terminal having an intermediate potential;
a low-side switching element being provided between the main output terminal and the low-side terminal;
a low-side drive circuit which drives the low-side switching element and operates using the low-side potential as a reference potential and using a supply potential regulated by an offset voltage from the low-side potential as a power source potential;
a high-side switching element being provided between the main output terminal and the high-side terminal;
a high-side drive circuit which drives the high-side switching element and operates using the intermediate potential as a reference potential and using a floating potential regulated by an offset voltage from the intermediate potential as a power source potential;
a detection circuit using the intermediate potential as a reference potential and detecting condition information of the high-side switching element, thereby outputting a detection signal;
a conversion circuit using the intermediate potential as a reference potential and outputting a conversion signal corresponding to the detection signal from the detection circuit, and
a signal transmission circuit outputting a signal corresponding to the conversion signal from the conversion circuit as a voltage signal using the low-side potential as a reference potential, wherein
the signal transmission circuit includes:
a first point to which the intermediate potential is applied;
a second point to which a referred potential between the low-side potential and the high-side potential is applied, the referred potential being different from the low-side potential and the high-side potential;
a signal switching element having a first end connected to the first point and a second end, and being switched in accordance with the conversion signal; and
a diode being provided between the second point and the second end of the signal switching element and having a direction with which a forward current can flow by a voltage between the first point and the second point in a case where the intermediate potential is the low-side potential.

US Pat. No. 10,116,300

SWITCHING COMPONENT, IN PARTICULAR DOMESTIC-APPLIANCE SWITCHING COMPONENT

1. A switching component, comprising:a main driver that applies an electrical signal to a plurality of driver circuits;
a series circuit of a plurality of field effect transistors;
each driver circuit is associated with one of the plurality of field effect transistors, each driver circuit having at least one switching element, which short circuits two control contacts of the associated field effect transistor in at least one operating state to simultaneously switch off each of the associated field effect transistors.

US Pat. No. 10,116,297

DC-COUPLED HIGH-VOLTAGE LEVEL SHIFTER

pSemi Corporation, San D...

1. A control circuit configured to control a high voltage device capable of withstanding a voltage higher than a first voltage (VIN), the control circuit comprising:low voltage transistor devices configured to operate between a first switching voltage (SW) and a second switching voltage (Vdd2+SW);
a first terminal configured to carry the first switching voltage, the first switching voltage switching between a reference voltage and the first voltage;
a second terminal configured to carry the second switching voltage as a function of the first switching voltage, the second switching voltage substantially corresponding to a sum of the first switching voltage and a second voltage (Vdd2) substantially lower than the first voltage;
input nodes configured to receive input timing control pulse signals;
a parallel resistive-capacitive coupling, coupled to the input nodes, configured to receive the input timing control pulse signals and transmit edge information and DC level information of the input timing control pulse signals to the low voltage transistor devices; and
an output node configured to provide an output timing control signal at a voltage higher than the first switching voltage for control of the high voltage device, the output timing control signal being based on the transmitted edge information and DC level information of the input timing control pulse signals through the parallel resistive-capacitive coupling.

US Pat. No. 10,116,295

VOLTAGE COMPARING CIRCUIT AND VOLTAGE COMPARING METHOD

PixArt Imaging Inc., Hsi...

1. A voltage comparing circuit, comprising:a comparator, comprising a first comparing terminal and a second comparing terminal;
a time interval computing unit;
a switch module, coupled to the first comparing terminal and the second comparing terminal, comprising a reference voltage terminal coupled to a reference voltage source, and comprising a first input terminal and a second input terminal;
a first current source, comprising a first charging terminal coupled to the first input terminal and the second input terminal;
a first capacitor, coupled to the first current source at the first charging terminal; and
a capacitance adjusting unit, coupled to the first capacitor.

US Pat. No. 10,116,287

SWITCHED CURRENT CONTROL MODULE AND METHOD THEREFOR

NXP USA, Inc., Austin, T...

1. A switched current control module comprising:a hysteretic control component arranged to receive a high threshold value signal, a low threshold value signal and an indication of a current flow through a load, and to output a switched current control signal based on a comparison of the current flow indication to the high and low threshold value signals;
a threshold generator component arranged to generate the high and low threshold value signals based on a base threshold value and a hysteretic excursion value;
a base threshold value generator component arranged to receive the current flow indication and a setpoint value, to determine an average current error value for the current flow through the load based on the received indication of current flow through the load and the setpoint value, and to generate the base threshold value signal based on the determined average current error value; and
a hysteretic excursion value generator component arranged to receive an indication of a switching frequency of the switched current control signal output by the hysteretic control component, and to generate the hysteretic excursion value signal based on the indicated switching frequency of the switched current control signal.

US Pat. No. 10,116,266

DOHERTY AMPLIFIER

KABUSHIKI KAISHA TOSHIBA,...

1. A method for determining circuit parameters of a Doherty amplifier comprising: an input terminal; an output terminal; a splitter connected to the input terminal, the splitter having first and second outputs; a combiner connected to the output terminal, the combiner having first and second inputs; a carrier amplifier including a first input-side two-port network connected to the first output of the splitter, a first amplifier connected to an output of the first input-side two-port network, and a first output-side two-port network connected between an output of the first amplifier and the first input of the combiner; and a peak amplifier including a second input-side two-port network connected to the second output of the splitter, a second amplifier connected to the output of the second input-side two-port network, and a second output-side two-port network connected between an output of the second amplifier and the second input of the combiner,wherein the method comprises:
determining circuit parameters of the output-side two-port network of the carrier amplifier and the output-side two-port network of the peak amplifier so that the combiner is a parallel-connected load type having a parallel connection of the output-side two-port network of the carrier amplifier and the output-side two-port network of the peak amplifier for the output terminal at the combining point, and that a load admittance at the combining point is expressed using a complex number;
wherein if the load admittance at the combining point is YL?, the circuit parameters of the output-side two-port network from the current source end of the carrier amplifier up to the combining point are Fc (Ac, Cc, Cc, Dc), the circuit parameters of the output-side two-port network from the current source end of the peak amplifier up to the combining point are Fp (Ap, Bp, Cp, Dp), the load resistance of the carrier amplifier in the state in which it is not backed off is Roptc, the load resistance of the peak amplifier in the state in which it is not backed off is Roptp, m=1+Roptc/Roptp, and the phase difference between the phase of the current source of the carrier amplifier and the phase of the current source of the peak amplifier is ?, within a transmission frequency band, the relationships:
(Ac×Dp+Bc×Cp+Bc×Dp×YL?)/(Cc×Dp+Cp×Dc+Dc×Dp×YL?)=m×Roptc  (1)
?c/(Cc×Dp+Cp×Dc+Dc×Dp×YL?)=?Roptc×ej×?  (2)
?p/(Cc×Dp+Cp×Dc+Dc×Dp×YL?)=Roptc×e?j×?  (3)
(Ap×Dc+Bp×Cc+Bp×Dc×YL?)/(Cc×Dp+Cp×Dc+Dc×Dp×YL?)=0  (4)
are satisfied, wherein ?c=Ac×Dc?Bc×Cc and ?p=Ap×Dp?Bp×Cp.

US Pat. No. 10,116,264

CALIBRATING A POWER AMPLIFIER SUCH AS IN A REMOTE UNIT IN A WIRELESS DISTRIBUTION SYSTEM (WDS)

Corning Optical Communica...

1. A power amplifier calibration circuit, comprising:a power amplifier comprising a signal input, a signal output, a first bias signal input, and a second bias signal input, wherein the power amplifier is configured to:
receive an input signal having a first power at the signal input;
receive a first bias signal at the first bias signal input;
receive a second bias signal at the second bias signal input;
amplify the input signal to generate an output signal having a second power higher than the first power at the signal output; and
control a first power amplifier performance parameter and a second power amplifier performance parameter in the output signal based on the first bias signal and the second bias signal; and
a control circuit configured to:
provide a plurality of bias signal combinations to the power amplifier, wherein each of the plurality of bias signal combinations comprises a respective first bias signal and a respective second bias signal to be provided to the first bias signal input and the second bias signal input of the power amplifier, respectively;
receive a plurality of performance indication signals comprising a plurality of measurements corresponding to the plurality of bias signal combinations, respectively, wherein each of the plurality of measurements comprises the first power amplifier performance parameter and the second power amplifier performance parameter;
rank the plurality of measurements based on a predefined ranking criteria; and
determine a selected bias signal combination among the plurality of bias signal combinations corresponding to a selected ranked measurement among the plurality of measurements.

US Pat. No. 10,116,260

VCO SELECTION AND AMPLITUDE MANAGEMENT USING CENTER TAP INDUCTOR

International Business Ma...

1. An apparatus comprising:a first voltage controlled oscillator (VCO) that includes a first inductor, a first varactor, a first transistor, and a second transistor, wherein the first inductor is coupled to the first varactor, the first transistor and the second transistor; wherein the first inductor includes a first center tap connection; and wherein a center tap voltage at the first center tap connection affects an oscillation of the first VCO;
a second VCO that includes a second inductor having a second center tap connection, a pair of transistors coupled to the second inductor, and a second varactor;
an operational amplifier, wherein an output of the operational amplifier is coupled to the first center tap connection of the first inductor;
a first multiplexer receiving an output from the operational amplifier, the first multiplexer coupled to the first and second center tap connections; and
a second multiplexer providing an input to the operational amplifier, the second multiplexer coupled to the first and second center tap connections,
wherein a selection signal is used to select between the second VCO and the first VCO.

US Pat. No. 10,116,259

INDUCTOR-ENCLOSED VOLTAGE-CONTROLLED OSCILLATORS

QUALCOMM Incorporated, S...

1. A frequency synthesizer, comprising:a first voltage-controlled oscillator (VCO) circuit comprising a first inductor; and
a second VCO circuit comprising a second inductor, wherein at least a portion of the first VCO circuit is disposed inside a loop of the second inductor, wherein at least a portion of the second VCO circuit is disposed inside a loop of the first inductor, wherein the portion of the first VCO circuit comprises a negative active transconductance circuit and a varactor of the first VCO circuit, and wherein the portion of the second VCO circuit comprises a negative active transconductance circuit and a varactor of the second VCO circuit.

US Pat. No. 10,116,257

ENHANCED SOLAR PANELS, LIQUID DELIVERY SYSTEMS AND ASSOCIATED PROCESSES FOR SOLAR ENERGY SYSTEMS

Accurate Solar Power, LLC...

1. A liquid distribution system for a power generation system comprising a plurality of solar panels, comprising:a server;
a delivery mechanism for distributing a liquid over the outer surface of at least a portion of the solar panels;
a liquid delivery controller associated with the delivery mechanism; and
a plurality of panel controllers, wherein each of the panel controllers is associated with a corresponding solar panel and is configured to track one or more operating parameters for the corresponding solar panel, and to send a data signal to the server, wherein the data signal corresponds to the tracked parameters;
wherein the server is configured to monitor temperature of one or more of the solar panels based upon the received data signals, and to send a control signal to the liquid delivery controller when the monitored temperature exceeds a temperature setpoint; and
wherein the liquid delivery controller is configured to activate the delivery mechanism in response to the control signal.

US Pat. No. 10,116,231

DIGITAL CURRENT-SHARING LOOP DESIGN OF PSUS TO ENSURE OUTPUT VOLTAGE REGULATION DURING DYNAMIC LOAD TRANSIENTS

Dell Products, L.P., Rou...

1. An Information Handling System (IHS) comprising:a power consuming component that requires electrical power to operate;
a power interconnect; and
more than one power supply unit (PSU) connected in parallel via the power interconnect to convert alternating current (AC) electrical power, received from a power source, into voltage regulated, shared direct current (DC) electrical power, provided at a shared current output, the more than one PSU having master-slave current sharing control to provide shared DC electrical power based in part on a shared current signal carried on the power interconnect, the shared current signal having a delay;
wherein each PSU of the more than one PSU comprises:
an output amplifier electrically connected to the shared current output and that produces respective local DC electrical power;
an internal current sensor that measures the local DC electrical power and provides a local current signal representing the magnitude of the local DC electrical power;
a master control unit (MCU) in communication with the power interconnect, the internal current sensor, and the output amplifier, and which:
delays the internal current signal to match the delay in the shared current signal; and
controls the output amplifier based on the shared current signal and the delayed local current signal to maintain the respective, local DC electrical power in proportion to contributions by other PSUs to the shared DC electrical power and thereby avoid instability in dynamic response to a load transient induced by the power consuming component;
wherein the MCU delays the local current signal by averaging the local current signal over an adjustable time period that is set to match the delay in the shared current signal.

US Pat. No. 10,116,229

MULTILEVEL CASCADE HEXAGONAL VOLTAGE SOURCE CONVERTER WITH ISOLATED DC SOURCES

KING SAUD UNIVERSITY, Ri...

1. A multilevel cascade hexagonal voltage source converter (VSC) comprising a plurality of polyphase stages, each of the polyphase stages having:a plurality of n AC inputs corresponding to a number of phases, and a numerically identical plurality of n outputs, the outputs of one of the polyphase stages being connected to the inputs of a next polyphase stage in order to connect the polyphase stages in cascade;
a plurality of n DC-to-AC converters corresponding to the number of phases, each of the n DC-to-AC converters being connected to one of the n AC inputs corresponding to a respective phase so that the n DC-to-AC converters provide n DC-to-AC electrical conversions at the corresponding respective phase of their respective n AC inputs and cascades AC current received at the inputs connected to then DC-to-AC converters, each of the n DC-to-AC converters providing two AC outputs;
a connection for receiving DC power and amplifying its AC outputs with the received DC power;
the multilevel cascade hexagonal voltage source converter (VSC) further having a plurality of n split inductors, each n split inductor having two end terminals and a center tap terminal, the n split inductor on respective sides of the center tap terminal forming inductor half-segments, the AC outputs of the n DC-to-AC converters being connected to adjacent ones of the n split inductors at respective ones of the two end terminals, whereby the n split inductors and the n DC-to-AC converters establish a polyphase ring connection, the plurality of n split inductors having inductive cross-coupling links, the inductive cross-coupling links being inductively connected to the inductor half-segments at opposite sides of the polyphase ring connection, the center tap terminals of the n split inductors providing n AC outputs for its respective polyphase stage.

US Pat. No. 10,116,227

SYSTEM AND METHOD FOR PULSE DRIVING FOR REDUCING NUMBER OF OPTICAL FIBERS

Delta Electronics (Shangh...

1. A pulse driving system for driving a multi-level converter which comprises at least M power switches, where M?2, wherein the pulse driving system comprises:a main control module generating encoding information which contains driving information according to sampling information;
a local control module electrically coupled to the multi-level converter to output control signals to the multi-level converter so as to control on and off of the at least M power switches in the multi-level converter; and
a first optical fiber coupled to the main control module and the local control module, wherein the local control module receives the encoding information output from the main control module via the first optical fiber and generates the control signals according to the encoding information;
wherein the main control module comprises:
a data processing unit receiving the sampling information of the multi-level converter and outputting the driving information by a control algorithm;
a first control unit electrically coupled with the data processing unit to receive and encode the driving information and output the encoding information.

US Pat. No. 10,116,223

SWITCHING POWER SUPPLY APPARATUS CAPABLE OF ACHIEVING SOFT SWITCHING OPERATION

COSEL CO., LTD., Toyama ...

1. A switching power supply apparatus comprising:a primary-side circuit and a secondary-side circuit, the primary-side circuit being a synchronous rectification step-up or step-down chopper circuit configured by a series circuit including a main switching element and a choke coil connected in parallel with an input power supply and by a series circuit including a buffer capacitor and a commutation element connected in parallel with the choke coil, and the secondary-side circuit being configured by a series circuit including a second winding of the choke coil, a rectifying element and an output capacitor, an output electric power being obtained from both ends of the output capacitor; and
a switching control circuit including a first deadtime generation circuit and a second deadtime generation circuit configured to complementarily turn the main switching element and the commutation element ON and OFF with a predetermined switching frequency by providing a deadtime,
wherein the first deadtime generation circuit in the switching control circuit is a delay circuit for delaying an ON-duty of the main switching element by a predetermined time, and controls ON and OFF of the main switching element by outputting a control signal based on a PWM signal which is generated from a pulse signal of a switching frequency oscillation circuit which determines the predetermined switching frequency to generate a predetermined first deadtime,
the second deadtime generation circuit synchronizes frequencies of the switching frequency oscillation circuit and an oscillation circuit in the second deadtime generation circuit, and outputs a pulse signal from the switching frequency oscillation circuit which determines the predetermined switching frequency immediately before a pulse signal of the oscillation circuit in the second deadtime generation circuit to generate a predetermined second deadtime, and
the choke coil has an inductance set to have a value so that a current flowing through the choke coil flows in both of a positive direction and a negative direction in one cycle of switching when an output current of the switching power supply apparatus is equal to or smaller than a predetermined rated value.

US Pat. No. 10,116,220

SYSTEMS AND METHODS FOR PROTECTING POWER CONVERSION SYSTEMS UNDER OPEN AND/OR SHORT CIRCUIT CONDITIONS

On-Bright Electronics (Sh...

1. A system for protecting a power converter, the system comprising:an off-time signal generator configured to receive a first comparison signal and generate an off-time signal based at least in part on the first comparison signal, the first comparison signal being associated with a sensing signal and a first threshold signal, the sensing signal being associated with at least a primary current flowing through a primary winding and a switch of a power converter, the power converter being associated with a switching frequency;
wherein the off-time signal generator is further configured to, in response to the first comparison signal indicating that the sensing signal associated with at least the primary current flowing through the primary winding and the switch of the power converter is larger than the first threshold signal in magnitude, generate the off-time signal to keep the switch to be turned off for at least a predetermined period of time, the predetermined period of time extending beyond at least a beginning of a next switching period corresponding to the switching frequency.

US Pat. No. 10,116,219

APPARATUS AND EFFICIENCY POINT TRACKING METHOD FOR HIGH EFFICIENCY RESONANT CONVERTERS

Futurewei Technologies, I...

1. A system comprising:a first converter comprising:
a first input stage coupled to a power source, wherein the first input stage comprises a plurality of power switches;
a first resonant tank coupled to the plurality of power switches;
a first transformer coupled to the first resonant tank;
a first output stage coupled to the first transformer;
a first detector configured to receive a first efficiency point tracking indicator obtained from the first converter; and
a first control circuit configured to receive a first efficiency point tracking signal from the first detector and adjust a first switching frequency of the first converter based upon the first efficiency point tracking signal; and
a second converter having an second input stage connected in parallel with the first input stage of the first converter, wherein the second converter comprises:
a second resonant tank coupled between a second input stage and a second transformer;
a second detector configured to receive a second efficiency point tracking indicator obtained from the second converter; and
a second control circuit configured to receive a second efficiency point tracking signal from the second detector and adjust a second switching frequency of the second converter based upon the second efficiency point tracking signal, wherein the second switching frequency is different from the first switching frequency.

US Pat. No. 10,116,218

POWER CONVERTER WITH CLAMPING CIRCUIT FOR OVERVOLTAGE PROTECTION

SILANNA ASIA PTE LTD, Si...

1. A method to control a power converter comprising:regulating an output using a switching circuit that responds to a first control signal;
comparing a feedback voltage from the output to a reference voltage using an error amplifier to create an error voltage;
comparing the error voltage to a ramp voltage from a periodic ramp signal using a comparator to create a pulse width modulated signal, wherein the pulse width modulated signal is used in combination with the switching circuit to regulate the output;
clamping the error voltage, using a clamping circuit, if the error voltage drops below a lowest value for the periodic ramp signal while the power converter is regulating a load and the switching circuit is not in a tristate;
unclamping the error voltage, using the clamping circuit, if the error voltage rises above the lowest value for the periodic ramp signal while the power converter is regulating the load and the switching circuit is not in the tristate;
transitioning the switching circuit into the tristate wherein the output floats; and
generating a second control signal to pull the switching circuit out of the tristate using the clamping circuit.

US Pat. No. 10,116,216

ULTRASONIC CONTROL SYSTEM AND METHOD FOR A BUCK-BOOST POWER CONVERTER

SEMICONDUCTOR COMPONENTS ...

1. A circuit for a buck-boost power converter comprising:an inductor driver comprising a first switch to selectively couple an input to a first node of an inductor, a second switch to selectively couple the first node of the inductor to a ground node, a third switch to selectively couple a second node of the inductor to the ground node, and a fourth switch to selectively couple the second node of the inductor to an output;
a pulse width modulator (PWM) to generate a PWM control signal responsive to an output level of the output;
a switch control in communication with the second switch and the third switch;
the circuit configured to operate in a buck mode with the fourth switch enabled for the buck mode and to begin to transition to a boost mode wherein the switch control is configured to, during the transition to the boost mode, detect an on time of the third switch less than a specified entry value and force the second switch to generate first boot refreshing pulses so that the second switch is enabled, during an on-time of the third switch, with an on time of a specified duration value at a rate more than a specified frequency, the circuit configured to subsequently operate in the boost mode after generation of the first boot refreshing pulses;
the circuit configured to operate in the boost mode with the first switch enabled for the boost mode and to begin to transition to the buck mode wherein the switch control is configured to, during the transition to the buck mode, detect on time of the second switch less than the specified entry value and force the third switch to generate second boot refreshing pulses so that the third switch is enabled, during an on time of the second switch, with an on time of the specified duration value at a rate more than the specified frequency, the circuit configured to subsequently operate in the buck mode after generation of the second boot refreshing pulses.

US Pat. No. 10,116,204

DISTRIBUTION TRANSFORMER INTERFACE APPARATUS AND METHODS

Gridbridge, Inc., Raleig...

1. An apparatus comprising:at least one external source terminal configured to be connected to at least one secondary terminal of a distribution transformer;
at least one external load terminal configured to be connected to a load;
a shunt converter circuit having a first port coupled to the at least one external source terminal to provide parallel connection to a secondary winding of the distribution transformer, wherein the distribution transformer is not coupled to the at least one external source terminal via a shunt transformer;
a series converter circuit having a first port coupled to the at least one external load terminal and a second port coupled to a second port of the shunt converter circuit, and
wherein the apparatus is independent of the distribution transformer.

US Pat. No. 10,116,198

SWITCHING SYSTEM

RENESAS ELECTRONICS CORPO...

1. A switching system comprising:a first PWM timing generation circuit generating an edge timing of a first PWM (Pulse Width Modulation) signal by using a first count value and a first comparison value supplied;
a second PWM timing generation circuit generating an edge timing of a second PWM signal by using a second count value and a second comparison value supplied, the second count value being a count value which is the same as the first count value or having a relation of the same frequency or integral multiple of frequencies of the first count value and whose timing at which the count value becomes the maximum value or minimum value is synchronized with that of the first count value;
a first switching circuit including a switching transistor driven by the first PWM signal and a shunt resistor detecting current flowing in the switching transistor;
a second switching circuit including a switching transistor driven by the second PWM signal and a shunt resistor detecting current flowing in the switching transistor in the second switching circuit;
a first AD conversion circuit converting an analog value detected by the shunt resistor in the first switching circuit to a digital value at a first AD conversion timing as a sampling timing;
a first AD conversion timing generation circuit generating the first AD conversion timing on the basis of an edge timing of the first PWM signal;
a second AD conversion circuit converting an analog value detected by the shunt resistor in the second switching circuit to a digital value at a second AD conversion timing as a sampling timing; and
a second AD conversion timing generation circuit generating the second AD conversion timing on the basis of an edge timing of the second PWM signal,
wherein one of the first and second switching circuits is an inverter circuit of a common shunt type in which the shunt resistor is provided commonly for a plurality of phases, and
wherein the first PWM timing generation circuit verifies an interval between an edge timing of the first PWM signal and the second AD conversion timing or an interval between the first AD conversion timing and an edge timing of the second PWM signal and, when the interval is less than a first reference value, shifts the edge timing of the first PWM signal so that the interval becomes equal to or larger than the first reference value.

US Pat. No. 10,116,194

VIBRATION MOTOR

AAC TECHNOLOGIES PTE. LTD...

1. A vibration motor including:a housing;
a vibration module including a main magnet and a central shaft extending along a vibration direction and passing through a center of the main magnet;
a fixing module located in the housing and including a first coil and a second coil spaced from the main magnet;
an elastic connecting part suspending the vibration module in the housing;
a sensor for detecting a displacement of the vibration module along a direction perpendicular to the central shaft; wherein
the first coil and the second coil are such arranged that a geometric center of one of the first coil and the second coil deviates from the central shaft, a geometric center of the other of the first coil and the second coil deviates from the central shaft, and the two geometric centers locate at two opposed sides of the central shaft.

US Pat. No. 10,116,192

DEVICE FOR PRODUCING A ROTATIONAL POSITION SIGNAL AND A METHOD FOR PRODUCING ROTATIONAL POSITION SIGNALS

DANFOSS MOBILE ELECTRIFIC...

1. A device for producing a position signal indicative of rotational position of a variable reluctance resolver, the device comprising:a signal transfer interface for receiving a first alternative signal and a second alternative signal, amplitudes of the first and second alternative signals being dependent on the rotational position of the variable reluctance resolver so that envelopes of the first and second alternative signals have a mutual phase shift,
a processing system for generating the position signal at least partly on the basis of the amplitudes of the first and second alternative signals and a polarity of an excitation signal of the variable reluctance resolver, and
a signal generator,
wherein:
the device is configurable to operate in a first operational mode where a1) the signal generator is configured to generate the excitation signal, b1) the signal transfer interface is configured to transmit the excitation signal to the variable reluctance resolver, and c1) the signal transfer interface is configured to transmit information indicative of the polarity of the excitation signal to one or more other devices, and
the device is configurable to operate in a second operational mode a2) where the signal transfer interface is configured to receive the information indicative of the polarity of the excitation signal from one of the other devices and b2) where the received information indicative of the polarity of the excitation signal is independent of operation of the signal generator of the device.

US Pat. No. 10,116,191

ELECTRIC MOTOR HAVING A PROTECTION STRUCTURE FOR ELECTRONIC COMPONENTS

JOHNSON ELECTRIC S.A., M...

1. An electric motor comprising: a stator, a rotor rotatably disposed inside the stator and having a shaft, an end cap assembly fitted to an axial end of the stator, the stator having at least one piece of permanent magnet, and the end cap assembly comprising: a cover having a hole, a circuit board disposed between the at least one piece of permanent magnet and the cover, and at least one electronic element mounted on the circuit board, wherein the shaft extends through the hole in the cover, and the cover and the shaft are made of a conductive material, and wherein an air gap is formed between the hole and the shaft, both sides of the air gap respectively extend to an inner peripheral surface of the hole in the cover and an outer peripheral surface of the shaft, and a width of the air gap is not larger than 0.25 mm, wherein the air gap is small enough for high voltage static electricity to be conducted between the cover and the air gap.

US Pat. No. 10,116,187

THIN-PROFILE COUNTER-ROTATING DIFFERENTIAL ELECTRIC MOTOR ASSEMBLY

CR FLIGHT LLC, Sacrament...

1. A dual propeller counter-rotating (CR) differential electric motor assembly; comprising:a. a central shaft having first and second ends;
b. a first rotational member, located proximate said first end of said central shaft, that rotates in a first direction about said central shaft;
c. a first propeller secured to said first rotational member;
d. a second rotational member, located between said first rotational member and said second end of said central shaft, that rotates in an opposite direction to said first rotational member's rotational direction and about said central shaft;
e. a second propeller secured to said second rotational member;
f. electro-magnetic means associated with said first and second rotational members for powering said rotation of said first and second rotational members in opposite directions about said central shaft;
g. means for transmitting electricity from an exterior power source to said electro-magnetic means, wherein said electricity transmitting means is located between said second rotational member and said second end of said central shaft; and
h. means for mounting said oppositely rotating first and second rotational members and said central shaft to a supporting structure, wherein said mounting means is associated with said central shaft and located after said electricity transmitting means and proximate second end of said central shaft.

US Pat. No. 10,116,186

BRUSHLESS WIPER MOTOR

Mitsuba Corporation, Kir...

1. A brushless wiper motor which drives and swings a wiper member, comprising:a motor case in which a stationary portion is fixed, the motor case having a bottom portion, a side wall portion, an opening, and a flange portion formed so as to extend from the opening, the motor case being formed of a plate material into a bottomed cylindrical shape by deep-drawing process, the stationary portion having an outer circumferential portion which is in contact with an inner periphery of the motor case;
a rotary portion rotatably provided in the stationary portion;
a gear mechanism which transmits rotation of the rotary portion to the wiper member; and
a gear case in which the gear mechanism is accommodated, the flange portion abutting on the gear case and being fixed to the gear case, wherein
the side wall portion has a small diameter portion and a large diameter portion which is different in outer diameter from the small diameter portion, the small diameter portion being disposed on the same side as the bottom portion of the motor case in an axial direction of the motor case, the large diameter portion being disposed on the same side as the opening of the motor case in the axial direction of the motor case,
a step portion is formed between the small diameter portion and the large diameter portion, one end of the stationary portion in an axial direction thereof abutting on the step portion, a concave convex portion being provided to at least one of an inner circumferential surface and an outer circumferential surface of at least the large diameter portion, thereby increasing a surface area of the motor case,
the motor case and the gear case are made of aluminium.

US Pat. No. 10,116,185

MOTOR

LG INNOTEK CO., LTD., Se...

1. A motor comprising: a rotation shaft; a rotor part encompassing the rotation shaft; a stator part arranged to be spaced apart from the rotor part; and a housing configured to fix the stator part;circuit board having an inverter circuit mounted thereon;
wherein the housing comprises a first housing arranged on one side of the stator part and a second housing arranged on an opposite side of the stator part, wherein the printed circuit board is arranged outside a bottom surface of the second housing,
wherein a plurality of first projection units is formed at an inner surface of the bottom surface of the second housing, and wherein a plurality of first holes is formed on the bottom surface and a lateral surface of the second housing;
further comprising a plurality of second projection units formed at an inner surface of lateral surface of the second housing, wherein the plurality of second projection units formed at the lateral surface is formed not to overlap the plurality of first projection units formed at the bottom surface.

US Pat. No. 10,116,180

ROTARY ELECTRIC MACHINE STATOR

TOYOTA JIDOSHA KABUSHIKI ...

1. A rotary electric machine stator comprising:a stator core that includes an annular stator yoke, and a plurality of teeth that protrude toward an inner peripheral side from the annular stator yoke;
at least one multi-layer winding coil that is wound around a rectangular cross-section of the teeth that is perpendicular to a radial direction of the teeth, the multi-layer winding coil being arranged with a predetermined number of steps in the radial direction of the teeth, each step of the multi-layer winding coil including a lowest layer coil of one winding and a surface layer coil of another winding;
a first insulating resin layer that is arranged between the teeth and the lowest layer coil, or between an insulator that is fixed to the teeth and the lowest layer coil; and
a second insulating resin layer that is arranged locally at curved portions of the multi-layer winding coil that correspond to corner portions of four corners of the rectangular cross-section of the teeth, the second insulating resin layer being arranged extending across a plurality of steps of the multi-layer winding coil.

US Pat. No. 10,116,179

THREE-PHASE ALTERNATING CURRENT MOTOR

FANUC CORPORATION, Yaman...

1. A three-phase alternating current motor comprising:a rotor having a plurality of pairs of magnetic poles;
a stator having a plurality of slots each formed in the direction of a rotation axis of the rotor and arranged in a circumferential direction, the stator is disposed opposite the rotor in a radial direction; and
a plurality of windings wound in the stator so as to be inserted into the slots, wherein
when 2P represents the number of the poles of the rotor and N represents the number of the slots for inserting the windings of the stator therethrough, the division of the slot number N by the number of the pole pairs P is not an integer,
when X represents the quotient of the division of the slot number N of the stator by the number of the poles 2P, the stator includes:
a first annular winding portion made of one set of coils, i.e., wound a predetermined number of turns having a diameter larger than the inner diameter of the stator by the winding of each phase, the first annular winding portion is wound 360 degrees in the circumferential direction through the slots by wave winding at alternating slot pitches such that the first annular winding portion has at least two adjacent slot pitches corresponding to X and X+1, respectively;
a second annular winding portion made of another coil, i.e., wound in a like manner as the first annular winding portion by the wave winding at alternating slot pitches such that the second annular winding portion has at least two adjacent slot pitches corresponding to X and X+1, respectively,
the second annular winding portion is wound in the position not to coincide with the first annular winding portion; and
a plurality of third winding portions each made of the one or more wires distinct from the wires of the first annular winding portion and the second annular winding portion, the one or more wires of the third winding portions being wound around two of the slots, and
the first annular winding portion, the second annular winding portion, and the plurality of third winding portions are connected in series on a phase-by-phase basis.

US Pat. No. 10,116,142

LOAD CONTROL APPARATUS, PROGRAM, METHOD, AND SYSTEM

Panasonic Intellectual Pr...

1. A load control apparatus used in a power supply system in which a power generator supplies electric power to a load device, and when electric power generated in the power generator is insufficient to supply the electric power to the load device, a commercial power system supplies electric power to the load device, the load control apparatus comprising:a controller configured to receive information regarding consumed electric power in the load device and generated electric power by the power generator and to control an operation of a controlled device included in the load device on the basis of the received information, wherein
the controller comprises:
a determination unit configured to determine whether a condition related to electric power is satisfied;
an execution unit configured to control the operation of the controlled device to start execution of a predetermined process in the controlled device, when the determination unit determines that the condition related to the electric power is satisfied; and
a prediction unit configured to predict a surplus electric power generated in a target period from the present time until a predetermined period of time elapses,
the determination unit is configured to:
determine that the condition is satisfied when the determination unit determines that the electric power necessary for executing the predetermined process will be continuously secured from the start to the completion of the predetermined process in the target period,
compare electric power and time necessary after the controlled device starts the predetermined process and before completing with a prediction result by the prediction unit,
the predetermined process comprises a process to be started and completed within a constant fixed period of time,
the prediction unit is further configured to predict, for the constant fixed period of time, a period from the present time until the constant fixed period of time elapses as the target period, the surplus electric power in the target period, and
the determination unit is further configured to compare, for the constant fixed period of time, the electric power necessary for the process in the controlled device with the prediction result by the prediction unit.