US Pat. No. 10,429,388

METHODS, DEVICES, KITS AND COMPOSITIONS FOR DETECTING ROUNDWORM, WHIPWORM AND HOOKWORM

Idexx Laboratories, Inc.,...

1. An immunocomplex comprising a first antibody specifically bound to a polypeptide, wherein the first antibody is capable of specifically binding to an amino acid sequence of SEQ ID NO:19-23, 38, or Copro6728.
US Pat. No. 10,426,826

VACCINE COMPOSITION FOR TREATING OR PREVENTING SHIGELLOSIS

International Vaccine Ins...

1. A Shigella strain in which surface exposure of a protective antigen existing on a cellular membrane increases due to the deletion of wzy gene of Shigella species, wherein the protective antigen is an IcsP2 or SigA2 protein.
US Pat. No. 10,428,362

ENZYMATIC HYDROLYSIS OF DISACCHARIDES AND OLIGOSACCHARIDES USING ALPHA-GLUCOSIDASE ENZYMES

E. I. DU PONT DE NEMOURS ...

1. A method of reducing the amount of a saccharide present in (i) a glucan synthesis reaction, or (ii) a fraction thereof, wherein said method comprises:contacting said glucan synthesis reaction or fraction thereof with an alpha-glucosidase enzyme, wherein the amount of said saccharide is reduced in said glucan synthesis reaction or said fraction thereof compared to the amount of said saccharide that was present prior to said contacting,
wherein said glucan synthesis reaction produces an insoluble alpha-glucan product, wherein at least 97% of the glycosidic linkages of said insoluble alpha-glucan product are alpha-1,3-glycosidic linkages, and
wherein said saccharide is a byproduct of said glucan synthesis reaction and is (a) leucrose or (b) a disaccharide or oligosaccharide that comprises at least one alpha-1,3 or alpha-1,6 glucosyl-glucose linkage.
US Pat. No. 10,426,827

DENGUE HEMORRHAGIC FEVER VIRUS VACCINE

MicroVAX, LLC, Warrenton...

1. A composition for generating a humoral and cellular immune response in an individual against four strains of the Dengue Hemorrhagic Fever Virus (DHFV) with the E antigenic protein of the DHFV, in the form of a multi expression vector mixture comprising twelve expression vectors each of which comprises an effective amount of a nucleic acid encoding a secretable fusion protein comprising one of twelve distinct epitopes SEQ ID NOS. 1-12 from Domain III of the E protein, wherein said twelve distinct epitopes comprise three separate fragments from each of said four strains, each of said twelve epitopes recognized and bound by Class I and Class II MHC capable to generate both neutralizing antibodies and CD8 effector T cells, and wherein each of said twelve epitopes is separately linked to the N-terminal end of the extracellular domain of a CD40 ligand to define one of twelve distinct sub-compositions, and to collectively define said multi-expression vector mixture composition that is potent to anticipate immunological escape to heterologous strains of the DHFV thereby providing protection against related but not identical DHFV viruses.
US Pat. No. 10,428,107

METHOD FOR ISOLATING AND PURIFYING RECOMBINANT HUMAN SERUM ALBUMIN FROM TRANSGENIC RICE GRAIN

Healthgen Biotechnology C...

1. A method for isolating and purifying recombinant human serum albumin from transgenic rice grain, sequentially consisting of the steps of:1) subjecting crude extract of recombinant human serum albumin to cation exchange chromatography to obtain primary product I;
2) subjecting the primary product I to anion exchange chromatography to obtain secondary product II, wherein the primary product I is not subjected to any additional chromatography before the primary product I is subjected to the anion exchange chromatography to obtain the secondary product II: and
3) subjecting the secondary product II to hydrophobic chromatography to obtain purified recombinant human serum albumin, thereby purifying the recombinant human serum albumin.
US Pat. No. 10,428,363

AMPLIFICATION METHODS TO MINIMISE SEQUENCE SPECIFIC BIAS

ILLUMINA CAMBRIDGE LIMITE...

1. A method for amplifying nucleic acid templates of different sequences comprising:a) amplifying nucleic acid templates on a solid support in the presence of an additive capable of increasing efficiency of amplification of GC rich nucleic acid templates or decreasing efficiency of amplification of AT rich nucleic acid templates, wherein a subset of nucleotide types are incorporated into copies of the templates at a lower efficiency compared to at least one other type of nucleotide, thereby producing a plurality of different copies; and
b) using the plurality of different copies as templates in a second cycle of amplification.
US Pat. No. 10,429,390

ANTIBODY COCKTAIL SYSTEMS AND METHODS FOR CLASSIFICATION OF HISTOLOGIC SUBTYPES IN LUNG CANCER

Biocare Medical, LLC, Pa...

1. A lung cancer detection system comprising:a cocktail of two primary antibodies,
wherein a first primary antibody of said cocktail comprises an anti-p40 mouse monoclonal antibody, clone BC28, which specifically binds to squamous cell carcinoma (SCC); and
wherein a second primary antibody of said cocktail comprises an anti-TTF-1 mouse monoclonal antibody which specifically binds to adenocarcinoma (ADC).
US Pat. No. 10,426,828

COMPOSITIONS OF MULTIMERIC-MULTIEPITOPE INFLUENZA POLYPEPTIDES AND THEIR PRODUCTION

BIONDVAX PHARMACEUTICALS ...

1. An injectable pharmaceutical composition in the form of an aqueous suspension of microparticles, said composition comprising at least one multimeric-multiepitope polypeptide comprising multiple copies of plurality of influenza virus peptide epitopes, a guanidinium-containing amino acid or a derivative thereof, and a pharmaceutically-acceptable diluent, excipient or carrier, wherein the aqueous suspension comprises aggregates of microparticles of said multimeric-multiepitope polypeptide having uniform aggregate size distribution with 95% of the aggregates in the suspension having a size range distribution selected from the group consisting of: 0.5-5 ?m, 0.6-6 ?m, 0.7-7 ?m, 0.8-8 ?m, 0.9-9 ?m, 1-10 ?m, 2-20 ?m, 3-30 ?m, 4-40 ?m and 5-50 ?m.
US Pat. No. 10,428,364

ENZYMATIC METHOD FOR PREPARING REBAUDIOSIDE M

PEPSICO, INC., Purchase,...

1. A method for preparing rebaudioside M, the method comprising reacting rebaudioside D in a reaction solution with a glucosyl donor in the presence of recombinant cells comprising a UDP-glucosyl transferase having the amino acid sequence of SEQ ID NO: 2, to obtain rebaudioside M;wherein at least 40% of the rebaudioside D is converted to rebaudioside M after reacting for two hours.
US Pat. No. 10,429,391

BIOMARKERS FOR CHOLANGIOCELLULAR CARCINOMA (CCC)

1. A method for identifying biomarkers for cholangiocellular carcinoma (CCC), comprising:a) collecting tumorous tissue samples and non-tumorous tissue samples from at least 5 patients with CCC;
b) comparing the tumorous tissue samples with the non-tumorous tissue samples by two-dimensional differential in-gel electrophoresis (2D-DIGE) and thereby identifying a first set of biomarker candidates for CCC showing different expression in tumorous tissue and non-tumorous tissue determined by statistical analysis;
c) comparing the tumorous tissue samples with the non-tumorous tissue samples by label-free liquid chromatography-mass spectrometry (LC-MS) and thereby identifying a second set of biomarker candidates for CCC showing different expression in tumorous tissue and non-tumorous tissue determined by statistical analysis;
d) comparing the first set of biomarker candidates obtained by 2D-DIGE according to step b) with the second set of biomarker candidates obtained by label-free LC-MS according to step c) and thereby identifying a third set of biomarker candidates for CCC showing different expression with both 2D-DIGE and label-free LC MS; and
e) performing an immunohistochemical analysis of the third set of biomarker candidates for CCC identified from step d) by comparing the expression of a respective biomarker candidate in the tumorous tissue of a subject with the expression of said respective biomarker candidate in non-tumorous tissue of the same subject and selecting one or more biomarkers for CCC that display a sensitivity of 40% or more.
US Pat. No. 10,426,829

VACCINE COMPOSITIONS HAVING IMPROVED STABILITY AND IMMUNOGENICITY

Novavax, Inc., Gaithersb...

1. A vaccine composition comprising:(i) a nanoparticle comprising a non-ionic detergent core and a viral glycoprotein,
wherein the viral glycoprotein is associated with the core; wherein the non-ionic detergent is PS80 wherein the viral glycoprotein is an RSV F glycoprotein and the molar ratio of PS80 to viral glycoprotein is about 30:1 to about 60:1; and
(ii) a pharmaceutically acceptable buffer.
US Pat. No. 10,429,648

AUGMENTED REALITY HEAD WORN DEVICE

1. An augmented reality head worn device comprising;a. a curved transparent mirror,
b. a scanning light source defining a field of view,
c. a holographic optical element (HOE) adapted to provide exit pupil expansion to create an enlarged eye-box, and
d. at least one projection system for providing pixels optically mapped to a pixel density;
wherein modulated red, green and blue lasers and a MEMS mirror micro-scanner are utilized to encode a display video illumination through conditioning and focusing optics onto the HOE and the HOE corrects for optical aberrations, replicates an image signal to create hexagonally packed exit pupil eye-box spots which are then redirected toward the curved transparent mirror which in turn directs the hexagonally packed exit pupil eye-box spots into the enlarged eye-box wherein the hexagonally packed exit pupil spots create the enlarged eye-box.
US Pat. No. 10,428,110

PEPTIDE

HysensBio Co., Ltd., Seo...

1. A peptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 1-86 and 88-95.
US Pat. No. 10,428,366

COLLAGENASE ASSAY

University of South Flori...

1. A method of measuring bacterial collagenase activity in a sample, comprising:staining native collagen fibrils with a dye at saturation level, said collagen fibrils being dry or lyophilized, said dye being capable of stably staining said collagen fibrils;
suspending said dyed collagen fibrils in a collagenase substrate buffer;
incubating said dyed collagen fibril suspension at about 37° C., wherein bacterial collagenase activity results in digestion of said dyed collagen fibrils into smaller, dyed collagen particulates that can be readily observed in a resulting mixture;
filtering said mixture to retain said dyed collagen particulates, wherein said dyed collagen particulates are digested and collected in a resulting filtrate;
extracting said dye from said filtrate to determine an amount of said digested dyed collagen particulates;
measuring absorbance of said extracted dye to determine an amount of said digested collagen particulates;
wherein said native fibrils are not solubilized by acid or gelled by heat, and
wherein said native fibrils are Type I collagen found in an animal body.
US Pat. No. 10,428,111

CANCER TARGETING BY ANTI-EGFR PEPTIDES AND APPLICATIONS THEREOF

1. A liposomal composition, comprising:a molecule; and
a lipid phase comprising a phospholipid, a PEGylated phospholipid, and cholesterol with molar ratio of between 50:30:5 and 60:40:5,
wherein the molecule consists of a lipid conjugated to a peptide through at least one linker with a molar ratio of the peptide to the lipid of 1.2:1,
wherein the peptide includes an amino acid sequence selected from the group consisting of LTVSPWY (SEQ ID NO: 1), MYWGDSHWLQYWYE (SEQ ID NO: 2), FCDGFYACYADV (SEQ ID NO: 3), IHNRYNRFFYWY (SEQ ID NO: 4), PRWGDSHWLQYWYE (SEQ ID NO: 5), LMWGGSHWLEYWYE (SEQ ID NO: 6), GHWGDQHWLQYWYE (SEQ ID NO: 7), GWWGDSHWLQYWYE (SEQ ID NO: 8), LTVEPWL (SEQ ID NO: 9), LTVSPLWD (SEQ ID NO: 11), LTVTPWL (SEQ ID NO: 12), LTVQPWP (SEQ ID NO: 13), LTVSPWT (SEQ ID NO: 14), VLTVQPW (SEQ ID NO: 15), LTVSLWT (SEQ ID NO: 16), PGVIPWN (SEQ ID NO: 17), LTYQTWP (SEQ ID NO: 18), and ELYVSRL (SEQ ID NO: 19), and
wherein the molecule comprises a spacer at N-terminal or C-terminal of the peptide, said spacer is the amino acid sequence CGGG as set forth in SEQ ID NO: 10,
wherein the liposomal composition comprises a plurality of liposomes, the plurality of liposomes comprising the molecule with a density between 25 and 200 molecules per liposome.
US Pat. No. 10,429,394

MONOCLONAL ANTIBODIES AGAINST KIR2DS1

National University Corpo...

7. A monoclonal antibody to KIR2DS1 that is produced by at least one hybridoma selected from the group consisting of a hybridoma with Accession No. NITE BP-01853, a hybridoma with Accession No. NITE BP-01855, and a hybridoma with Accession No. NITE BP-01854 or a fragment comprising an antigen-binding region thereof.
US Pat. No. 10,428,113

COMPOSITIONS FOR EXPANDING REGULATORY T CELLS (TREG), AND TREATING AUTOIMMUNE AND INFLAMMATORY DISEASES AND CONDITIONS

THE REGENTS OF THE UNIVER...


US Pat. No. 10,431,700

CONDUCTIVE PASTE COMPOSITION FOR PROVIDING ENHANCED ADHESION STRENGTH TO A SEMICONDUCTOR SUBSTRATE AND ITS USE

Giga Solar Materials Corp...

1. A conductive paste composition for forming an electrode for solar cells, said conductive paste comprising:(a) a conductive metal, derivatives of the conductive metal or a combination thereof;
(b) a glass frit;
(c) LiAlO2; and
(d) an organic medium,
said conductive paste providing increased adhesion strength of said electrode to a substrate.
US Pat. No. 10,426,834

METHODS OF STERILIZING DRUGS

AKORN, INC., Lake Forest...

1. A method of sterilizing Bacitracin, comprising exposing a composition comprising Bacitracin to a dose of 17.6-25 kGy electron-beam (E-beam) radiation, wherein the Bacitracin is a micronized powder, and wherein after the E-beam radiation exposure, the composition comprises not more than 4.5% Impurity-F and is characterized by a Sterility Assurance Level of 10?6.
US Pat. No. 10,427,090

CONTROL OF SWING ADSORPTION PROCESS CYCLE TIME WITH AMBIENT CO2 MONITORING

PRAXAIR TECHNOLOGY, INC.,...

1. A method for maximizing the time an adsorbent bed can remain online in feed mode in a swing adsorption process without experiencing breakthrough of adsorbate, wherein said swing adsorption process comprises at least two adsorbent beds each having a predetermined design bed capacity, wherein one adsorber bed is online in feed mode during which adsorbate is adsorbed from a feed gas mixture passing through the bed, while another adsorbent bed is in regeneration mode, during which the adsorbed component is desorbed from the bed, wherein the beds alternate between said modes, said method comprising:a) Repeatedly measuring the feed gas flow rate, feed gas temperature, feed gas pressure and the concentration levels of adsorbate in said feed gas during the on-stream mode;
b) Calculating the perturbation front velocity of the adsorbate through the adsorbent bed when there is a an instantaneous variation of ambient levels of said adsorbate in the feed gas;
c) Calculating the breakthrough time of said adsorbate based on the perturbation front velocity of said adsorbate through the adsorbent bed, and
d) Updating the bed capacity and the online cycle time to maximize the time that the adsorbent bed can remain online in feed mode without experiencing breakthrough of said adsorbate.
US Pat. No. 10,428,114

TYPE POLYPEPTIDE TARGETING TUMOURS

SICHUAN UNIVERSITY, Chen...

1. A polypeptide nRGD, wherein an alanine-alanine-asparagine (AAN)-containing sequence is linked to an RGD-containing peptide, wherein the AAN-containing sequence is linked to the RGD-containing peptide by CH2NH—, —CH2S—, —CH2-CH2-, —CH?CH— or —CH(OH)CH2-.
US Pat. No. 10,428,115

DYNORPHIN A ANALOGS WITH BRADYKININ RECEPTORS SPECIFICITY FOR MODULATION OF NEUROPATHIC PAIN

Arizona Board of Regents ...

1. A peptide consisting of an amino acid sequence selected from the group consisting of SEQ ID NOs: 4-6, 28, 30, 33, 34, and 36-45.
US Pat. No. 10,426,836

COMPOSITIONS AND METHODS FOR TREATING STRESS-RELATED DISORDERS

Hoffman Technologies, Inc...

1. A method of treating alleviating a symptom of post-traumatic stress disorder comprising orally administering to a subject in need thereof an effective amount of at least one tyrosine hydroxylase inhibitor; wherein said tyrosine hydroxylase inhibitor is one or more of methyl (2R)-2-amino-3-(2-chloro-4 hydroxyphenyl) propanoate, D-tyrosine ethyl ester hydrochloride, methyl (2R)-2-amino-3-(2,6-dichloro-3,4-dimethoxyphenyl) propanoate HD-Tyr(TBU)-allyl ester HCl, methyl (2R)-2-amino-3-(3-chloro-4,5-dimethoxyphenyl) propanoate, methyl (2R)-2-amino-3-(2-chloro-3-hydroxy-4-methoxyphenyl) propanoate, methyl(2R)-2-amino-3-(4-[(2-chloro-6-fluorophenyl) methoxy] phenyl) propanoate, methyl (2R)-2-amino-3-(2-chloro-3,4-dimethoxyphenyl) propanoate, methyl (2R)-2-amino-3-(3-chloro-5-fluoro-4-hydroxyphenyl) propanoate, diethyl 2-(acetylamino)-2-(4-[(2-chloro-6-fluorobenzyl) oxy] benzyl malonate, methyl (2R)-2-amino-3-(3-chloro-4-methoxyphenyl)propanoate, methyl (2R)-2-amino-3-(3-chloro-4-hydroxy-5-methoxyphenyl) propanoate,methyl (2R)-2-amino-3-(2,6-dichloro-3-hydroxy-4-methoxyphenyl) propanoate, methyl (2R)-2-amino-3-(3-chloro-4-hydroxyphenyl) propanoate, H-DL-tyr-OMe HCl, H-3,5-diiodo-tyr-OMe HCl, H-D-3,5-diiodo-tyr-OMe HCl, H-D-tyr-OMe HCl, D-tyrosine methyl ester hydrochloride, D-tyrosine-OMe HCl, methyl D-tyrosinate hydrochloride, (2R)-2-amino-3-(4-hydroxyphenyl) propionic acid, (2R)-2-amino-3-(4-hydroxyphenyl) methyl ester hydrochloride, methyl (2R)-2-amino-3-(4-hydroxyphenyl) propanoate hydrochloride, methyl (2R)-2-azanyl-3-(4-hydroxyphenyl) propanoate hydrochloride, 3-chloro-L-tyrosine, 3-nitro-L-tyrosine, 3-nitro-L-tyrosine ethyl ester hydrochloride, DL-m-tyrosine, DL-o-tyrosine, Boc-Tyr(3,5I2)-OSu, Fmoc-tyr(3-NO2)-OH, and ?-methyl-DL-tyrosine.
US Pat. No. 10,428,116

RHINOVIRUS C IMMUNOGENIC PEPTIDES

Wisconsin Alumni Research...

1. A composition comprising a peptide of the rhinovirus structural protein 1 (VP1) of rhinovirus C and a heterologous carrier protein, wherein the peptide consisting of an amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 6, 8, 11, 13, 15, 17, 19, 21, 23, 25, 27, 30, 33, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 57, 59, 61, 63, 65, 67, 48, 71, 73, 75, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 117, 119, 121, 123, 125, and 127.
US Pat. No. 10,429,399

PROCESS CONTROL FOR INCREASED ROBUSTNESS OF GENETIC ASSAYS

Good Start Genetics, Inc....

1. A method for processing a biological sample, the method comprising:obtaining a sample comprising at least one cell biopsied from an embryo in a solution of 2-3 ?l of liquid;
contacting the sample with an indicator dye comprising cresol red that provides a visual indication that the sample is frozen and within a specific, pre-defined pH range;
exposing the sample to a freezing temperature;
determining based on the visual indication that the sample is frozen; and
performing a preimplantation genetic screening procedure comprising:
using a camera controlled by computer software to evaluate a color of the sample;
confirming with the computer software that the color indicates that the sample remains frozen;
contacting the sample with an alkaline lysis solution followed by contacting the sample with an acid to achieve a neutral pH;
using the camera and the computer software to evaluate a color of the sample and confirm that the sample has a neutral pH; and
analyzing a karyotype of the at least one biopsied cell in the sample.
US Pat. No. 10,428,117

PISCINE MYOCARDITIS VIRUS-LIKE PARTICLES AND METHODS OF USE THEREOF

PHARMAQ AS, Overhalla (N...

1. A vaccine composition comprising a recombinant piscine myocarditis virus (PMCV) virus-like particle (VLP) comprising a PMCV ORF1 protein comprising SEQ ID NO.2.
US Pat. No. 10,428,373

DUPLICATING DNA WITH CONTIGUITY BARCODES FOR GENOME AND EPIGENOME SEQUENCING

The Regents of the Univer...

1. A method for sequencing a template polynucleotide comprising:(a) contacting the template polynucleotide with a plurality of oligonucleotide pairs, wherein each member of each oligonucleotide pair comprises (i) an adaptor sequence, (ii) a unique barcode sequence that hybridizes to its complement on the other member of the oligonucleotide pair, and wherein one or both of the oligonucleotide pairs comprises (iii) a primer sequence that hybridizes to the template polynucleotide;
(b) contacting the template polynucleotide and plurality of oligonucleotide pairs with a polymerase lacking strand displacement activity and reagents necessary for polymerization, and
(c) allowing extension of a polynucleotide strand from the 3? end of the primer sequence to produce an extended polynucleotide comprising components (i)-(iii) and a sequence complementary to the template polynucleotide;
(d) collecting the extended polynucleotides;
(e) sequencing the extended polynucleotides; and
(f) assembling the sequences of the extended polynucleotides based on the unique barcodes, thereby sequencing the template polynucleotide,
wherein the method does not include fragmenting the template, damaging the polynucleotide or removing epigenetic markers on the template polynucleotide.
US Pat. No. 10,428,118

HUMAN CYTOMEGALOVIRUS COMPRISING EXOGENOUS ANTIGENS

1. A recombinant human cytomegalovirus (HCMV) comprising:(1) a nucleic acid encoding at least one heterologous antigen,
(2) an inactivating mutation in the UL82 gene, and
(3) active US2, US3, US6, US7, UL131A, and UL97 genes;
wherein the recombinant HCMV is a genetically modified TR strain of HCMV; and the recombinant HCMV is Ganciclovir sensitive.
US Pat. No. 10,426,839

PHARMACEUTICAL COMPOSITIONS COMPRISING MELOXICAM

AXSOME THERAPEUTICS, INC....

1. A method of improving oral bioavailability of meloxicam in a human being, comprising orally administering a solid dosage form comprising both a bicarbonate and meloxicam to the human being, wherein the solid dosage form contains 400 mg to 900 mg of the bicarbonate, wherein the oral bioavailability of meloxicam for the solid dosage form in the human being is improved as compared with a first reference dosage form that: 1) contains the same amount of meloxicam; 2) does not contain the bicarbonate; and 3) does not contain a carbonate, or a second reference dosage form that: a) contains the same amount of meloxicam; b) does not contain the bicarbonate; and c) contains an amount of potassium carbonate that achieves about the same pH as the bicarbonate; wherein the solid dosage form has been shown to have a median Cmax that is about 1800 ng/mL to about 3000 ng/mL in fasted human subjects.
US Pat. No. 10,428,119

PSEUDOMONAS EXOTOXIN A WITH LESS IMMUNOGENIC T CELL AND/OR B CELL EPITOPES

The United States of Amer...

1. A Pseudomonas exotoxin A (PE) comprising the amino acid sequence of Formula I:FCS-R1m—R2p—R3n-PE functional domain III   (Formula I),
wherein:
m, n, and p are, independently, 0 or 1;
FCS comprises a furin cleavage amino acid sequence;
R1 comprises 1 or more continuous amino acid residues of residues 285-293 of SEQ ID NO: 1;
R2 comprises X1VAX2X3X4AAX5LSW (SEQ ID NO: 2), wherein X1, X2, and X4 are independently leucine, alanine, glycine, serine, or glutamine; X3 is tyrosine, alanine, glycine, serine, or glutamine; and X5 is arginine, alanine, glycine, serine, or glutamine; with the proviso that the PE does not comprise LVALYLAARLSW (SEQ ID NO: 3) and that when X5 is alanine, at least one of X1, X2, X3, and X4 is alanine, glycine, serine, or glutamine;
R3 comprises 1 or more continuous amino acid residues of residues 306-394 of SEQ ID NO: 1; and
PE functional domain III comprises residues 395-613 of SEQ ID NO: 1 with a substitution of amino acid residue D463,
optionally with a substitution of one or more amino acid residues within one or more B-cell epitopes of SEQ ID NO: 1; and/or
optionally with a substitution of one or more amino acid residues within one or more T cell epitopes within amino acid residues R421, L422, L423, A425, R427, L429, Y439, H440, F443, L444, A446, A447, I450, amino acid residues at positions 464-519, R551, L552, T554, I555, L556, and W558 of SEQ ID NO: 1.
US Pat. No. 10,426,840

OIL SUSPENSION OF METRONIDAZOLE

VIRBAC, Carros (FR)

1. A method for improving the acceptance by a domestic animal of an oral treatment for inflammatory diseases of the intestines, the method comprising administering to the domestic animal an effective amount of an oily metronidazole suspension comprising:a) between 5% and 30% by weight/volume of metronidazole;
b) between 70% and 95% by weight/volume of at least one edible animal, vegetable or mineral oil; and
wherein the metronidazole is provided in the form of particles of metronidazole, at least 90% of which have an equivalent diameter strictly between 50 and 250 ?m and wherein said particles are devoid of coating.
US Pat. No. 10,427,096

METHOD AND SYSTEM FOR CONTROLLING MERCURY EMISSIONS FROM COAL-FIRED THERMAL PROCESSES

ADA-ES, INC., Highlands ...

1. A method, comprising:providing a mercury-containing gas stream generated from a combustible source having native mercury and native halogens, wherein the mercury-containing gas stream comprises a vapor-phase mercury, a vapor-phase halogen, and first particulates;
introducing, into the mercury-containing gas stream, a reactive surface agent to collect at least most of the halogen and the mercury, wherein the reactive surface agent comprises second particulates, and wherein the second particulates comprise one or more of a clay and a carbon sorbent; and
thereafter removing the first and second particulates from the mercury-containing gas stream to form a treated stream, at least a portion of the vapor-phase mercury being removed from the mercury-containing gas stream with removal of the first and second particulates,
wherein at least one of the following is true:
(i) the mercury-containing gas stream comprises about 3.5 ppmw or less of a vapor-phase iodine;
(ii) in the mercury-containing gas stream, a molar ratio of the vapor-phase iodine to the vapor-phase mercury is no more than about 600;
(iii) at an air preheater outlet, a concentration of the vapor-phase iodine ranges from about 0.1 to about 10 ppmw; and
(iv) a concentration of the iodine is about 30 ppmw or less relative to a weight of a mercury-containing feed material producing the vapor-phase mercury.
US Pat. No. 10,428,120

SERUM HALF-LIFE EXTENSION USING IGBD

UNIVERSITAT STUTTGART, S...

1. An immunoglobulin (Ig) binding moiety comprising a CH1 binding-immunoglobulin binding domain (IgBD) of a streptococcal protein G, which is a variant of SEQ ID NO: 1, wherein the three amino acids Glu26, Lys27, and Lys30 of SEQ ID NO: 1 are substituted with Ala and which may have up to 3 further amino acid substitutions, wherein the Ig binding moiety specifically binds to the constant domain 1 of the heavy chain (CH1) of an Ig molecule wherein the variant has the amino acid sequence TTYKLVINGKTLKGETTTKAVDAETAAAAFAQYANDNGVDGVWTYDDATKTFTVTE (SEQ ID NO: 3).
US Pat. No. 10,428,376

RNA AMPLIFICATION AND OLIGONUCLEOTIDE LIBRARY PREPARATION

REGENTS OF THE UNIVERSITY...

1. A method of amplifying an RNA template, the method comprising:annealing a primer to the RNA template, the primer comprising:
a region complementary to a portion of the RNA template; and
a digestible oligonucleotide adapter comprising RNA, DNA, an RNA/DNA hybrid, LNA, PNA, an oligonucleotide comprising at least one modified nucleotide, at least a portion of a plasmid, or at least a portion of a virus;
synthesizing an oligonucleotide from the primer, thereby producing a product that comprises a nucleotide strand complementary to the RNA template having the digestible oligonucleotide adapter;
isolating at least a portion of the oligonucleotide; and
subjecting the isolated product to treatment that digests at least a portion of the digestible adapter but does not digest the nucleotide strand complementary to the RNA template.
US Pat. No. 10,431,451

METHODS AND APPARATUSES FOR INCREASING REACTOR PROCESSING BATCH SIZE

LAM RESEARCH CORPORATION,...

1. A method of increasing a reaction chamber batch size, the method comprising:(a) processing a portion of a batch of wafers within the reaction chamber, wherein the processing results in at least some off-target deposition of material on interior surfaces of the reaction chamber;
(b) without cleaning the chamber, conducting a mid-batch reaction chamber processing to stabilize the off-target deposition material accumulated on interior surfaces of the reaction chamber comprising depositing a dielectric film coating that binds to the material on the interior surfaces of the reaction chamber; and
(c) processing another portion of the batch of wafers within the reaction chamber.
US Pat. No. 10,426,841

COMBINATION OF DRUGS WITH PROTEIN-BINDING PRODRUGS

Vergell Medical S.A., Ge...

1. A composition comprising doxorubicin and 6-maleimidocaproyl (hydrazone) of doxorubicin (DOXO-EMCH), wherein a molar ratio of the DOXO-EMCH to the doxorubicin ranges from 3:1 to 5:1.
US Pat. No. 10,428,121

NUCLEIC ACIDS AND PROTEINS FROM STREPTOCOCCUS GROUPS A AND B

Novartis AG, Basel (CH) ...

1. A fusion polypeptide consisting of (i) a polypeptide which has at least 95% sequence identity to SEQ ID NO: 4212 and (ii) a heterologous sequence.
US Pat. No. 10,428,378

SEQUENCING METHOD FOR RAPID IDENTIFICATION AND PROCESSING OF COGNATE NUCLEOTIDE PAIRS

OMNIOME, INC., San Diego...

1. A method of determining the identity of first and second correct nucleotides respectively comprising bases complementary to the next two bases of a template strand immediately downstream of a primer of a primed template nucleic acid molecule, said method comprising the steps of:(a) conducting a plurality of cycles of contacting a first primed template nucleic acid molecule with a reaction mixture comprising a polymerase and, for each cycle, a different test nucleotide, and removing any polymerase and nucleotide that may have bound to the first primed template nucleic acid molecule,
wherein the polymerase does not incorporate any of the different test nucleotides into the primer of the first primed template nucleic acid molecule during any of the plurality of cycles;
(b) measuring, for the cycles in step (a), signals indicating the magnitudes of formation of stabilized ternary complexes comprising binding of the first primed template nucleic acid molecule to the polymerase and the different test nucleotides; and
(c) determining the identities of the first correct nucleotide downstream of the primer, and the second correct nucleotide downstream of the primer using the measured signals from step (b), wherein the test nucleotide associated with the highest magnitude of stabilized ternary complex formation is identified as the first correct nucleotide downstream of the primer, and the test nucleotide associated with the second-highest magnitude of stabilized ternary complex formation is identified as the second correct nucleotide downstream of the primer.
US Pat. No. 10,428,123

CONSTITIUTIVE PROMOTER

Lonza Ltd, Visp (CH)

1. An expression construct comprising a pCS1 promoter which is any of:i) a promoter comprising the nucleic acid sequence identified as SEQ ID NO: 1, or
ii) a promoter which is a size variant of SEQ ID NO: 1 comprising a contiguous fragment of SEQ ID NO: 1 that has a length of at least 500 bp and includes the 3? terminus of SEQ ID NO: 1 wherein the size variant has at least 80% sequence identity to the contiguous fragment of SEQ ID NO: 1, which pCS1 promoter is operably linked to a nucleotide sequence encoding a protein of interest (POI), which pCS1 promoter is not natively associated with the nucleotide sequence encoding the POI.
US Pat. No. 10,426,844

CAPSID-MUTATED RAAV VECTORS AND METHODS OF USE

University of Florida Res...

1. A recombinant adeno-associated virus (rAAV) particle, comprising:(a) a mutated AAV2 VP3 capsid protein comprising phenylalanines at each of the positions corresponding to Y444, Y500 and Y730 in a wild type AAV2 VP3 capsid protein; and
(b) a rAAV nucleic acid vector comprising a 5? inverted terminal repeat (ITR), a transgene, and a 3? ITR.
US Pat. No. 10,428,124

TIMOTHY GRASS ALLERGENS AND METHODS AND USES FOR IMMUNE RESPONSE MODULATION

La Jolla Institute For Al...

1. A method for increasing immunological tolerance against grass pollen in a subject, the method comprising administering at least once to a subject an effective amount of a peptide comprising at least one T-cell epitope, said peptide consisting ofa) an amino acid sequence selected from the group consisting of SEQ ID NOS: 854, 855, and 857-868
wherein said peptide induces, elicits or stimulates production of interleukin-5 or interferon-gamma production in peripheral blood mononuclear cells from grass allergic subjects following contact with said peptide.
US Pat. No. 10,426,077

SEED FLOW LUBRICANT COMPOSITIONS AND USES THEREOF

3 Star Ag LLC, Calamus, ...

1. A method for improving plant seed flowability and/or reducing formation of plant seed dust, the method comprising contacting a plurality of plant seeds with a dry composition comprising a protein powder and a lipid.
US Pat. No. 10,426,845

DIABETES GENE THERAPY

UCL Business PLC, London...

1. A nucleic acid molecule comprising a nucleotide sequence encoding a functional preproinsulin protein wherein the nucleotide sequence has at least 89% identity to the sequence of SEQ ID NO. 1.
US Pat. No. 10,428,125

CYSTINE KNOT SCAFFOLD PLATFORM

Genentech, Inc., South S...

1. A peptide that binds to vascular endothelial growth factor A (VEGF-A), and comprises the scaffold structure:Z1C1L1C2L2C3L3C4L4C5L5C6Z2 wherein:Z1 corresponds to the N-terminus of the peptide and is selected from the group consisting of: G, no amino acid, and X, wherein X is acetylglycine or PEG6-propargylglycine;
Z2 corresponds to the C-terminus of the peptide and is selected from the group consisting of G, no amino acid, L-serine, D-serine, X, wherein X is selected from the group consisting of: L-beta-homoserine, L-beta-alanine, N-alpha-methyl-glycine, glycine comprising amidated carboxyl group, glycine ester of glycerol, glycine ester of glycol, glycine ester of oxetane-3-yl, glycine amide, and glycine morpholine amide, GFH, GIA, GGS, GTR, GVH, GLS and amino acids 30-33 of any one of SEQ ID NOs: 369-378;
C1-C6 are cysteine residues; and
L1 is loop 1 , L2 is loop 2 , L3 is loop 3 , L4 is loop 4 , and L5 is loop 5;whereinL1 is selected from the group consisting of SEQ ID NOs: 33, 141, 143, 212, 213, 277, 396-404, 414, 416, 433, 434, and amino acids 3 to 8 of SEQ ID NO: 548;
L2 is selected from the group consisting of SEQ ID NO: 97, 418, and amino acids 12-16 of SEQ ID NOs: 538, 539, 540, and 541;
L3 is selected from the group consisting of LAG, LQQ, VER, MSD, MNQ, MQT, VYQ, FIN, VSQ, VTE, FYE, MEQ, LEQ, VYR, VSD, VSE, VSK, VSN, VSX, wherein X is ornithine, LAK, MED, MEE, MEK, MEN, and MEX wherein X is ornithine, LAX wherein X is ornithine, LSG, LTG, LEG, and XAG wherein X is selected from the group consisting of: t-butyl-L-alanine, cyclobutyl-L-alanine, cyclopentyl-L-alanine, and 5,5,5-trifluoro-L-leucine, and XEQ wherein X is selected from the group consisting of: norleucine, t-butyl-L-alanine, and cyclobutyl-L-alanine;
L4 is selected from the group consisting of: V, L, I, and X wherein X is selected from the group consisting of: norleucine, butyl-L-glycine, t-butyl-L-alanine, L-cyclopentylglycine, cyclopentyl-L-alanine, cyclobutyl-L-glycine, cyclobutyl-L-alanine, and 5,5,5-trifluoro-L-leucine; and
L5 is selected from the group consisting of SEQ ID NOs: 45, 220, 427, and 429; and
wherein C1 forms a disulfide bond with C4, C2 forms a disulfide bond with C3, and C5 forms a disulfide bond with C6.
US Pat. No. 10,426,846

OLIG1 MINI-PROMOTERS: PIE305

University of British Col...

1. An isolated polynucleotide comprising an OLIG1 mini-promoter wherein the OLIG1 mini-promoter comprises one or more OLIG1 regulatory elements with at least 95% sequence identity to one, two or all of SEQ ID NOs: 3-5 operably joined to an OLIG1 basal promoter with at least 95% sequence identity to SEQ ID NO: 2 through a non-native spacing between the regulatory elements and the basal promoter, wherein the OLIG1 mini-promoter has at least 95% sequence identity to SEQ ID NO: 1.
US Pat. No. 10,428,126

DERMASEPTIN-TYPE AND PISCIDIN-TYPE ANTIMICROBIAL PEPTIDES

The Regents of the Univer...

1. An antimicrobial peptide (AMP) comprising the amino acid sequence selected from the group consisting of: ALWMTLKKKVLKAKAKALNAVLKGANA (SEQ ID NO: 16); ALWMTLKKKVLKAKAKALNAVLAGVNA (SEQ ID NO: 17); and ALWMTLKKKVLKAKAKALNAVLVGLNA (SEQ ID NO: 19)or a pharmaceutically-acceptable salt thereof.
US Pat. No. 10,428,382

MIRNA BASED TREATMENT MONITORING IN MULTIPLE SCLEROSIS

Hummingbird Diagnostics G...

1. A method of adjusting a therapeutic treatment of Relapsing-Remitting Multiple Sclerosis (RRMS) comprising the step of:(i) determining the level of at least one miRNA in erythrocytes, leukocytes, and thrombocytes isolated from a whole blood sample taken from a patient to whom at least once a drug to be used in said therapeutic treatment is administered or has been administered, wherein the nucleotide sequence of the at least one miRNA is selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 4; and
(ii) detecting an increase when the level of the at least one miRNA determined in step (i) is compared to a reference level of the at least one miRNA, which is determined in erythrocytes, leukocytes, and thrombocytes isolated from a whole blood sample taken from the patient prior to the administration of the drug, and subsequently administering to the patient at least once a renewed dose of the drug; or detecting no increase when the level of the at least one miRNA determined in step (i) is compared to the reference level of the at least one miRNA, and subsequently administering to the patient at least once an increased dose of the drug or a different drug.
US Pat. No. 10,426,847

METHOD FOR THE TREATMENT OF MALIGNANCIES

OncoSec Medical Incorpora...

1. A method of treating a subject having a treatment-refractory, cutaneous or subcutaneous, cancerous tumor, the method comprising:a) injecting the treatment-refractory cutaneous or subcutaneous cancerous tumor with an effective dose of at least one plasmid coding for at least one immunostimulatory cytokine;
b) administering electroporation therapy to the tumor; and
c) administering an effective dose of an immune checkpoint inhibitor to the subject.
US Pat. No. 10,428,127

CYCLIC, AMYLOID BETA-BINDING PEPTIDES AND THE USE THEREOF

Forschungszentrum Juelich...

1. A cyclic peptide comprising:a linear sequence of amino acids from a first amino acid to a last amino acid for binding to amyloid beta species, wherein the linear sequence comprises one or more sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11;
wherein said linear sequence of amino acids is in a cyclic form in which a first amino acid of the linear sequence has a covalent bond to a last amino acid of the linear sequence either directly or via a linker group comprising biotin or a streptavidin tetramer.
US Pat. No. 10,428,383

BIOMARKERS FOR PREMATURE BIRTH AND USE THEREOF

The Chinese University of...

1. A method for prophylactic treatment of premature birth, comprising the steps of:(a) measuring mRNA level of marker gene B3GNT5 in a blood sample taken from a pregnant woman by a reverse transcriptase polymerase chain reaction (RT-PCR), wherein the B3GNT5 mRNA level is normalized over the mRNA level of reference gene GAPDH in the same sample;
(b) detecting the B3GNT5 mRNA level obtained in step (a) to be higher than the standard control and determining the woman as having increased risk of premature birth; and
(c) providing prophylactic treatment for premature birth to the woman determined in step (b) as having increased risk of premature birth, wherein the prophylactic treatment comprises administration of an antenatal corticosteroid, a tocolytic drug, or transdermal glyceryl trinitrate.
US Pat. No. 10,426,848

HUMANIZED FC?R MICE

Regeneron Pharmaceuticals...

1. A genetically modified mouse whose genome comprises at least one human low affinity Fc?R ?-chain gene encoding a human low affinity Fc?R ?-chain with a polymorphism, wherein the human low affinity Fc?R ?-chain gene replaces an endogenous low affinity Fc?R ?-chain gene, and wherein the mouse comprises a functional endogenous FcR ?-chain and functionally expresses the human low affinity Fc?R ?-chain gene.
US Pat. No. 10,428,128

HELIX-GRAFTED PROTEINS AS INHIBITORS OF DISEASE-RELEVANT PROTEIN-PROTEIN INTERACTIONS

Colorodo State University...

1. A helix grafted protein, the helix grafted protein comprising at least 10 amino acids from a C-peptide from a virus grafted onto the solvent exposed ?-helix of a protein selected from the group consisting of GLUE, PLECKSTRIN, AKT2, DOK5, and ELMO, andwherein 1-20 solvent exposed amino acid residues in the terminal ?-helix are mutated.
US Pat. No. 10,428,384

BIOMARKERS FOR POST-TRAUMATIC STRESS STATES

Northwestern University, ...

1. A panel of biomarkers consisting of an isolated set of 100 or fewer full-length cDNA biomarkers, wherein said isolated set includes ALOX15, EIF4G2, and PRDX6 full-length cDNA biomarkers.
US Pat. No. 10,426,849

STAINING COMPOSITION

D.O.R.C. Dutch Ophthalmic...

1. A staining composition, comprising hyaluronic acid and a dye combination comprising Chicago Sky Blue 6B and trypan blue (TB).
US Pat. No. 10,428,129

RECOMBINANT PROTEIN

UBI PHARMA INC., Hukou T...

1. A recombinant protein, comprising an erythropoietin and a highly glycosylated peptide, wherein the highly glycosylated peptide comprises the sequence of SEQ ID NO: 1 and/or 2.
US Pat. No. 10,427,106

ASYMMETRIC MEMBRANES

Georgia Southern Universi...

1. An asymmetric membrane comprising: a) a first portion comprising nanopores; b) a second portion, adjacent to the first portion, comprising macrovoids; wherein the membrane has a total thickness of at least about 1 m; wherein each portion comprises amorphous carbon and paracrystalline carbon, wherein each portion comprises a lithium storage material; and wherein the amorphous carbon comprises a carbonized cellulose acetate, carbonized polyacrylonitrile, carbonized polysulfone, carbonized polyamide.
US Pat. No. 10,428,130

PURIFICATION OF BONE MORPHOGENETIC PROTEINS (BMPS)

ISTITUTO BIOCHIMICO ITALI...

1. A method of purifying a secreted TGF-? superfamily protein, wherein the secreted TGF-? superfamily protein is a bone morphogenetic protein (BMP), said method comprising:i. contacting a solution containing the secreted TGF-? superfamily protein with a Hydrophobic Charge Interaction Chromatography (HCIC) resin for obtaining a first eluate containing the TGF-? superfamily protein, wherein the first eluate containing the secreted TGF-? superfamily protein is eluted from the HCIC resin using an elution Glycine buffered solution; and
ii. contacting the first eluate containing the secreted TGF-? superfamily protein with a cation-exchange chromatography resin for obtaining a second eluate containing the secreted TGF-? superfamily protein.
US Pat. No. 10,428,386

GENE FOR PREDICTING THE PROGNOSIS FOR EARLY-STAGE BREAST CANCER, AND A METHOD FOR PREDICTING THE PROGNOSIS FOR EARLY-STAGE BREAST CANCER BY USING THE SAME

GENCURIX INC., Seoul (KR...

1. A method of treating a breast cancer in a breast cancer patient, comprising:collecting a breast cancer tissue sample from the breast cancer patient;
isolating RNA from the breast cancer tissue sample;
making cDNA with primers which specifically amplify a target sequence of SEQ ID NO: 7, complementary to the RNA from the breast cancer tissue sample;
amplifying the cDNA with the primers;
measuring an expression level of the target nucleotide sequence;
comparing the measured expression level of the target nucleotide sequence to an expression level of said target nucleotide sequence in a reference breast tumor sample;
diagnosing the breast cancer patient with an increased likelihood of metastasis of breast cancer, when the measured expression level of the target sequence is decreased in the breast cancer tissue sample as compared to the reference breast tumor sample; and
treating the diagnosed breast cancer patient with at least one of chemotherapy and surgery.
US Pat. No. 10,428,387

TREATING CHRONIC MYELOGENOUS LEUKEMIA (CML)

University of Massachuset...

1. A method for treating BCR-ABL independent imatinib mesylate (IM)-resistant chronic myeloid leukemia (CML) in a mammalian subject, the method comprising:detecting a level of PRKCH mRNA in a sample comprising leukemic cells from the subject;
comparing the level of PRKCH mRNA in the sample to a reference level; and
administering a combination of a BCR-ABL inhibitor and a MEK inhibitor to a subject who has a level of PRKCH mRNA above the reference level.
US Pat. No. 10,427,108

ZEOLITE FILM STRUCTURE

NGK Insulators, Ltd., Na...

1. A zeolite film structure comprising:a support,
a zeolite film formed on a surface of the support, and
a protective film formed on a surface of the zeolite film and configured from organic-nonorganic hybrid silica or carbon, wherein
an average thickness of the protective film is less than or equal to 172 nanometers and greater than or equal to 44 nanometers.
US Pat. No. 10,429,671

OPHTHALMIC LENS AND MANUFACTURING METHOD THEREOF

BenQ Materials Corporatio...

1. An ophthalmic lens comprising:a lens body; and
an antimicrobial hydrophilic layer formed on the surface of the lens body, comprising tannic acid and a zwitterionic polymer, wherein the zwitterionic polymer is selected from the group consisting of a phosphorylcholine polymer, a sulfobetaine polymer, a carboxybetaine polymer and a mixed-charge polymer, or combinations thereof.
US Pat. No. 10,428,133

CODON OPTIMIZED IL-15 AND IL-15R-ALPHA GENES FOR EXPRESSION IN MAMMALIAN CELLS

THE UNITED STATES OF AMER...

1. A method of expanding lymphocytes in an individual in need thereof comprising co-administering to the individual:(i) an interleukin-15 (IL-15) polynucleotide comprising an IL-15 nucleic acid sequence encoding an IL-15 polypeptide, wherein the IL-15 nucleic acid sequence has at least 85% sequence identity to nucleotides 145-489 of SEQ ID NO:3; and
(ii) an IL-15 receptor ? (IL-15R?) polynucleotide comprising an IL-15R? nucleic acid sequence encoding an IL-15R? polypeptide;
wherein the IL-15 nucleic acid sequence and the IL-15R? nucleic acid sequence are each operably linked to a promoter.
US Pat. No. 10,428,389

METHOD FOR DETECTING METHYLATION OF COLORECTAL CANCER SPECIFIC METHYLATION MARKER GENE FOR COLORECTAL CANCER DIAGNOSIS

GENOMICTREE, INC., Daeje...

1. A method for detecting CpG methylation of GPM6A (glycoprotein M6A) gene, the method comprising the steps of:(a) isolating genomic DNA from a clinical sample;
(b) treating the genomic DNA or a fragment thereof with bisulfite;
(c) amplifying a methylated CpG of GPM6A gene in the bisulfite-treated genomic DNA or fragment thereof from step (b) by using primer pair comprising:
a primer comprising the sequence of SEQ ID NO: 25, and a primer comprising the sequence of SEQ ID NO: 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, or 63 to amplify a methylated CpG of the bisulfite-treated GPM6A gene; and
(d) determining whether the CpG of GPM6A was methylated based on whether the DNA was amplified in step (c).
US Pat. No. 10,428,134

IMMUNOGLOBULINS AND USES THEREOF

JANSSEN PHARMACEUTICA NV,...

1. An isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, a HCDR3, and a light chain complementarity determining region 1 (LCDR1), a LCDR2, and a LCDR3, having the polypeptide sequences of SEQ ID NO: 16, 17, 18, 19, 20, and 21, respectively.
US Pat. No. 10,428,135

FUSION POLYPEPTIDES CAPABLE OF ACTIVATING RECEPTORS

REGENERON PHARMACEUTICALS...

1. A homodimer formed from two fusion polypeptides of the form (A)-M-(A?), wherein component A comprises a single chain variable fragment (scFv) antibody capable of binding Tie-1, component M comprises a multimerizing component comprising an Fc domain of IgG, and component A? comprises i) a fibrinogen domain of Ang1 or Ang2, or ii) a single chain variable fragment (scFv) antibody capable of binding Tie-2, wherein said homodimer binds to both Tie-1 and Tie-2 receptors and clusters four or more Tie receptors of the cell resulting in phosphorylation of both Tie-1 and Tie-2 receptors.
US Pat. No. 10,428,391

METHOD TO USE VIRAL AND HOST METHYLATION MARKERS FOR CERVICAL CANCER SCREENING AND TRIAGE IN LIQUID PREP, SERUM/PLASMA, AND URINE: PCR AND SEQUENCING BASED PROCESS METHODS

The Johns Hopkins Univers...

1. A method for triaging a human papillomavirus (HPV)-positive woman into colposcopy, the method comprising:(a) selecting a HPV-positive woman testing positive for one or more high risk types of HPV;
(b) obtaining nucleic acid from a test sample from a liquid prep, plasma, serum or urine of the selected HPV-positive woman;
(c) performing bisulfite modification to the nucleic acid from the test sample to produce a bisulfite modified nucleic acid;
(d) determining in the bisulfite modified nucleic acid from (c) a promoter methylation level of the promoter regions of the group of genes comprising ZNF516, FKBP6, and INTS1 and HPV gene HPV16-L1 using quantitative real-time methylation specific PCR (QMSP) and primers and/or probes are selected from the group consisting of SEQ ID NOS: 1-12 that exhibit increased promoter methylation in women having CIN12+ lesions as compared to women having no intraepithelial lesions or malignancy (NILM);
(e) triaging the HPV-positive woman into colposcopy when the level of promoter methylation of the group of genes is increased relative to the level of promoter methylation of the group of genes in a reference sample obtained from women having NILM; and
(f) performing a colposcopy.
US Pat. No. 10,428,136

I DOMAIN CHIMERIC ANTIGEN RECEPTOR SPECIFIC TO ICAM-1

1. A Chimeric antigen receptor (CAR) comprising from N-terminus to C-terminus:(i) an I domain of the ?L subunit of human lymphocyte function-associated antigen-1,
(ii) a transmembrane domain,
(iii) at least one co-stimulatory domains, and
(iv) an activating domain, wherein the I domain binds ICAM-1 at an affinity between about 145 nM to about 20 ?M, and the I domain comprises the sequence of 130-310 amino acids of SEQ ID NO: 1, with one mutation of F292A, F292S, L289G, or F265S.
US Pat. No. 10,428,392

COMPOSITIONS AND METHODS FOR IDENTIFYING SECRETORY ANTIBODY-BOUND MICROBES

YALE UNIVERSITY, New Hav...

1. A method of treating an inflammatory disease or disorder associated with a secretory antibody-bound bacteria in the microbiota of a subject in need thereof, the method comprising administering to the subject at least one therapy, wherein the at least one therapy induces an immune response directed against the secretory antibody-bound bacteria.
US Pat. No. 10,428,393

CORN EVENT 5307

Syngenta Crop Protection ...

1. A method of detecting the presence of a nucleic acid molecule that is unique to event 5307 in a sample comprising corn nucleic acids, the method comprising:a) isolating a nucleic acid molecule from corn;
b) combining the nucleic acid molecule with a pair of nucleic acid primer sequences, wherein the first primer sequence is selected from any one of SEQ ID NO. 8 through SEQ ID NO: 14 or SEQ ID NO: 69 through SEQ ID NO: 72, or their complements; and the second primer sequence is selected from any one of SEQ ID NO: 15 through SEQ ID NO: 68, or their complements;
c) performing a nucleic acid amplification reaction which results in an amplicon; and
d) detecting the amplicon.
US Pat. No. 10,428,394

METHOD OF PROMOTING PLANT GROWTH

IDEMITSU KOSAN CO., LTD.,...

1. A method of promoting plant growth, comprising:treating a seed of a plant with bacterial cells or a culture product including bacterial cells of Bacillus sp. ITB105 strain NITE BP-01727,
wherein the Bacillus sp. ITB105 strain NITE BP-01727 has the 16S rDNA having the nucleotide sequence of SEQ ID NO: 3.
US Pat. No. 10,428,139

GM HYBRIDOMA CELL, MONOCLONAL ANTIBODY, KIT AND PREPARATION METHOD AND USE THEREOF

DYNAMIKER BIOTECHNOLOGY (...

1. A hybridoma cell or a passage cell thereof having an accession number of CGMCC No. 13827.
US Pat. No. 10,428,395

METHOD FOR THE PREPARATION OF ANALLERGIC PROBIOTIC BACTERIAL CULTURES AND RELATED USE

PROBIOTICAL S.P.A., Nova...

1. A method for preparing a live probiotic food product or a live probiotic pharmaceutical formulation comprising(i) providing a fermentative substrate containing sulfur dioxide and sulfites at concentrations of not more than 10 mg/kg or 10 mg/liter expressed as SO2;
(ii) adding to the substrate provided in step (i) an exogenous meat peptone or an exogenous vegetal peptone selected from the group consisting of rice, potato, maize, chestnuts, tapioca, manioca, pea, fava beans, and mixtures thereof;
(iii) fermenting one or more live probiotic bacteria in the fermentative substrate of step (ii) to yield a probiotic bacterial culture containing less than 3 ppm gluten, less than 7 ppm lactose, and less than 0.05 ppm beta-lactoglobulins, and
(iv) preparing a live probiotic food product or live probiotic pharmaceutical formulation comprising said probiotic bacterial culture
wherein one of the one or more live probiotic bacteria is the Lactobaciillus acidophilus strain deposited at the BCCM LMG under deposit accession number LMG P21381.
US Pat. No. 10,426,348

USING DIFFERENTIAL TIME-FREQUENCY TISSUE-RESPONSE SPECTROSCOPY TO EVALUATE LIVING BODY RESPONSE TO A DRUG

PURDUE RESEARCH FOUNDATIO...

1. A method of evaluating a drug, comprising:applying a drug to a living body in which a functional response of the living body to the drug is under evaluation;
generating a differential spectrogram which plots a differential relative spectral density for a given frequency at a time t relative to an initial time t0 using motility contrast imaging of the living body as it responds to the application of the drug;
applying a plurality of feature masks to the spectrogram for the drug under evaluation wherein each feature mask identifies a portion of the spectrogram;
applying the plurality of feature masks to a plurality of differential spectrograms wherein each of the plurality of differential spectrograms is obtained by applying a stimulus to a living body wherein the living body has a known response to the stimulus;
generating a feature vector for the drug under evaluation by assigning a numerical value for each of the plurality of feature masks wherein the assigned numerical value is related to the strength and sign of the response of the living body for that portion of the spectrogram identified by the feature mask;
generating a feature vector for each of the plurality of differential spectrograms generated by applying stimuli to the living body wherein each feature vector is created by assigning a numerical value for each of the plurality of feature masks wherein the assigned numerical value is related to the strength and sign of the response of the living body for that portion of the spectrogram identified by the feature mask; and
evaluating the drug under evaluation by comparing the feature vector for the drug under evaluation with the feature vectors for the plurality of stimuli to determine whether the living body exhibits a known functional response to the drug under evaluation, and if so, selecting and using the drug under evaluation for treatment of a patient or further testing.
US Pat. No. 10,428,396

METHOD FOR THE PREPARATION OF HIGH TEST MOLASSES

PRAJ INDUSTRIES, LIMITED,...

1. A method for the preparation of high test molasses from sugarcane or sugar beet juice comprising:(a) concentrating said juice by evaporation to contain a higher amount of sucrose forming a concentrated syrup;
(b) adding a desired amount of organic acid to said syrup creating a reaction mixture; and
(c) treating said reaction mixture at an effective temperature for about 2 to about 3 hours to cause inversion of sucrose to inverted sugar forming a high test molasses product, wherein the high test molasses product has a pH of about 3.
US Pat. No. 10,428,141

COMPOSITIONS AND METHODS FOR TREATING CANCER WITH ANTI-ROR1 IMMUNOTHERAPY

LENTIGEN TECHNOLOGY, INC....

1. An isolated nucleic acid molecule encoding a chimeric antigen receptor (CAR) comprising at least one extracellular antigen binding domain comprising a ROR1 antigen binding domain encoded by a nucleotide sequence comprising SEQ ID NO: 1, or SEQ ID NO: 7, a transmembrane domain comprising CD8 transmembrane domain, an intracellular signaling domain comprising a functional signaling domain of 4-1BB and a CD3 zeta intracellular domain.
US Pat. No. 10,428,397

METHOD TO PRODUCE WATER-SOLUBLE SUGARS FROM BIOMASS USING SOLVENTS CONTAINING LACTONES

Wisconsin Alumni Research...

1. A process to produce an aqueous solution of carbohydrates comprising C6-sugar-containing oligomers, C6-sugar monomers, C5-sugar-containing oligomers, C5-sugar monomers, or any combination thereof, the process comprising:reacting biomass or a biomass-derived reactant with a solvent system comprising (i) an organic solvent selected from the group consisting of beta-, gamma-, and delta-lactones, and combinations thereof, and (ii) at least about 1 wt % water; in the presence of an acid catalyst for a time and under conditions to yield a product mixture wherein at least a portion of water-insoluble C6-sugar-containing polymers or oligomers, or water-insoluble C5-sugar-containing polymers or oligomers, if present in the biomass or biomass-derived reactant, are converted to water-soluble C6-sugar-containing oligomers, C6-sugar monomers, C5-sugar-containing oligomers, C5-sugar monomers, or any combination thereof.
US Pat. No. 10,428,142

MULTIPARTITE SIGNALING PROTEINS AND USES THEREOF

bluebird bio, Inc., Camb...

1. An isolated non-natural cell comprising:(a) a first nucleic acid molecule encoding a first fusion protein comprising a first multimerization domain comprising an FRB T2098L polypeptide, a CD8a transmembrane domain, a costimulatory domain of 4-1BB, and an actuator domain of CD3, wherein the first multimerization domain localizes extracellularly when the first fusion protein is expressed; and
(b) a second nucleic acid molecule encoding a second fusion protein comprising a binding domain comprising a single chain antibody variable region (scFv) specific for CD19 or B cell maturation antigen (BCMA), a second multimerization domain comprising an FKBP12 polypeptide, and a CD4, a CD154 or a CD71 transmembrane domain, wherein the second multimerization domain localizes extracellularly when the first fusion protein is expressed;
wherein the first fusion protein and the second fusion protein are each expressed as separate fusion proteins and form a polypeptide complex on the non-natural cell surface in the presence of a bridging factor, rapalog AP21967; and
wherein the bridging factor is associated with and disposed between the first and second multimerization domains.
US Pat. No. 10,428,398

ANIMAL HIDE DEHAIRING METHODS

National Beef Packing Com...

1. A method for preparing an animal hide for chrome tanning, the method comprising the steps of:treating the hide with a first enzyme, wherein the first enzyme includes:
a glycosylase enzyme;
treating the hide with a second enzyme after the step of treating with the first enzyme, wherein the second enzyme includes a peptidase; and
treating the hide with a polysulfide after the step of treating with the first enzyme.
US Pat. No. 10,428,143

MODULATION OF STIMULATORY AND NON-STIMULATORY MYELOID CELLS

The Regents of the Univer...

1. A method of killing, disabling, or depleting Triggering Receptor Expressed on Myeloid Cells 2 (TREM2+) myeloid cells present in a cancer tissue of a subject, comprising: contacting the TREM2+ myeloid cells present in the cancer tissue of the subject with an antibody or antigen-binding fragment thereof comprising a human Fc domain, wherein the antibody or antigen-binding fragment thereof binds to the extracellular domain of TREM2; wherein the antibody or antigen-binding fragment thereof is present in an amount effective to kill, disable, or deplete the TREM2+ myeloid cells via antibody-dependent cell-mediated cytotoxicity activity, antibody-dependent phagocytosis activity, complement-dependent cytotoxicity activity, or antibody-mediated phagocytosis activity.
US Pat. No. 10,428,144

DICAM-SPECIFIC ANTIBODIES AND USES THEREOF

VAL-CHUM, LIMITED PARTNER...


US Pat. No. 10,428,400

STEEL SHEET HAVING HIGH TENSILE STRENGTH AND DUCTILITY

ARCELORMITTAL FRANCE, Sa...

1. A hot-rolled steel sheet or part comprising:a tensile strength greater than 800 MPa;
an elongation at break greater than 10%;
a composition of the steel comprising, the contents being expressed by weight:
0.050%?C?0.090%;
1.4%?Mn?1.8%;
0.015%?Al?0.050%;
0.1%?Si?0.3%;
0.10%?Mo?0.40%;
S?0.010%;
P?0.025%;
0.003%?N?0.009%;
0.12% Ti<0.005%;
Nb?0.020%; and
a balance of the composition comprising iron and inevitable impurities resulting from the smelting; and
a microstructure of the sheet or part comprising:
at least 80% upper bainite, as a surface fraction;
a remainder consisting of lower bainite, martensite and residual austenite; and
a sum of the martensite and residual austenite, as a surface fraction, being less than 5%.
US Pat. No. 10,426,865

ABSORBENT PAD THAT INCLUDES A FATTY ACID COMPOSITION FOR ODOR CONTROL

BioNutraTech, Inc., Hous...

1. An absorbent pad, comprising:a batt of cellulose fibers;
superabsorbent particles intermixed within the batt of cellulose fibers; and
an odor control material intermixed within the batt of cellulose fibers, wherein the odor control material is a particulate material that is a composite of one or more fatty acids mixed with a source of nitrogen, a source of phosphorus, and a source of iron.
US Pat. No. 10,427,377

FILM, PACKAGING BAG USING THE FILM, AND METHOD OF IMPARTING HEAT SEALING PROPERTIES TO THE FILM

TOPPAN PRINTING CO., LTD....

1. A film made up of a single layer of biaxially stretched polyester or made up of a laminate including a layer of biaxially stretched polyester at a surface, wherein the layer of biaxially stretched polyester includes a non-sealing portion having no heat sealing properties, and a sealing portion having heat sealing properties with lower crystallinity compared to that of the non-sealing portion, wherein the layer of biaxially stretched polyester has a specific viscosity in a range of 0.62 or more to 0.66 or less.
US Pat. No. 10,428,145

PD-1 BINDING PROTEINS AND METHODS OF USE THEREOF

Celgene Corporation, Sum...

1. An antibody or antigen-binding fragment thereof that binds to PD-1, wherein the antibody or antigen-binding fragment comprises:a light chain variable region (VL) comprising:
a VL complementarity determining region 1 (CDR1) comprising SEQ ID NO:1,
a VL CDR2 comprising SEQ ID NO:2, and
a VL CDR3 comprising SEQ ID NO:3; and
a heavy chain variable region (VH) comprising:
a VH CDR1 comprising SEQ ID NO:4,
a VH CDR2 comprising SEQ ID NO:5, and
a VH CDR3 comprising SEQ ID NO:6.
US Pat. No. 10,426,866

TERNARY MIXTURE FOR A BONE CEMENT AND METHOD FOR ITS REALISATION

TECRES S.P.A., Sommacamp...

1. A composition for an acrylic bone cement for surgical or orthopedic use, wherein said composition comprises a solid phase comprising:a ternary mixture having the following composition: a polymethyl methacrylate (PMMA) homopolymer, a methyl methacrylate-styrene (MMA-styrene) copolymer and a methyl methacrylate-methyl acrylate (MMA-MA) copolymer, and
a liquid phase comprising at least one acrylic monomer,
further comprising at least one viscosizing polymer, wherein said at least one viscosizing polymer is soluble in said liquid phase and wherein said at least one viscosizing polymer has smaller particles than the particles making said ternary mixture,
wherein said at least one viscosizing polymer comprises at least one of the components of said ternary mixture.
US Pat. No. 10,428,146

ANTI PD-1 ANTIBODIES

CB Therapeutics, Inc., S...

1. An isolated antibody or fragment thereof that binds to PD-1, wherein the antibody or fragment thereof comprises(i) a light chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 34, 35, and 36, respectively, and a heavy chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 29, 30, and 31, respectively;
(ii) a light chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 55, 56, and 57, respectively, and a heavy chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 50, 51, and 52, respectively;
(iii) a light chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 65, 66, and 67, respectively, and a heavy chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 60, 61, and 62, respectively;
(iv) a light chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 105, 106, and 107, respectively, and a heavy chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 100, 101, and 102, respectively; or
(v) a light chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 115, 116, and 117, respectively, and a heavy chain CDR1, CDR2, and CDR3 sequence comprising SEQ ID NO: 110, 111, and 112, respectively.
US Pat. No. 10,428,147

ANTI-SORTILIN ANTIBODIES, USES AND METHODS FOR TREATMENT

1. An antibody, or an antigen-binding fragment thereof, capable of binding specifically to Sortilin, wherein the antibody or antigen-binding fragment thereof comprises:a. a light chain variable domain L-CDR1 comprising SEQ ID NO:145;
b. a light chain variable domain L-CDR 2 comprising SEQ ID NO:146;
c. a light chain variable domain L-CDR 3 comprising SEQ ID NO:147;
d. a heavy chain variable domain H-CDR 1 comprising SEQ ID NO:148;
e. a heavy chain variable domain H-CDR 2 comprising SEQ ID NO:149; and
f. a heavy chain variable domain H-CDR 3 comprising SEQ ID NO:150.
US Pat. No. 10,426,868

METHOD FOR PREPARING AN ANIMAL DECELLULARIZED TISSUE MATRIX MATERIAL AND A DECELLULARIZED TISSUE MATRIX MATERIAL PREPARED THEREBY

Beijing Ruijian Gaoke Bio...

1. A method for manufacturing an animal acellular tissue matrix material, comprising the steps of:(1) collecting a raw material of an animal tissue, wherein the animal tissue is washed to remove blood and dirt, and cut into a tissue material having a length, a width and a height of the desired specification and dimension, and then the tissue material is preserved at a low temperature below freezing;
(2) thawing slowly, and rehydrating the tissue material from step (1) in normal saline containing gentamicin;
(3) disinfecting and sterilizing the tissue material from step (2) in a moderate alkaline solution, then rinsing the tissue material with sterile pure water, and adjusting the pH of the tissue material to be neutral, wherein the moderate alkaline solution is a sodium bicarbonate or sodium hydroxide solution with a pH of 10.5 to 11.5 or an ammonia hydroxide solution with a concentration of 0.1%, wherein in the step of disinfection and sterilization, the rehydrated tissue material is soaked in the moderate alkaline solution for 24 hours to 48 hours with slow shaking;
(4) decellularizing and washing the tissue material from step (3),
wherein the decellularizing comprises rinsing the disinfected, sterilized and rinsed tissue material in normal saline containing 2.0 mmol/L of calcium chloride, 2.0 mmol/L of magnesium chloride and 100 mg/L of gentamicin at room temperature for 1˜3 hours, and then adding a dispase solution to remove the cells, wherein the dispase solution is a neutral dispase solution containing 1 mmol/L to 20 mmol/L of calcium chloride, 1 mmol/L to 20 mmol/L of magnesium chloride and 50 units/L to 400 units/L of dispase, and the tissue material is soaked in the neutral dispase solution at 37° C. for 24 hours to 36 hours with slow shaking;
wherein the washing comprises washing with a first detergent solution at 37° C. for 12 hours to 18 hours with slow shaking and washing with a second detergent solution at room temperature for 24 hours to 36 hours with slow shaking, wherein the first detergent solution is prepared by dissolving polyethylene glycol tert-octylphenyl ether, at a concentration of 0.5%, in a buffer solution of hydroxyethylpiperazine ethane sulfonic acid with a pH between 7.0 and 8.0; and the second detergent solution is prepared by dissolving sodium deoxycholate, at a concentration of 1.0%, in phosphate buffer solution with a pH between 7.2 and 7.8;
(5) digesting DNA components of the animal tissue, wherein the animal tissue is then rinsed with normal saline;
(6) digesting ?-Gal antigen of the animal tissue, wherein the animal tissue is then rinsed with a 2% to 5% high concentration sodium chloride solution, and then rinsed with normal saline, and when the raw material of the animal tissue has been improved by genetic engineering to have no ?-Gal antigen is selected, step (6) is omitted and step (7) is directly performed;
(7) inactivating any viruses in the tissue material and then rinsing the tissue material;
(8) packaging and sealing the tissue material under an aseptic condition; and
(9) terminal sterilization treatment of the tissue material to obtain the animal acellular tissue matrix material;
wherein an enzymatic method is used to remove cell components and ?-Gal antigen and improve the flexibility of a scaffold.
US Pat. No. 10,428,148

ANTI-ALK2 ANTIBODY

Saitama Medical Universit...

1. A monoclonal antibody or an antigen-binding fragment thereof which inhibits activin like kinase 2 (ALK2)-mediated bone morphogenetic proteins (BMP) signal transduction and specifically binds to a polypeptide sequence consisting of at least 7 amino acids present in any one of the following amino acid sequences (a) to (d):(a) the amino acid sequence of SEQ ID NO: 84;
(b) the amino acid sequence consisting of amino acid position numbers 21 to 123 of the amino acid sequence of SEQ ID NO: 84;
(c) the amino acid sequence of SEQ ID NO: 86; and
(d) the amino acid sequence consisting of amino acid position numbers 21 to 123 of the amino acid sequence of SEQ ID NO: 86,wherein the monoclonal antibody or antigen binding fragment comprises a heavy chain variable region having complementarity determining region (CDR) H1, CDRH2, and CDRH3 and a light chain variable region having CDRL1, CDRL2, and CDRL3, wherein a set of the amino acid sequences of CDRH1, CDRH2, and CDRH3 and the amino acid sequences of CDRL1, CDRL2, and CDRL3 is selected from the group consisting of:(1) SEQ ID NO: 72 for CDRH1, SEQ ID NO: 73 for CDRH2, and SEQ ID NO: 74 for CDRH3, and SEQ ID NO: 75 for CDRL1, SEQ ID NO: 76 for CDRL2, and SEQ ID NO: 77 for CDRL3;
(2) SEQ ID NO: 59 for CDRH1, SEQ ID NO: 60 for CDRH2, and SEQ ID NO: 61 for CDRH3, and SEQ ID NO: 62 for CDRL1, SEQ ID NO: 63 or 71 for CDRL2, and SEQ ID NO: 64 for CDRL3;
(3) SEQ ID NO: 78 for CDRH1, SEQ ID NO: 79 for CDRH2, and SEQ ID NO: 80 for CDRH3, and SEQ ID NO: 81 for CDRL1, SEQ ID NO: 82 for CDRL2, and SEQ ID NO: 83 for CDRL3; and
(4) SEQ ID NO: 65 for CDRH1, SEQ ID NO: 66 for CDRH2, and SEQ ID NO: 67 for CDRH3, and SEQ ID NO: 68 for CDRL1, SEQ ID NO: 69 for CDRL2, and SEQ ID NO: 70 for CDRL3.
US Pat. No. 10,426,869

BIODEGRADABLE MAGNESIUM ALLOYS AND COMPOSITES

The University of Toledo,...

1. A composite comprising:magnesium;
a rare earth element present at a concentration up to about 15 wt %; and
silica present at a concentration ranging from about 10 wt % to about 15 wt %;
wherein the composite has a nanocrystalline grain size.
US Pat. No. 10,427,125

METHODS FOR PERFORMING PATTERNED CHEMISTRY

ARIZONA BOARD OF REGENTS ...

1. A method of making an array of molecules, comprising:providing a substrate having a surface wherein the surface has a plurality of features, each of the features being defined and outlined by an electrically neutral perimeter wall to reduce lateral diffusion of reagents and at least some of the features comprising a first plurality of active sites, wherein the electrically neutral perimeter wall comprises a metal chosen from the group consisting of gold, chrome and tin, and wherein the surface of the feature comprises a different material than the electrically neutral perimeter wall,
applying a first chemical reaction mixture onto the surface such that the first chemical reaction mixture is evenly distributed across the first plurality of active sites, wherein the first chemical reaction mixture comprises a first molecule having a first functional group capable of attaching to the active site, a second functional group capable of forming a covalent bond and a protecting group capping the second functional group, whereby the first molecule is coupled to the first plurality of active sites.
US Pat. No. 10,428,149

SINGLE-CHAIN TUMOR NECROSIS FACTOR (TNF) LIGAND FAMILY MOLECULES, FUSION PROTEINS AND DERIVATIVES THEREOF

UNIVERSITAT STUTTGART, S...


through a peptide Xa, which is in each case independently selected and has a length of 3 to 8 amino acids,
wherein X1 is a non-polar/hydrophobic or polar/neutral amino acid;
wherein X2 is selected from the group consisting of P, K, V, I, and A;
wherein X3 is selected from the group consisting of D, S, M, and I;
(ii) component B comprising
a dimerization domain consisting of an antibody VL and VH region linked directly to each other with a peptide that has a length of between 7 and 11 amino acids.
US Pat. No. 10,427,126

SYSTEM AND METHOD FOR LONGITUDINAL ANALYSIS OF PEPTIDE SYNTHESIS

Roche Sequencing Solution...

1. A method of assessing a synthetic peptide population, the method comprising:interrogating a population of peptide features in the presence of a receptor having an affinity for a binder sequence, the population of peptide features synthesized over a plurality of synthesis periods, the population of peptide features including a plurality of control peptide features synthesized to have an amino acid sequence including the binder sequence, wherein the population of peptide features are covalently bound to a solid surface in an array, the plurality of control peptide features including:
a first control peptide features synthesized beginning with a first one of the plurality of synthesis periods; and
a second control peptide feature synthesized beginning after the first one of the plurality of synthesis periods such that synthesis of the second control peptide feature is delayed by at least one synthesis period; and
detecting a signal output characteristic of an interaction of the receptor with the plurality of control peptide features, the signal output indicative of the fidelity of the synthesis of the population of the peptide features,
wherein the binder sequence is a streptavidin binder sequence, wherein the streptavidin binder sequence comprises an amino acid sequence selected from a group consisting of SEQ ID NOs:1-3, and wherein the receptor is streptavidin.
US Pat. No. 10,428,151

TREATMENT OF HEMATOLOGIC MALIGNANCIES WITH AN ANTI-CXCR4 ANTIBODY

Bristol-Myers Squibb Comp...

1. A method for inducing apoptosis of multiple myeloma cells in a subject afflicted with multiple myeloma, said method comprising administering to the subject a therapeutically effective amount of an antibody or an antigen-binding fragment thereof which specifically binds to a human CXCR4 receptor and comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 domains comprising consecutively linked amino acids having the sequences set forth in SEQ ID NO: 1, SEQ ID NO: 5 and SEQ ID NO: 9, respectively, and a light chain variable region comprising CDR1, CDR2 and CDR3 domains comprising consecutively linked amino acids having the sequences set forth in SEQ ID NO: 13, SEQ ID NO: 17 and SEQ ID NO: 21, respectively.
US Pat. No. 10,428,152

ANTIBODIES DIRECTED AGAINST CD127

OSE IMMUNOTHERAPEUTICS, ...

1. An isolated antibody or an antigen-binding fragment thereof which binds specifically to human CD127, wherein said antibody or antigen-binding fragment thereof comprises a VH chain comprising the following amino acid sequences:(a) VHCDR1 of SEQ ID No:10;
(b) VHCDR2 of SEQ ID No:12; and
(c) VHCDR3 of SEQ ID No:14 or of SEQ ID No:48;
and a VL chain comprising the following amino acid sequences:
(d) VLCDR1 of SEQ ID No:16 or of SEQ ID No:50;
(e) VLCDR2 of SEQ ID No:18 or of SEQ ID No:52; and
(f) VLCDR3 of SEQ ID No:20.
US Pat. No. 10,428,408

R-T-B-BASED RARE EARTH SINTERED MAGNET AND ALLOY FOR R-T-B-BASED RARE EARTH SINTERED MAGNET

TDK Corporation, Tokyo (...

1. An R-T-B-based rare earth sintered magnet, comprisinga rare earth element R, B, a metallic element M which includes one or more metals selected from Al, Ga and Cu, a transition metal T which includes Fe as a main component, and inevitable impurities, wherein
the sintered magnet includes
13 atom % to 15.5 atom % of R,
5.0 atom % to 6.0 atom % of B,
0.1 atom % to 2.4 atom % of M,
0.1 atom % or more of Ga, and
T and the inevitable impurities as a balance,
and wherein
the sintered magnet includes 0.015 atom % to 0.04 atom % of Zr as the transition metal T, and
the Zr does not form a compound with the B in a grain boundary phase.
US Pat. No. 10,428,153

HUMAN ANTI TSHR ANTIBODIES

RSR Ltd., Lancaster (GB)...

1. An isolated human monoclonal or recombinant antibody or fragment thereof that binds to the TSH receptor and stimulates the TSH receptor, wherein the antibody or fragment thereof comprises:an antibody VL domain having the amino acid sequence shown in residues 1-129 of SEQ ID NO:33; and
an antibody VH domain having the amino acid sequence shown in residues 1-141 of SEQ ID NO:15.
US Pat. No. 10,427,130

HYDROTHERMAL CARBONIZATION METHOD AND DEVICE WITH OPTIMISED SLUDGE AND STEAM MIXING

SUEZ INTERNATIONAL, Pari...

1. A method of continuous hydrothermal carbonization of sludge containing organic matter, said sludge having a solids content between 10and 30% by weight, said method involving a hydrothermal reaction carried out in a reactor, said hydrothermal reaction comprising:continuously injecting said sludge into the reactor via a first inlet,
injecting steam into the reactor via a second inlet that is distinct from the first inlet,
circulating a mixture consisting of the sludge and the steam injected into the reactor, within the reactor,
continuously extracting at least a portion of the mixture contained in the reactor via a sludge outlet,
wherein said injecting steam comprises injecting the steam in counterflow to the mixture circulating in the reactor.
US Pat. No. 10,428,154

MONOCLONAL ANTI-CD95L ANTIBODY

Apogenix AG, Heidelberg ...

1. A monoclonal anti-CD95L antibody, comprisinga heavy chain amino acid sequence including CDRH1 as shown in SEQ ID NO: 1, CDRH2 as shown in SEQ ID NO: 2, and CDRH3 as shown in SEQ ID NO: 3, and
a light chain amino acid sequence including CDRL1 as shown in SEQ ID NO: 4, CDRL2 as shown in SEQ ID NO: 5, and CDRL3 as shown in SEQ ID NO: 6.
US Pat. No. 10,428,410

HIGH TOUGHNESS SECONDARY HARDENING STEELS WITH NICKEL AS A PRIMARY STRENGTH AND TOUGHENING AGENT

Carnegie Mellon Universit...

1. A steel alloy, comprising:a medium carbon secondary hardening steel composition containing:
0.3-0.45 wt. % carbon;
4-6 wt. % chromium;
0-2.5 wt. % molybdenum;
0-3 wt. % tungsten;
0-1.0 wt. % vanadium;
less than 0.75 wt. % silicon;
less than 3 wt. % cobalt; and
less than 1 wt. % manganese; and
an addition of nickel to the medium carbon secondary hardening steel composition in a range of about 3 wt. % to about 7 wt. % that:
provides a V-notch Charpy energy of at least 20.7 joules;
increases a yield strength of the medium carbon secondary hardening steel composition to at least 1500 MPa;
increases an ultimate tensile strength of the medium carbon secondary hardening steel composition to at least 1800 MPa; and
increases a KIc fracture toughness of the medium carbon secondary hardening steel to at least about 86 MPa?m.
US Pat. No. 10,427,131

GUANIDINE-FUNCTIONALIZED PERLITE PARTICLES, ARTICLES CONTAINING THE PARTICLES, AND METHODS OF USING THE PARTICLES AND ARTICLES

3M Innovative Properties ...

1. A guanidine-functionalized perlite particle comprising a perlite particle that is modified with at least one silane having the formulaX3-nRanSi—Y-G,wherein:n is 0, 1, or 2;
each Ra, if present, is independently an alkyl, aralkyl, or aryl;
Y is a divalent group comprising an alkylene having 2 to 20 carbons;
G is a guanidine group of the formula —NH—C(?NH)—NH2; and
each X is independently alkoxy or acyloxy.
US Pat. No. 10,427,132

BIOREFINING METHOD

Licella Pty Ltd, North S...

1. A method for producing a bio-product from organic matter feedstock, the method comprising:providing a reaction mixture comprising the organic matter feedstock, a solvent, and a solid substrate;
treating the reaction mixture at a temperature of between about 200° C. and 400° C. and pressure of about 100 bar and 400 bar in a reactor vessel at a reaction temperature and pressure suitable for conversion of all or a portion of the organic matter feedstock into a product mixture comprising the bio-product; and
depressurising and cooling the product mixture;
wherein the solid substrate constitutes between 5% and 15% of a total combined mass of the solid substrate and organic matter feedstock in the reaction mixture prior to said treating;
the solid substrate is solid or substantially solid at the reaction temperature and pressure;
the solid substrate is chemically inert or substantially chemically inert at the reaction temperature and pressure;
the solid substrate sequesters organic and/or inorganic matter that de-solubilises within the reaction mixture or the product mixture; and/or
alters one or more flow characteristics of the reaction mixture and/or the product mixture in the reactor vessel, and
the solid substrate is:
(a) selected from the group consisting of: anthracitic coal, metaanthracite, anthracite, activated carbon, semianthracite, coking coal, coal char, coke, high temperature coke, foundry coke, low and medium temperature coke, pitch coke, petroleum coke, coke oven coke, coke breeze, gas coke, brown coal coke, semi coke, charcoal, pyrolysis char, hydrothermal char, carbon black, graphite fine particles, amorphous carbon, carbon nanotubes, carbon nanofibers, vapor-grown carbon fibers, and any combination thereof; or
(b) selected from the group consisting of ash, fly ash, a mineral, calcium carbonate, calcite, a silicate, silica, quartz, an oxide, a metal oxide, an insoluble or substantially insoluble metal salt, iron ore, a clay mineral, talc, gypsum, carbonates of magnesium, carbonates of calcium and magnesium, limestone, dolomite, hydroxides of calcium, hydroxides of magnesium, oxides of calcium, oxides of magnesium, hydrogen carbonates of calcium, hydrogen carbonates of magnesium, kaolinite, bentonite, illite, zeolites, calcium phosphate, hydroxyapataite, phyllosilicates, and any combination thereof.
US Pat. No. 10,428,156

ANTI-MFI2 ANTIBODIES AND METHODS OF USE

Abbvie Stemcentrx LLC, N...

1. A humanized antibody that binds to a human MFI2 protein and comprises a light chain variable region and a heavy chain variable region, wherein the antibody comprises:(a) three complementarity determining regions of a light chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 99 and three complementarity determining regions of a heavy chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 101;
(b) three complementarity determining regions of a light chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 105 and three complementarity determining regions of a heavy chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 107;
(c) three complementarity determining regions of a light chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 93 and three complementarity determining regions of a heavy chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 95; or
(d) three complementarity determining regions of a light chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 93 and three complementarity determining regions of a heavy chain variable region comprising an amino acid sequence set forth as SEQ ID NO: 97.
US Pat. No. 10,426,621

IMPLANTABLE COMPOSITE CONTAINING CARBONATED HYDROXYAPATITE

WARSAW ORTHOPEDIC, INC., ...

1. An implantable composite comprising a plurality of resorbable ceramic particles, the resorbable ceramic particles comprising mixed AB type carbonated hydroxyapatite and tricalcium phosphate in a ratio from about 5:95 to about 70:30.
US Pat. No. 10,427,389

RESIN COMPOSITION AND MULTILAYER STRUCTURE USING SAME

MITSUBISHI CHEMICAL CORPO...

1. A resin composition comprising:(A) a base resin consisting of a thermoplastic resin other than a saponified ethylene-vinyl ester-based copolymer; and
(B) a hydrate-forming alkaline earth metal salt satisfying the water absorption properties shown below:
(?) a ratio of X5:Y from 0.2:1 to 2.0:1, wherein X5 is an amount of water absorption for 5 days per 100g of the alkaline earth metal salt (B) when being placed for 5 days under a condition of 40° C. and 90% relative humidity, and Y is a content of crystallization water in maximum hydrate of the alkaline earth metal salt (B); and
(?) a local maximum point exists in the amount of water absorption when the hydrate-forming alkaline earth metal salt (B) is placed under the condition of 40° C. and 90% relative humidity.
US Pat. No. 10,428,157

DOSING REGIMENS FOR USE WITH PCSK9 INHIBITORS

SANOFI BIOTECHNOLOGY, Pa...

1. A method for reducing low-density lipoprotein cholesterol (LDL-C) in a subject in need thereof comprising:(a) selecting a subject with primary hypercholesterolemia who is not taking a statin; and
(b) administering to the subject a pharmaceutical composition comprising an anti-proprotein convertase subtilisin/kexin type 9 (anti-PCSK9) antibody or antigen-binding fragment thereof at a dose of about 150 mg every 4 weeks for at least 3 doses in the absence of a concomitant statin therapy, wherein the antibody or antigen-binding fragment thereof comprises the heavy and light chain complementarity determining regions (CDRs) of a heavy chain variable region/light chain variable region (HCVR/LCVR) amino acid sequence pair of SEQ ID NOs: 1/6,
thereby reducing the LDL-C in the subject.
US Pat. No. 10,428,413

HYDROPHOBIC ALLOY FILM AND MANUFACTURING METHOD THEREOF

Industrial Technology Res...

1. A hydrophobic alloy film, comprising:Ti, Zr, O, and at least one selected from the group consisting of Fe, Co, Ni, and Cr,
wherein a content of Ti is in a range of 40 at. % to 70 at. %, a content of Zr is in a range of 10 at. % to 40 at. %, a total content of at least one selected from the group consisting of Fe, Co, Ni, and Cr is in a range of 10 at. % to 30 at. %, a content of 0 is in a range of 10 at. % to 30 at. %, and
the hydrophobic alloy film has a quasicrystal structure and nanoparticles, wherein a particle size of the nanoparticles is in a range of 10 nm to 200 nm.
US Pat. No. 10,426,110

CANOLA INBRED RESTORER LINE CL2503899R

Agrigenetics, Inc., Indi...

1. A seed of canola designated CL2503899R, wherein a representative sample of seed of said cultivar was deposited under ATCC Accession No. PTA-123164.
US Pat. No. 10,427,390

MULTILAYER COMPOSITE COMPRISING A POLYESTER LAYER

Evonik Degussa GmbH, Ess...

1. A multilayer composite, comprising in the order listed:an outer layer of a moulding compound comprising at least 40 wt. % polymer components; wherein the polymer components consist of:
1) 60 to 99 parts by wt. of a partially aromatic copolyamide which contains monomer units which are obtained from
?) 41 to 90 mol % of a combination of hexamethylenediamine and terephthalic acid, and
?) 59 to 10 mol % of a combination of hexamethylenediamine and a linear aliphatic dicarboxylic acid having 8 to 19 carbon atoms;
wherein the mol % values relate to the sum of ?) and ?) and
wherein not more than 20% of the hexamethylenediamine is optionally replaced by the equivalent amount of another diamine, and/or
wherein not more than 20% of the terephthalic acid is optionally replaced by the equivalent amount of another aromatic dicarboxylic acid and/or 1,4-cyclohexanedicarboxylic acid, and/or
wherein not more than 20% of the repeating units containing hexamethylenediamine and linear aliphatic dicarboxylic acid is optionally replaced by the equivalent quantity of units obtained from a lactam/an ?-aminocarboxylic acid having 6 to 12 carbon atoms,
2) 40 to 1 parts by wt. of an olefinic copolymer, comprising:
from 35 to 94.9 wt %, of monomer units based on ethene,
from 5 to 65 wt %, of monomer units based on a 1-alkene having 4 to 8 carbon atoms, and
from 0.1 to 2.5 wt % of monomer units based on an aliphatically unsaturated dicarboxylic anhydride, as impact modifier;
an adhesion promoter layer;
an interlayer of a moulding compound comprising at least 60 wt. % of a thermoplastic polyester;
an adhesion promoter layer; and
an inner layer of a moulding compound comprising at least 40 wt. % polymer components; wherein the polymer components consist of:
1) 60 to 99 parts by wt. of a partially aromatic copolyamide which contains monomer units which are obtained from
?) 41 to 90 mol % of a combination of hexamethylenediamine and terephthalic acid, and
?) 59 to 10 mol % of a combination of hexamethylenediamine and a linear aliphatic dicarboxylic acid having 8 to 19 carbon atoms;
wherein the mol % values relate to the sum of ?) and ?) and
wherein not more than 20% of the hexamethylenediamine is optionally replaced by the equivalent amount of another diamine, and/or
wherein not more than 20% of the terephthalic acid is optionally replaced by the equivalent amount of another aromatic dicarboxylic acid and/or 1,4-cyclohexanedicarboxylic acid, and/or
wherein not more than 20% of the repeating units containing hexamethylenediamine and linear aliphatic dicarboxylic acid is optionally replaced by the equivalent quantity of units obtained from a lactam/an ?-aminocarboxylic acid having 6 to 12 carbon atoms,
2) 40 to 1 parts by wt. of an olefinic copolymer, comprising:
from 35 to 94.9 wt %, of monomer units based on ethene,
from 5 to 65 wt %, of monomer units based on a 1-alkene having 4 to 8 carbon atoms, and
from 0.1 to 2.5 wt % of monomer units based on an aliphatically unsaturated dicarboxylic anhydride, as impact modifier,
wherein the moulding compound of the outer layer and the moulding compound of the inner layer are the same.
US Pat. No. 10,428,158

COMPOSITIONS AND METHODS FOR TREATMENT OF DIABETIC MACULAR EDEMA

Dyax Corp., Lexington, M...

1. A method for treating a retinal disease in a subject, the method comprising:administering an effective amount of a composition comprising an antibody to a subject in need thereof, wherein
the antibody comprises:
a heavy chain variable region comprising a complementarity determining region (CDR) 1 set forth as HYIMM (SEQ ID NO: 5), a CDR2 set forth as GIYSSGGITVYADSVKG (SEQ ID NO: 6), and a CDR3 set forth as RRIGVPRRDEFDI (SEQ ID NO: 7); and
a light chain variable region comprising a CDR1 set forth as RASQSISSWLA (SEQ ID NO: 8), a CDR2 set forth as KASTLES (SEQ ID NO: 9), and a CDR3 set forth as QQYNTYWT (SEQ ID NO: 10);
wherein the retinal disease is selected from the group consisting of diabetic macular edema (DME), age-related macular degeneration (AMD), and retinal vein occlusion (RVO).
US Pat. No. 10,428,414

CARBURIZED COMPONENT

DAIDO STEEL CO., LTD., A...

1. A carburized part having a total amount of TiC, AlN and ZrC, which are precipitate particles, of 4.5×10?1° mole or less per 1 mm2 of grain boundary area of prior austenite grains after carburization, which is formed by processing a steel material into a shape of a part and performing a carburizing treatment on the steel material, the steel material having a composition consisting of, in terms of % by mass:0.10% to 0.30% of C;
0.01% to 0.49% of Si;
0.65% to 1.50% of Mn;
0.01% to 0.10% of S;
0.03% or less of P;
0.05% to 1.00% of Cu;
0.05% to 1.00% of Ni;
0.01% to 2.00% of Cr;
0.01% to 0.50% of Mo;
0.001% or less of Nb;
0.005% to 0.050% of s-Al;
0.005% to 0.030% of N; and
one or two elements selected from
0.001% to 0.150% of Ti and
0.001% to 0.300% of Zr,
and optionally:
0.001% to 0.010% of B,
with the remainder being Fe and inevitable impurities,
wherein
[Ti], [Zr] and [N] which respectively represent contents of Ti, Zr, and N, in mole/g, satisfy the following equation (1):
|[Ti]/47.9+[Zr]/91.2?[N]/14|/100?3.5×10?6 mole/g  Equation (1);
wherein at least one element selected from Ti and Zr combines with N included in the steel at the time of forging of the steel, and crystallizes in a form of at least one of TiN and ZrN having no contribution to a pinning of crystal grain boundaries to prevent AlN having a pinning action from being precipitated, and
a structure thereof after the carburization is a well-ordered grain structure having a uniform crystal grain size in which an average crystal grain size of the prior austenite grain is greater than 3 and 7.5 or less, and a crystal grain size difference of the prior austenite grains is 6 or less.
US Pat. No. 10,426,111

LOW PALMITIC ACID COTTON LINES

TEXAS TECH UNIVERSITY SYS...

1. A cotton seed of a cotton line, wherein the cotton line is AFIS 1-136-A5, a seed sample of said cotton line having been deposited in ATCC Accession No. PTA-126033, and wherein the cotton seed comprises low palmitic acid content.
US Pat. No. 10,427,391

FORMULATION FOR PREPARING A POLYURETHANE FOAM

Dow Quimica Mexicana S.A....

1. A formulation for preparing a polyurethane foam comprising:(a) a polyol composition comprising:
(a1) from 10 to 23 wt % of a first polyoxypropylene polyol having a functionality of from 2 to 3.8 and an equivalent weight of from 85 to 2000;
(a2) from 3 to 15 wt % of a second polyoxypropylene polyol having a functionality of from 4.5 to 8 and an equivalent weight of from 100 to 175;
(a3) from 30 to 60 wt % of an ethylene oxide-capped polyether polyol having an equivalent weight of from 70 to 2500 and an oxyethylene content of from 10 to 25 wt %;
(a4) from 5 to 40 wt % of a copolymer polyol;
(a5) a latent catalyst; and
(a6) water; and
(b) an isocyanate-terminated prepolymer composition, with an isocyanate content of from 10 to 48 wt % based on the total weight of the prepolymer composition, comprising the reaction product of (b1) diphenylmethane diisocyanate, (b2) carbodiimide-modified diphenylmethane diisocyanate, (b3) polymethylene polyphenylisocyanate, and (b4) a third polyether polyol.
US Pat. No. 10,426,112

SINGLE NUCLEOTIDE POLYMORPHISM (SNP) MARKERS FOR PHASEOLUS VULGARIS L. AND METHODS OF USE THEREOF IN SELECTION EFFICIENCY WITH BREEDING STRATEGIES

Oregon State University, ...

1. A method for producing a common bean plant with enhanced flavor traits, the enhanced flavor traits comprising phenotypic expression of volatile compound 1-penten-3-ol, the method comprising,providing a first common bean plant having a single nucleotide polymorphism (SNP) identified as SNP 8 having a G or A nucleotide at a position that corresponds to position 29 of SEQ ID NO: 8;
providing a second common bean plant that does not have a single nucleotide polymorphism (SNP) that corresponds with expression by the first common bean plant of SNP 8;
crossing the first common bean plant with the second common bean plant to produce an F1 generation; and
identifying one or more members of the F1 generation for presence of SNP 8.
US Pat. No. 10,427,136

CATALYST FOR ALKYLATION OF POLYALKYLENE GLYCOL AND ALKYLATION METHOD USING THE SAME

NH CHEMICALS, Ulsan (KR)...

1. A method of preparing a catalyst for alkylating a terminal of polyalkylene glycol, comprising:(a-1) adding a precipitant to a first alumina precursor aqueous solution, thus forming aluminium hydroxide;
(a-2) mixing a second alumina precursor aqueous solution and a phosphate precursor and then adding a precipitant, thus forming aluminum phosphate hydroxide;
(a-3) mixing the aluminium hydroxide of (a-1) with the aluminum phosphate hydroxide of (a-2) to form a hydroxide mixture, which is then added with a precipitant, thus forming an alumina-aluminum phosphate-mixed hydroxide; and
(b) drying and then calcining the alumina-aluminum phosphate-mixed hydroxide.
US Pat. No. 10,426,113

TOMATO LINE FIR-9R14-6153

Seminis Vegetable Seeds, ...

1. A tomato plant comprising at least a first set of the chromosomes of tomato line FIR-9R14-6153, a sample of seed of said line having been deposited under ATCC Accession Number PTA-122979.
US Pat. No. 10,426,369

DEVICE AND METHOD FOR LOCALIZATION OF BRAIN FUNCTION RELATED APPLICATIONS

1. A system for displaying an animated simulation of neurological activity of a system user comprising:a) a user-computer having an input device and display;
b) a system server having a system processor and system storage memory;
c) a network connection between the user computer and the system server;
d) a neurological database in the system storage memory;
e) said neurological database containing at least one user-condition datum stored in a relation to at least one affected nervous system portion datum;
f) at least one operating instruction in said system storage memory for the system server to receive from said user-computer over said network connection a user-condition input;
g) at least one operating instruction in said system storage memory for the system server to receive from said user-computer over said network connection a user-photograph;
h) at least one operating instruction in said system storage memory for determining from a correlation of said user-condition input and said at least one user-condition datum in said neurological database a related user-affected nervous system portion; and
i) at least one operating instruction in said system storage memory for the system server to transmit to said user-computer display over said network connection an animated image that comprises a combination of said related user-affected nervous system portion and at least a portion of said user-photograph.
US Pat. No. 10,427,137

EXHAUST TREATMENT CATALYSTS WITH ENHANCED HYDROTHERMAL STABILITY AND LOW-TEMPERATURE ACTIVITY

UT-Battelle, LLC, Oakrid...

1. A catalyst for treating fuel combustion exhaust, the catalyst comprising the following components:(i) an oxide inner core comprising silicon oxide, aluminum oxide, or a combination of silicon oxide and aluminum oxide;
(ii) an outer layer comprising nanoparticles or an amorphous shell of cerium oxide, zirconium oxide, or a combination of cerium oxide and zirconium oxide as a coating on said oxide inner core; and
(iii) nanoparticles comprising elemental palladium or platinum in contact with at least component (ii), wherein said nanoparticles comprising palladium or platinum are present in an amount of 0.1-4 wt. % by weight of the catalyst, and wherein surfaces of said nanoparticles comprising elemental palladium or platinum are exposed.
US Pat. No. 10,428,161

METHOD FOR PRODUCING MODIFIED SOLUTION-POLYMERIZED DIENE RUBBER TO BE BLENDED WITH SILICA, AND RUBBER COMPOSITION CONTAINING SAME

ERIC Inc., Tokyo (JP)

1. A method for producing a modified solution polymerized diene rubber, comprising:i) initiating polymerization of a conjugated diene compound and an aromatic vinyl compound in a hydrocarbon by an organolithium compound or in the co-presence of a secondary amine compound;
ii) after completion of the polymerization, adding a tin compound of formula (1) to treat the diene rubber so that the content of three or more branched component is 5 to 30%;
iii) adding the silane compound of formula (2), whereby the content of two-branched component of the diene rubber is less than 30%; and
iv) steam coagulating and drying the obtained polymer composition, so that the content of two or more branched component increases by 10 to 50% with respect to the state before steam coagulation, and wherein the modified solution polymerized diene rubber is thermally stabilized to the extent that the Mooney viscosity (a) of the rubber measured after said coagulation and drying, varies by not more than 10 from the Mooney viscosity (b) of the rubber measured when it is further heat-treated for 20 minutes with a subsequent 130° C. roll mill,
[Formula 1]
(R1)n—Sn—(X)4-n  Formula (1)wherein R1 is an alkyl group, an allyl group or aromatic group, wherein a carbon number of R1 is 1 to 12 carbon atoms, X is a halogen compound of iodine, bromine or chlorine, n is an integer of 0 or 1,[Formula 2]
(R2O)n—Si—(R3)4-m  Formula (2)
wherein R2 is an alkyl group, an allyl group or an aromatic group, wherein a carbon number of R2 is 1 to 12, or an alkyl group, an aromatic group or an allyl group containing a nitrogen atom in these functional groups, R3 is a an alkyl group, an allyl group or aromatic group, wherein a carbon number of R3 is 1-12, or an alkyl group, an aromatic group or allyl group, containing an oxygen atom and/or a nitrogen atom in these functional groups, m is an integer of 2 to 4.
US Pat. No. 10,426,114

PLANTS AND SEEDS OF HYBRID CORN VARIETY CH871134

Monsanto Technology LLC, ...

1. A seed produced by crossing a hybrid plant having varieties CV483519 and CV995128 as parents with a plant of variety CV744222, wherein representative seeds of said varieties CV483519, CV995128, and CV744222 are deposited under ATCC Accession Nos. PTA-12082, PTA-11307, and PTA-124496, respectively.
US Pat. No. 10,428,162

HYDROGENATION CATALYST AND PROCESS FOR PRODUCING OLEFIN POLYMER

SUMITOMO CHEMICAL COMPANY...

1. A process for producing an olefin polymer, the process comprising:a prepolymerization step; and
after the prepolymerization step, two or more olefin polymerization steps different in olefin polymerization conditions;
wherein the prepolymerization step includes prepolymerizing an olefin in the presence of the undermentioned component (D);
wherein the polymerization steps include polymerizing an olefin in the presence of hydrogen and the undermentioned component (D), and includes a step of adding the undermentioned component (A) and a step of adding the undermentioned component (B) into a polymerization reaction system in any one or more of the second and subsequent olefin polymerization steps,
wherein a hydrogen content in the polymerization reaction system, after the step of adding the component (A) and the step of adding the component (B), is lower than a hydrogen content in the polymerization reaction system in a precedent olefin polymerization step:
component (A): a titanocene compound,
component (B): a silicon compound represented by the undermentioned general formula [1]:
Si(OR1)4  [1]
wherein, in formula [1], R1 stands for a hydrocarbon group having 1 to 20 carbon atoms, and the four R1 may be same or different respectively, and
component (D): a catalyst for olefin polymerization formed by contacting the undermentioned component (a), the undermentioned component (b), and the undermentioned component (c):
component (a): a solid component containing titanium, magnesium and a halogen,
component (b): an alkyl aluminum compound, and
component (c): a silicon compound represented by the following general formula [2]:
R2rSi(OR3)4-r  [2]
wherein, in formula [2], R2 stands for hydrogen atom, a hydrocarbon group having 1 to 20 carbon atoms, or a hetero atom-containing group, R3 stands for a hydrocarbon group having 1 to 20 carbon atoms, and r stands for an integer of 1 to 3, and when plural R2 are present, plural R2 may be respectively same or different, and when plural R3 are present, plural R3 may be respectively same or different.
US Pat. No. 10,426,115

WHEAT CULTIVAR FA9S10-0049R

Monsanto Technology LLC, ...

1. A plant of wheat cultivar FA9S10-0049R, wherein a sample of seed of said cultivar has been deposited under ATCC Accession No. PTA-124241.
US Pat. No. 10,427,139

METHOD FOR PRODUCING AMMOXIDATION CATALYST, AND METHOD FOR PRODUCING ACRYLONITRILE

ASAHI KASEI KABUSHIKI KAI...

1. A method for producing an ammoxidation catalyst, comprising:a step of preparing a precursor slurry that is a precursor of the catalyst;
a drying step of obtaining a dry particle from the precursor slurry; and
a calcination step of calcining the dry particle, wherein
the step of preparing the precursor slurry is a step of mixing a first solution or slurry having a first pH and a second solution or slurry to obtain a solution or slurry having a second pH after completion of mixing,
a time during which a pH of a mixture passes through a particular range having an upper limit and a lower limit while the second solution or slurry is mixed is 1-70 seconds, the upper limit and the lower limit being designated as a third pH and a fourth pH respectively, and
the third pH and the fourth pH are set between the first pH and the second pH.
US Pat. No. 10,426,118

BRASSICA PLANT COMPRISING A MUTANT INDEHISCENT ALLELE

BASF AGRICULTURAL SOLUTIO...

1. A Brassica plant, or a cell, part, seed or progeny thereof, comprising at least two INDEHISCENT (IND) genes and comprising three full knock-out mutant IND alleles in its genome, wherein said full knock-out mutant IND alleles are mutant alleles of a gene encoding a functional IND protein comprising a nucleic acid that:(a) has at least 95% sequence identity to the nucleic acid sequence of SEQ ID NO: 1, SEQ ID NO: 3 from the nucleotide at position 46 to the nucleotide at position 633, SEQ ID NO: 3, SEQ ID NO: 5, or SEQ ID NO: 7; or
(b) encodes an amino acid with at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 4 from the amino acid at position 16 to the amino acid at position 21 or SEQ ID NO: 4, and
wherein said full knock-out mutant IND alleles comprise a mutated DNA region comprising one or more inserted, deleted, or substituted nucleotides compared to a corresponding wild-type DNA region in the functional IND gene, and
wherein said full knock-out mutant IND alleles are:
(a) a mutant IND allele comprising a mutation resulting in the production of a non-functional IND protein or resulting in no production of an IND protein,
(b) a mutant IND allele encoding a truncated IND protein of which at least the Helix-Loop-Helix domain at positions corresponding to positions 132 to 174 of SEQ ID NO: 10 are lacking or substituted; and/or
(c) a mutant IND allele with a missense mutation of the codon encoding the amino acid at a position co-responding to position 128 of SEQ ID NO: 10.
US Pat. No. 10,427,142

METHODS FOR SYNTHESIZING HIERARCHICAL ZEOLITES FOR CATALYTIC CRACKING

KING FAHD UNIVERSITY OF P...

1. A method of catalytic cracking of a hydrocarbon-containing feedstock to catalytic cracking conversion products, the method comprising:providing, to a catalytic cracking process, a hierarchical zeolite composition prepared by:
subjecting an initial zeolite and a zirconium source to a partial isomorphous substitution process to produce a zirconium-substituted zeolite;
subjecting the zirconium-substituted zeolite to a framework modification process using a single template to produce a framework-modified zeolite; and
subjecting the framework-modified zeolite to an ion exchange process to produce a hierarchical pore structure in at least a portion of the framework-modified zeolite, resulting in the hierarchical zeolite composition; and
contacting a hydrocarbon-containing feedstock with the hierarchical zeolite composition at catalytic cracking conditions to produce catalytic cracking conversion products.
US Pat. No. 10,428,166

ARTICLES HAVING IMPROVED CLARITY, PREPARED FROM PROPYLENE-ETHYLENE COPOLYMERS

FINA TECHNOLOGY, INC., H...

1. A process comprising:supplying an isotactic propylene-ethylene random copolymer resin having an ethylene content of from about 0.5 to about 3 percent by total weight of the isotactic propylene-ethylene random copolymer, a melt flow rate of from about 0.1 g/10 min to about 150 g/10 min as determined by ASTM D-1238, Procedure B, and a xylene solubles content of less than about 2 percent by total weight of the isotactic propylene-ethylene random copolymer; and
injection molding the isotactic propylene-ethylene random copolymer resin to form an injection molded article, wherein the injection molded article exhibits a haze of less than about 20 percent, as determined by ASTM D1003, at a thickness of about 0.08 inch (2.03 mm).
US Pat. No. 10,426,119

MAIZE INBRED PH2SYN

PIONEER HI-BRED INTERNATI...

1. A seed, plant, plant part, or plant cell of inbred maize variety PH2SYN, representative seed of the variety having been deposited under ATCC accession number PTA-124791.
US Pat. No. 10,427,144

HIGH CHARGE DENSITY METALLOALUMINOPHOSPHOSILICATE MOLECULAR SIEVES MEAPSO-83

UOP LLC, Des Plaines, IL...


US Pat. No. 10,426,121

MAIZE HYBRID X18M726

PIONEER HI-BRED INTERNATI...

1. A seed of hybrid maize variety X18M726, representative seed produced by crossing a first plant of variety PH40V9 with a second plant of variety PH40W3, wherein representative seed of the varieties PH40V9 and PH40W3 have been deposited under ATCC Accession Numbers PTA-124801 and PTA-124806, respectively.
US Pat. No. 10,427,145

HIGH CHARGE DENSITY METALLOALUMINOPHOSPHOSILICATE MOLECULAR SIEVES MEAPSO-82

UOP LLC, Des Plaines, IL...


US Pat. No. 10,426,122

PLANTS AND SEEDS OF HYBRID CORN VARIETY CH406580

Monsanto Technology LLC, ...

1. A seed of hybrid corn variety CH406580, produced by crossing a first plant of variety CV038252 with a second plant of variety CV093813, wherein representative seeds of said varieties CV038252 and CV093813 are deposited under ATCC Accession Nos. PTA-11780 and PTA-123818, respectively.
US Pat. No. 10,427,146

IMMOBILIZED METATHESIS TUNGSTEN OXO ALKYLIDENE CATALYSTS AND USE THEREOF IN OLEFIN METATHESIS

1. A tungsten catalyst comprising (?SiO)XW(?O)(?(CR1R2)(R3 or R4)2-x(L)z, wherein (?SiO)X is comprised in a solid support, wherein each of R1 and R2 is independently R, —OR, —SR, —N(R)2, —OC(O)R, —SOR, —SO2R1, —SO2N(R)2, C(O)N(R)2, —NRC(O)R, or —NRSO2R;each R is independently hydrogen or an optionally substituted group selected from C1-20 aliphatic, C1-20 heteroaliphatic having 1-3 heteroatoms independently selected from nitrogen, oxygen, or sulfur, phenyl, ferrocene, a 3-7 membered saturated or partially unsaturated carbocyclic ring, an 8-10 membered bicyclic saturated, partially unsaturated or aryl ring, a 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 4-7membered saturated or partially unsaturated heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 7-10 membered bicyclic saturated or partially unsaturated heterocyclic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaryl ring having 1-5 heteroatoms in- dependently selected from nitrogen, oxygen, or sulfur, or:
two R groups on the same nitrogen atom are taken together with the nitrogen to form an optionally substituted 3-12 membered saturated, partially unsaturated, or aryl ring having 0-5 additional heteroatoms not including the same nitrogen atom independently selected from nitrogen, oxygen, or sulfur; or:
two R groups on the same oxygen atom are taken together with the oxygen to form an optionally substituted 3-12 membered saturated, partially unsaturated, or aryl ring having 0-5 additional heteroatoms not including the same oxygen atom independently selected from nitrogen, oxygen, or sulfur;
R3 and R4 have independently the same meaning as R1 and R2; or tris(C1-20 alkyl)silyl, tris(C1-20 alkyl)silyloxy, tris(C1-20 alkoxy)silyl, tris(C1-20 alkoxy)silyloxy, tris(aryl)silyl, tris(aryl)silyloxy, tris(aryloxy)silyl, or tris(aryloxy)silyloxy; and
wherein x=1 or 2;
z=0, 1 or 2 or a number between 0 and 2;
and L is a neutral ligand.
US Pat. No. 10,428,170

HYDROCARBON BLOWN POLYURETHANE FOAM FORMULATION GIVING DESIRABLE THERMAL INSULATION PROPERTIES

HUNTSMAN INTERNATIONAL LL...

1. A composition comprising:an organic polyisocyanate;
an isocyanate reactive material containing at least about 20% by weight, based on the total weight of the composition, of an aromatic polyester polyol;
a hydrocarbon blowing agent;
a first catalyst selected from the group consisting of a carboxylate salt of an alkali metal, a carboxylate salt of an alkaline earth metal, a carboxylate salt of a quaternary ammonium compound, and combinations thereof; and
a tertiary amine selected from the group consisting of a trialkylamine, an alkyl amine, an alkylaryl amine, an aliphatic polyamine, diazabicyclooctane, 1,4-ethylene piperidine, N-methylimidazole, 1,2-dimethylimidazole, 1,8-diazabicyclo(5,4,0)undecene-7, an ether amine, a saturated heterocyclic amine, and a combination thereof and
wherein a molar ratio of the first catalyst to the tertiary amine is less than about 1.0, the tertiary amine is present in an amount of at least 4.0 millimoles per 100 grams of the composition to 9.46 millimoles per 100 grams of the composition, and the composition has an isocyanate index of about 200 to 500.
US Pat. No. 10,427,147

SMALL CRYSTAL, HIGH SURFACE AREA EMM-30 ZEOLITES, THEIR SYNTHESIS AND USE

EXXONMOBIL RESEARCH AND E...

8. A process for producing a crystalline material having the MFI and/or MEL framework-type, the process comprising:(i) preparing a synthesis mixture capable of forming said crystalline material, said mixture comprising a source of an oxide of a tetravalent element Y, optionally a source of a trivalent element X, optionally a source of an alkali or alkaline earth metal (M), water, and a directing agent (Q2) comprising 1,5-bis(N-tributylammonium)pentane dications, and/or 1,6-bis(N-tributylammonium)hexane dications;
(ii) heating the mixture under crystallization conditions including a temperature from 80° C. to 220° C. and a time from about 4 hours to about 28 days until crystals of the crystalline material are formed; and
(iii) recovering the crystalline material from step (ii).
US Pat. No. 10,426,124

SOYBEAN CULTIVAR 179565921658

SGI GENETICS, INC., St. ...

1. A seed of soybean cultivar 179565921658, wherein a sample of seed of soybean cultivar 179565921658 is deposited under NCIMB No. 43419.
US Pat. No. 10,428,172

REACTIVE POLYURETHANE ADHESIVE COMPOSITION, POLYURETHANE PREPOLYMER, AND FLEXIBLE LAMINATES INCLUDING THE SAME

H.B. Fuller Company, St....

1. A polyurethane adhesive composition comprising:a polyurethane prepolymer comprising the reaction product of
a first polyol component comprising
glycerol monostearate, and
a hydroxy functional triglyceride, and
polyisocyanate; and
a second polyol.
US Pat. No. 10,426,125

SOYBEAN CULTIVAR 179609121658

SGI GENETICS, INC., St. ...

1. A seed of soybean cultivar 179609121658, wherein a sample of seed of soybean cultivar 179609121658 is deposited under NCIMB No. 43418.
US Pat. No. 10,428,173

HIGH STRENGTH POLYURETHANE FOAM COMPOSITIONS AND METHODS

1. A method for increasing the strength of a polyurethane foam composition, the foam composition comprising the reaction product of a polyol component and a polyisocyanate component, the method comprising the step of incorporating into the polyol component a polycarbonate polyol derived from the copolymerization of one or more epoxides and carbon dioxide, wherein the polycarbonate polyol is added in a quantity from about 2 weight percent to about 50 weight percent, from about 5 weight percent to about 25 weight percent, from about 2 weight percent to about 10 weight percent, from about 10 weight percent to about 20 weight percent, from about 20 weight percent to about 30 weight percent, or from about 30 weight percent to about 50 weight percent of all polyols present in the polyol component;wherein a tear strength value measured by ASTM D 3574-08 of the foam composition comprising the added polycarbonate polyol is greater than the tear strength value of a corresponding foam composition formulated without the added polycarbonate polyol.
US Pat. No. 10,428,429

FORMULATION AND METHOD FOR INHIBITING CARBON-BASED DEPOSITS

AGENCY FOR SCIENCE, TECHN...

1. A formulation for inhibiting carbon-based deposits on a metal substrate, the formulation comprising at least one oxidizing agent and at least one etchant to form free metal ions from the metal substrate, at least one sequestering agent having a ligand selected to form a complex with the free metal ions and at least one chelating agent having a ligand selected to complex with at least one surface metal atom, wherein the at least one etchant comprises 50 to 70 wt % of the formulation, based on the weight of the formulation, the at least one etchant being an acid selected from the group consisting of hydrochloric acid, sulfuric acid, nitric acid, trifluoromethanesulfonic acid, fluorosulfuric acid, trichloroacetic acid, trifluoroacetic acid and combination thereof, and wherein the at least one sequestering agent comprises 20 to 25 wt % of the formulation, based on the weight of the formulation.
US Pat. No. 10,431,248

MAGNETIC TAPE HAVING CHARACTERIZED MAGNETIC LAYER AND MAGNETIC TAPE DEVICE

FUJIFILM Corporation, To...

1. A magnetic tape comprising:a non-magnetic layer including non-magnetic powder and a binder on a non-magnetic support; and
a magnetic layer including ferromagnetic powder and a binder on the non-magnetic layer,
wherein the magnetic layer includes a timing-based servo pattern,
a center line average surface roughness Ra measured regarding a surface of the magnetic layer is equal to or smaller than 1.8 nm,
one or more components selected from the group consisting of fatty acid and fatty acid amide are at least included in the magnetic layer, and
a C—H derived C concentration calculated from a C—H peak area ratio of C1s spectra obtained by X-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %.
US Pat. No. 10,426,126

GARDEN BEAN NAMED HMX5107

HM.CLAUSE, INC., Davis, ...

1. A seed of bean cultivar designated HMX5107, wherein a representative sample of seed of said cultivar has been deposited under NCIMB No. 43120.
US Pat. No. 10,431,249

MAGNETIC TAPE HAVING CHARACTERIZED MAGNETIC LAYER AND MAGNETIC TAPE DEVICE

FUJIFILM Corporation, To...

1. A magnetic tape comprising:a non-magnetic support; and
a magnetic layer including ferromagnetic powder and a binder on the non-magnetic support,
wherein a total thickness of the magnetic tape is equal to or smaller than 5.30 ?m,
the magnetic layer includes a timing-based servo pattern,
a center line average surface roughness Ra measured regarding a surface of the magnetic layer is equal to or smaller than 1.8 nm,
one or more components selected from the group consisting of fatty acid and fatty acid amide are included in the magnetic layer, and
a C—H derived C concentration calculated from a C—H peak area ratio of C1s spectra obtained by X-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %.
US Pat. No. 10,428,175

TOUGHENING OF EPOXY THERMOSETS

Drexel University, Phila...

18. A composite as claimed in claim 16 comprising one or more additives selected from colorants, pigments, carbon black, impact modifiers, antioxidants, stabilizers, flame retardants, reheating aids, crystallization aids, oxygen scavengers, plasticizers, flexibilizers, nucleating agents, foaming agents, and mold release agents.
US Pat. No. 10,428,178

POLYESTER RESIN FOR TONER, METHOD FOR PRODUCING POLYESTER RESIN FOR TONER, AND TONER

Mitsubishi Chemical Corpo...

1. A polyester resin, comprising:40 mol % or more and 60 mol % or less of structural units derived from tri- or higher hydric carboxylic acid based on 100 mol % of structural units derived from all acid components, and
144 parts by mol or more and 182 parts by mol or less of structural units derived from all alcohol components based on 100 parts by mol of structural units derived from all acid components,
wherein
a softening temperature of the polyester resin is 125° C. or lower, and
a content of a metal in the polyester resin is 100 ppm or less.
US Pat. No. 10,428,434

ADDITIVE FOR HIGH-PURITY COPPER ELECTROLYTIC REFINING, METHOD OF PRODUCING HIGH-PURITY COPPER, AND HIGH-PURITY ELECTROLYTIC COPPER

MITSUBISHI MATERIALS CORP...

1. An additive for high-purity copper electrolytic refining which is an additive to be added to a copper electrolyte in copper electrolytic refining, the additive comprising:a silver and chlorine reducing agent of electrolytic copper which is formed of one of tetrazoles selected from a tetrazole and a tetrazole derivative,
wherein the additive further comprises a stress relaxation agent formed of a polyvinyl alcohol or a derivative thereof,
the polyvinyl alcohol or the derivative thereof in the stress relaxation agent has a saponification rate of 70 to 99% by mole and an average polymerization degree of 200 to 2500, and
the tetrazole derivative is one of an alkyl derivative, an amino derivative, and a phenyl derivative of tetrazole.
US Pat. No. 10,426,131

FRAGRANCE COMPOSITION

GIVAUDAN S.A., Vernier (...

1. A solid, free-flowing composition adapted to deliver fragrance or malodor counteractant in a consumer product that is subjected to actual or potential malodorous influences, the solid, free-flowing composition comprising:a delivery system consisting of a particulate core material surrounded by a fragranced material comprising microdroplets of a fragrance dispersed in a fragrance-encapsulating material, wherein the delivery system is formed by applying a fragranced material emulsion, comprising the microdroplets dispersed in the fragrance-encapsulating material, to the particulate core material such that the outer surface of the particulate core material is homogeneously exposed to the fragranced material emulsion,
optionally, surrounded by a protective coating,
and,
an external absorbent material in which the fragrance delivery system is dispersed.
US Pat. No. 10,428,180

POLYAMIDE RESIN AND MOLDED ARTICLE CONTAINING SAME

UBE INDUSTRIES, LTD., Ub...

1. A polyamide resin consisting of a unit derived from ?-caprolactam and/or ?-aminocaproic acid (to also be referred to as “Unit 1”), a unit derived from adipic acid (to also be referred to as “Unit 2”) and a unit derived from hexamethylenediamine (to also be referred to as “Unit 3”), wherein the concentration of terminal amino groups in the polyamide resin is greater than the concentration of terminal carboxyl groups in the polyamide resin, and the amount of Unit 1 is greater than 60% by weight to less than 80% by weight of the total amount of Unit 1, Unit 2 and Unit 3, and wherein the polyamide resin has the following features (1) and (2):(1) relative viscosity (?r) of the polyamide resin measured in 96% by weight of sulfuric acid under conditions of a polyamide concentration of 1% by weight and temperatures of 25° C. is 3.4 or more; and
(2) the concentration of terminal carboxyl groups in the polyamide resin is 2.00×10?5 eq/g to 3.00×10?5 eq/g, provided that the concentration of terminal amino groups in the polyamide resin is greater than the concentration of terminal carboxyl groups in the polyamide resin.
US Pat. No. 10,427,160

RAPID AND CONTINUOUS ANALYTE PROCESSING IN DROPLET MICROFLUIDIC DEVICES

The Research Foundation f...

1. A method of amplifying a target polynucleotide in a biological sample comprising:a) placing a single cell in an aqueous droplet;
b) lysing the single cell, thereby generating a cell lysate;
c) reacting the cell lysate with a tag attached to a bead, thereby binding the target polynucleotide to the tag;
d) moving the bead into a reaction zone or a container by using an electrical or magnetic field; and
e) amplifying the target polynucleotide.
US Pat. No. 10,428,186

MULTI-COMPONENT PARTICLES COMPRISING INORGANIC NANOPARTICLES DISTRIBUTED IN AN ORGANIC MATRIX AND PROCESSES FOR MAKING AND USING SAME

SICPA HOLDING SA, Prilly...

1. A process for making multi-component particles comprising inorganic nanoparticles distributed in an organic matrix, the process comprising the steps of:(a) generating an aerosol comprising droplets, wherein the droplets comprise a liquid vehicle, an inorganic nanoparticle precursor and an organic matrix precursor; and
(b) removing at least a portion of the liquid vehicle from the droplets under conditions effective to convert at least a portion of the organic matrix precursor to the organic matrix and to convert at least a portion of the inorganic nanoparticle precursor to the inorganic nanoparticles distributed in the organic matrix.
US Pat. No. 10,427,419

TEXTILE PRINTING METHOD, DYEING APPARATUS, TEXTILE PRINTING INK, AND TREATMENT INK

MIMAKI ENGINEERING CO., L...

1. A textile printing method, comprising:a dyeing step of discharging a textile printing ink from an inkjet head toward a fabric to apply the textile printing ink to the fabric; and
a treatment step of discharging a treatment ink from an inkjet head toward the fabric to apply the treatment ink to the fabric, the treatment step being performed at substantially the same time as the dyeing step,
the textile printing ink at least including a coloring material; an UV-curable compound polymerizable by ultraviolet light into a water-soluble, UV-curable resin; a readily water-soluble compound added to adjust solubility of the water-soluble, UV-curable resin; and a solvent containing moisture,
the treatment ink at least including the UV-curable compound; the readily water-soluble compound; the solvent; and an auxiliary added to facilitate a process to dye the fabric using the coloring material,
the dyeing step further comprising irradiating the textile printing ink applied to the fabric with ultraviolet light,
the treatment step further comprising irradiating the treatment ink applied to the fabric with ultraviolet light.
US Pat. No. 10,428,187

METHOD FOR PRODUCING MIXTURE

BRIDGESTONE CORPORATION, ...

1. A method for producing a mixture, comprising a mixing step for mixing a slurry prepared by dispersing a filler containing carbon black and a rubber liquid prepared by dispersing or dissolving a rubber component, wherein the carbon black contained in the slurry prepared by dispersing the filler containing carbon black has a surface average acidic functional group amount (?eq/m2) of 0.40 or more and less than 3.00; a pH of the slurry is 8 or more; the sum total of the solid matter concentrations of the slurry prepared by dispersing the filler containing carbon black and the rubber liquid prepared by dispersing or dissolving the rubber component is 20% by mass or less; a mixing equipment used in the mixing step has one or plural rotors disposed rotatably in a rotation axis direction and one or plural stators disposed unrotatably in the rotation axis direction; the rotors and the stators have plural projections which are arranged circularly with the rotation axis set as the center; rings are formed concentrically by the projections in a single stage or a multistage; the projections of the rotors and the stators are oppositely disposed so that they engage alternately; and the slurry and the rubber liquid in which the sum total of the solid matter concentrations thereof is 20% by mass or less are allowed to pass through a space between the rotors and the stators while the rotors rotate, whereby the mixing step is carried out.
US Pat. No. 10,428,188

METHOD FOR PRODUCING MASTER BATCH, MASTER BATCH OBTAINED BY SAID PRODUCTION METHOD, RUBBER COMPOSITION FOR TIRE, AND PNEUMATIC TIRE

SUMITOMO RUBBER INDUSTRIE...

1. A method for producing a masterbatch, the method comprising:mixing a rubber latex with microfibrillated plant fibers oxidized with an N-oxyl compound to obtain a mixture, and
coagulating the mixture by adjusting the mixture pH to 3 to 5 to produce the masterbatch,
wherein the masterbatch comprises 10 to 20 parts by mass of the microfibrillated plant fibers per 100 parts by mass of a rubber component in the masterbatch.
US Pat. No. 10,428,189

PROCESS AND COMPOSITION FOR WELL DISPERSED, HIGHLY LOADED COLOR MASTERBATCH

CHROMA COLOR CORPORATION,...

1. A process for making a masterbatch composition comprising:providing an additive mixture including a colorant and an optional additive component or components to a primary feed;
melting a thermoplastic and providing the melted thermoplastic to a secondary feed that is physically separated from the primary feed;
combining the secondary feed with the primary feed and extruding the resultant mixture to form a masterbatch composition having greater than 45 wt. % of the additive mixture; and
wherein, upon combining the primary and secondary feeds, a weight ratio of primary to secondary feed is greater than 60:40.
US Pat. No. 10,429,728

MASK BLANK SUBSTRATE, SUBSTRATE WITH MULTILAYER REFLECTION FILM, TRANSMISSIVE MASK BLANK, REFLECTIVE MASK BLANK, TRANSMISSIVE MASK, REFLECTIVE MASK, AND SEMICONDUCTOR DEVICE FABRICATION METHOD

HOYA CORPORATION, Tokyo ...

1. A production method of a mask blank substrate for use in lithography, the method comprising:surface-treating a main surface of the substrate so as to satisfy a relational equation of (BA70?BA30)/(BD70?BD30)?350 (%/nm) of the main surface of the substrate, and the main surface of the substrate having a maximum height (Rmax)?1.2 nm in a relation between a bearing area (%) and a bearing depth (nm) obtained by measuring, with an atomic force microscope, an area of 1 ?m×1 ?m in the main surface on a side of the substrate where a transfer pattern is formed, wherein BA30 is defined as a bearing area of 30%, BA70 is defined as a bearing area of 70%, and BD70 and BD30 are defined to respectively represent bearing depths for the bearing area of 30% and the bearing area of 70%; and
inspecting defects of the main surface of the substrate using inspection light having a wavelength region of 150 nm to 365 nm or inspection light having a wavelength region of 0.2 nm to 100 nm.
US Pat. No. 10,428,190

PROCESSES FOR DESIGNING CROSS-LINKABLE POLYCARBONATES AND ARTICLES FORMED THEREFROM

SABIC GLOBAL TECHNOLOGIES...

1. A process for preparing an article that has a high probability of passing UL94 V0 test, the process comprising:(A) providing a polymeric composition to be exposed to a dosage (D) of UVA radiation, wherein the polymeric composition comprises:
(i) a cross-linkable polycarbonate resin including repeating units derived from a dihydroxybenzophenone;
(ii) a flame retardant; and
(iii) optionally one or more polymeric base resins;
(iv) wherein the cross-linkable polycarbonate resin contains a molar percentage of the dihydroxybenzophenone (MOL %); and
(v) wherein the polymeric composition has:
(a) a molecular weight increase of polymeric components therein after exposure to UV radiation (MW_I in gram/mol)
(b) a melt flow rate (MF), MF being measured in cubic centimeter per 10 minutes according to ASTM D1238-13, 1.2 kg load, 300° C. temperature, 360 second dwell, and
(c) a weight percentage of the cross-linkable polycarbonate resin (WP);
(B) forming an article from the polymeric composition; and
(C) exposing the formed article to the dosage;wherein D, MOL %, MW_I, MF, and WP are determined based on a flame performance equation as follows:Sqrt(V0_Avg)=?0.62315+(9.21942×10?3×WP)+(0.041498×D)+(4.34876×10?5×MW_I)+(6.55546×10?3×MOL %)+(0.089017×MF)+(9.87122×10?4×WP×D)?(4.36994×10?6×WP×MW_I)?(2.43440×10?3×WP×MOL %)+(2.08870×10?3×WP×MF)?(4.40362×10?6×D×MW_I)?(2.32567×10?3×D×MOL %)?(3.75290×10?3×D×MF)+(2.05611×10?5×MW_I×MF)+(5.61409×10?3×MOL %×MF)+(2.98567×10?9×(MW_I)2)+(6.17229×10?3×(MOL %)2)?(0.017115×(MF)2)wherein the article has an average V0(V0_Avg) that is the average of:(i) the probability of a first time pass in a UL94 V0 test at a thickness of 1.2 mm after UV exposure measured after 2 days of aging at room temperature, and
(ii) the probability of a first time pass in a UL94 V0 test at a thickness of 1.2 mm after UV exposure measured after 7 days of aging at 70° C.; andwherein V0 _Avg is at least 0.7; andwherein D is measured in J/cm 2 of UVA radiation.
US Pat. No. 10,428,446

WOVEN FLAME-RESISTANT GARMENT FABRIC, AND GARMENT MADE THEREFROM

1. A woven flame-resistant garment fabric, the fabric comprising warp yarns that extend in a longitudinal or warp direction and fill yarns that extend in a width direction of the fabric, the warp and fill yarns comprising at least about 30 wt. % inherently flame-resistant fibers, the fabric being a single-layer fabric woven from a plurality of warp yarn groups consecutively arranged across the width direction in a recurring pattern, each warp yarn group consisting of a plurality of adjacent consecutively arranged warp yarns,wherein at least one warp yarn in each warp yarn group is woven with the fill yarns in a plain (1/1) weave and at least one warp yarn in each warp yarn group is woven with the fill yarns in one or more non-plain weaves each selected from the group consisting of 1/2, 2/1, 2/2, 1/3, and 3/1, and
wherein approximately half of the warp yarns in the fabric are woven with the fill yarns in a plain (1/1) weave and the remaining warp yarns in the fabric are woven with the fill yarns in said one or more non-plain weaves, in an alternating fashion.
US Pat. No. 10,428,191

CHITIN NANOWHISKER COMPOSITES AND METHODS

BOCO Technology Inc., To...

1. A product comprising a plurality of particles of polycarbonate substantially coated with a chitin nanowhisker gel.
US Pat. No. 10,426,146

NON-HUMAN ANIMALS HAVING A HUMANIZED SIGNAL-REGULATORY PROTEIN GENE

REGENERON PHARMACEUTICALS...

1. A rodent whose genome comprises a humanized SIRP? gene at an endogenous rodent SIRP? locus, wherein the humanized SIRP? gene(i) comprises exon 1 of a rodent SIRP? gene, exons 2, 3 and 4 of a human SIRP? gene, and exons 5, 6, 7 and 8 of the rodent SIRP? gene,
(ii) is operably linked to a rodent SIRP? promoter at the endogenous rodent SIRP? locus, and
(iii) expresses in the rodent a humanized SIRP? protein comprising an extracellular portion of the human SIRP? protein encoded by the human SIRP? gene and an intracellular portion of the rodent SIRP? protein encoded by the rodent SIRP? gene; and
wherein the rodent is a rat and is homozygous for the humanized SIRP? gene.
US Pat. No. 10,427,938

METHOD AND DEVICE FOR DETECTING CELLULAR TARGETS IN BODILY SOURCES USING CARBON NANOTUBE THIN FILM

UNIVERSITY OF LOUISVILLE ...

1. A method of fabricating a sensor for detecting cellular targets in a bodily source, the method comprising:forming a thin film of carbon nanotubes (CNT's) on a carrier using vacuum filtration;
mechanically bonding the thin film to a dielectric layer on a semiconductor substrate;
separating the thin film from the carrier;
patterning the thin film to form a biofunctional pad; and
depositing a plurality of conductive contacts on the substrate, with at least a portion of each conductive contact overlapping and electrically coupled to the thin film, wherein after forming the thin film, the method additionally comprises the step of altering a surface of the thin film or the biofunctional pad, to provide the biofunctional pad with a hydrophilic surface which lowers the density of the CNTs on the portion of the surface that was altered.
US Pat. No. 10,429,733

LOW TEMPERATURE BAKING ADAPTED RESIST INK

DIC GRAPHICS CORPORATION,...

1. A resist ink adaptable to low temperature baking, comprising a polyester resin, a titanium oxide, and an organic silicon compound,wherein the titanium oxide is contained in an amount of 2.5 to 30% by weight based on the total amount of the resist ink.
US Pat. No. 10,426,147

INSECT MUSCLE ACTIN PROMOTER

Oxitec Limited, Abingdon...

1. A polynucleotide expression system, comprising:a polynucleotide sequence encoding a fluorescent marker; and
an insect muscle actin promoter comprising a nucleic acid sequence that is at least 95% identical as the nucleic acid sequence set forth in SEQ ID NO: 1, 5, or 6, operably linked to the polynucleotide sequence.
US Pat. No. 10,428,196

CURABLE NANO-COMPOSITES FOR ADDITIVE MANUFACTURING

Schmutz IP, LLC, Lawrenc...

1. A curable liquid nano-composite for use with a jetable piezo head device for additive manufacturing of a semi-conductive component, the nano-composite comprising:one or more cross-linkable diacrylates and/or triacryclates present in an amount from about 10-50 wt % based upon the total weight of the nano-composite;
a photo-initiator; and
an organic nanoparticle,
wherein the curable liquid nano-composite is configured for use in said jetable piezo head device to produce said semi-conductive component.
US Pat. No. 10,429,736

METHOD OF MAKING A FLEXOGRAPHIC PRINTING PLATE

MacDermid Graphics Soluti...

1. A method of making a flexographic printing plate is provided, said method comprising:a) providing a liquid photocurable composition in a reservoir, wherein the photocurable composition comprises:
i) a binder resin;
ii) monomers;
iii) a photoinitiator; and
iv) a polymerization inhibitor;
wherein the reservoir contains a transparent bottom, and wherein actinic radiation is capable of shining through the transparent bottom; and
b) providing a carrier plate comprising a substrate and a cured layer of photopolymer on said substrate wherein the cured layer of photopolymer provides a surface on which a flexographic printing plate is formed, wherein the reservoir is below the carrier plate;
c) bringing the cured layer of photopolymer into contact with the liquid photocurable composition in the reservoir;
d) selectively providing actinic radiation beneath the transparent bottom of the reservoir in a pattern that corresponds to raised relief structures to be formed on the cured layer of photopolymer, wherein the radiation crosslinks and cures areas of the liquid photocurable composition in the reservoir;
e) moving the carrier plate away from the reservoir while the actinic radiation continuously crosslinks and cures the photocurable composition to form a flexographic printing plate, wherein raised features of the flexographic printing plate are formed on the cured layer of photopolymer on the carrier plate simultaneously as the carrier plate is withdrawn from the reservoir.
US Pat. No. 10,428,198

ULTRAVIOLET LIGHT ABSORBING MATRIX-MODIFIED LIGHT STABILIZING SILICA PARTICLES

International Business Ma...

1. A silica particle comprising:a silica matrix having an ultraviolet (UV) light absorbing material incorporated into the silica matrix; and
a light stabilizer material bonded to a surface of the silica matrix, the light stabilizer material comprising 4-(3-(dimethoxy(methyl)silyl)propoxy)-2,2,6,6-tetramethylpiperidine bonded to the surface of the silica matrix.
US Pat. No. 10,428,199

POLYESTER-ETHER RESIN BLENDS

Trevira Holdings GMBH, (...

1. A composition for blow-molding articles comprising:a) ?80-99.5 parts by weight of polyester;
b) a copolyester-ether, wherein the copolyester-ether comprises one or more polyether segments having a number-average molecular weight of between 200 to 5000 g/mol;
c) a transition metal-based oxidation catalyst, wherein the transition metal is selected from the group consisting of cobalt, manganese, copper, chromium, zinc, iron or nickel, and wherein the transition metal based oxidation catalyst is present in an amount of ?2000 to <6000 ppm, on basis of the weight of the transition metal in the composition;
d) an alkali metal compound, and
e) an alkaline earth metal compound;wherein the weight ratio of the transition metal-based oxidation catalyst to the alkaline earth metal compound, of the weight of the transition metal and the alkaline earth metal, is from 50:1 to 1:50, and the weight ratio of the alkali metal compound to the alkaline earth metal compound, on basis of the weight of the alkali metal and the alkaline earth metal, is from 20:1 to 1:20; and wherein the intrinsic viscosity of said composition is at least 0.4 dL/g.
US Pat. No. 10,428,455

PLASMA TREATMENTS FOR COLORATION OF TEXTILES, FIBERS AND OTHER SUBSTRATES

The North Face Apparel Co...

1. A method of treating a substrate, comprising:providing a substrate comprising a textile having a generally sheet or planar form or a substrate comprising a fiber or yarn form;
providing a colorant to be set at the surface of the substrate; and
at about atmospheric pressure, subjecting the substrate and the colorant to reactive species from a plasma generated by an atmospheric plasma apparatus until the colorant affixes to the substrate via chemical bonding to a desired color, wherein the energy of the plasma is sufficient to overcome bond energies to cause permanent bonding of the colorant on the substrate, without the substrate being immersed in a dye bath and without subjecting the substrate and colorant to a separate thermal fixation step, and wherein the affixing of the substrate provides a wash durable coating on the substrate and the change of color without negatively affecting the bulk properties of the substrate.
US Pat. No. 10,428,200

IMMOBILIZATION OF AN ACTIVE AGENT ON A SUBSTRATE USING COMPOUNDS INCLUDING TRIHYDROXYPHENYL GROUPS

Baxter International Inc....

1. A substrate having an active agent immobilized on a surface thereof, the substrate having a compound including a trihydroxyphenyl group coupled to the substrate surface, wherein the compound includes an active agent coupled thereto, such that the active agent is immobilized on the surface, and the compound including a trihydroxyphenyl group is selected from the group consisting of gallic acid, phloroglucinol carboxylic acid, gallamide, benzenetriol, 5-methyl-benzene-1,2,3-triol, 3,4,5-trihydroxybenzaldehyde, 2,3,4-trihydroxybenzaldehyde, gallacetophenone, 3,4,5-trihydroxybenzamide, 2,3,4-trihydroxybenzoic acid, 5-hydroxydopamine hydrochloride, methyl gallate, pyrogallol, salts of the foregoing, and combinations thereof.
US Pat. No. 10,427,945

ION SIEVE MATERIAL, AND METHODS OF PREPARING AND USING THE SAME

Shenzhen Donglihua Techno...

3. A method of using an ion sieve material, comprising the steps of:providing a molten liquid salt compound to be purified; and adding an ion sieve material to the molten liquid salt compound, and reacting at a temperature that is above the melting temperature of the liquid salt compound; and removing the ion sieve material after the concentration of the impurity metal ions to be purified in the molten liquid salt compound falls within a preset range; wherein the ion sieve material comprises, based on the weight of the ion sieve material, 15-55% by weight (wt %) of SiO2, 5-50 wt % of an auxiliary material, and 15-48 wt % of at least one functional metal oxide, wherein the metal in the functional metal oxide is a monovalent and/or divalent metal.
US Pat. No. 10,428,201

PLASTICIZER COMPOSITIONS AND METHODS FOR MAKING PLASTICIZER COMPOSITIONS

Dow Global Technologies L...

1. A plasticizer composition, comprising:an epoxidized fatty acid alkyl ester, wherein said epoxidized fatty acid alkyl ester has
(i) an APHA color value from at least 1 to less than 15;
(ii) a triepoxide content from at least 6.5 weight percent to less than 8 weight percent, based on the entire weight of said epoxidized fatty acid alkyl ester, wherein the triepoxide is an epoxidized C18 fatty acid alkyl ester molecule having three epoxide groups on its alkyl tail;
(iii) an oxirane oxygen content of at least 5 grams oxirane per 100 grams of epoxidized fatty acid alkyl ester;
(iv) a fatty acid dimer content greater than 0.8 weight percent based on the entire weight of said epoxidized fatty acid alkyl ester; and
(v) an iodine value from at least 1 gram to less than 5 grams per 100 grams of epoxidized fatty acid alkyl ester.
US Pat. No. 10,428,204

POLYOLEFIN COMPOSITIONS FOR BUILDING MATERIALS

BASF SE, Ludwigshafen (D...

1. An extruded article comprising a polyolefin substrate having incorporated therein one or more additives comprising:about 0.10 to about 2.5 weight percent, in total, of one or more ultraviolet light absorbers selected from the group consisting of hexadecyl 3,5-di-tert-butyl-4-hydroxybenzoate and 2,4-di-tert-butylphenyl 3,5-di-tert-butyl-4-hydroxybenzoate;
about 0.10 to about 1.9 weight percent, in total, of a binary or ternary hindered amine light stabilizer combination selected from the group consisting of:
(2) bis(2,2,6,6-tetramethylpiperidin-4-yl) sebacate and (45) oligomeric compound condensate of 4,4?-hexamethylenebis(amino-2,2,6,6-tetramethylpiperidine) and 2,4-dichloro-6-[(2,2,6,6-tetramethylpiperidin-4-yl)butylamino]-s-triazine end-capped with 2-chloro-4,6-bis(dibutylamino)-s-triazine;
(20) 2,2,6,6-tetramethylpiperidin-4-yl octadecanoate and a (45) oligomeric condensate of 4,4?-hexamethylenebis(amino-2,2,6,6-tetramethylpiperidine) and 2,4-dichloro-6-[(2,2,6,6-tetramethylpiperidin-4-yl)butylamino]-s-triazine end-capped with 2-chloro-4,6-bis(dibutylamino)-s-triazine;
(2) bis(2,2,6,6-tetramethylpiperidin-4-yl) sebacate and (20) 2,2,6,6-tetramethylpiperidin-4-yl octadecanoate;
(2) bis(2,2,6,6-tetramethylpiperidin-4-yl) sebacate, (14) 1-(2-hydroxy-2-methyl-propoxy)-4-octadecanoyloxy-2,2,6,6-tetramethylpiperidine and a (45) oligomeric condensate of 4,4?-hexamethylenebis(amino-2,2,6,6-tetra-methylpiperidine) and 2,4-dichloro-6-[(2,2,6,6-tetramethylpiperidin-4-yl)butylaminol-s-triazine end-capped with 2-chloro-4,6-bis(dibutylamino)-s-triazine; and
(14) 1-(2-hydroxy-2-methylpropoxy)-4-octadecanoyloxy-2,2,6,6-tetramethylpiperidine, (20) 2,2,6,6-tetramethylpiperidin-4-yl octadecanoate and a (45) oligomeric condensate of 4,4?-hexamethylenebis(amino-2,2,6,6-tetramethylpiperidine) and 2,4-dichloro-6-[(2,2,6,6-tetramethylpiperidin-4-yl)butylamino-s-triazine end-capped with 2-chloro-4,6-bis(dibutylamino)-s-triazine;
one or more additional additives selected from:
one or more antioxidants,
one or more colorants,
one or more flame retardants, or
one or more antimicrobial compounds;
wherein:
any two of the binary or ternary HALS combinations have a weight ratio from about 1:5 to about 5:1;
the weight percents being based on the weight of the polyolefin substrate;
the extruded article is in the form of a house siding, cladding, soffit, or roofing, and has a thickness of about 0.030 inches to about 0.070 inches and a weight of from about 0.18 lbs/ft2 to about 0.31 lbs/ft2;
the polyolefin substrate comprises a nucleating agent and one or more fillers;
the nucleating agent comprises sodium benzoate, 2,2?-methylene-bis-(4,6-di-tert-butylphenyl)phosphate, zinc glycerolate, calcium salt of 1,2-dicarboxylic acid cyclohexane, aromatic trisamide compounds, cis-endo-bicyclo-[2.2.1]-heptane-2,3-dicarboxylic acid disodium salt, aluminum hydroxyl-bis[4-(tert-butyl)benzoate], 1,3:2,4-bis-(3,4-dimethylbenzylidene)sorbitol, 1,3:2,4-bis(4-methylbenzylidene)sorbitol, or 1,3:2,4-bis(3,4-dimethylbenzylidene)sorbitol; and
the extruded article exhibits impact strength of >35 in-lb measured according to ASTM D4226, coefficient of linear thermal expansion of <4.5×10E-05 in/in/ft measured according to ASTM D696, acceptable color uniformity in finished siding parts according to ASTM D6864, a low delta E color according to ASTM D2244 of ?5.0, and optionally a UL-94 V-1 or V-0 rating and/or a flame spread index of <200 measured according to ASTM E-84.
US Pat. No. 10,427,949

ALUMINA SINTERED BODY AND BASE SUBSTRATE FOR OPTICAL DEVICE

NGK Insulators, Ltd., Na...

1. An alumina sintered body having:a degree of c-plane orientation of 5% or more, which is determined by a Lotgering method using an X-ray diffraction profile in a range of 2?=20° to 70° obtained under X-ray irradiation, and an XRC half width of 15.0° or less in rocking curve measurement;
an F content of less than 0.99 mass ppm when measured by D-SIMS;
a crystal grain diameter of 15 to 200 ?m; and
25 or less pores having a diameter of 0.2 ?m to 1.0 ?m when a photograph of a viewing area 370.0 ?m in a vertical direction and 372.0 ?m in a horizontal direction taken at a magnification factor of 1000 is visually observed.
US Pat. No. 10,428,205

PNEUMATIC TIRE

1. A pneumatic tire having a tread comprising a radially outer cap layer and radially inner cap layer underlying the outer cap layer;the outer cap layer comprising a vulcanizable rubber composition comprising, based on 100 parts by weight of elastomer (phr),
(A) from about 80 to about 20 phr of a solution polymerized styrene-butadiene rubber having a glass transition temperature (Tg) ranging from ?85° C. to ?50° C.;
(B) from about 20 to about 80 phr of natural rubber; and
(C) from 30 to 70 phr of a process oil;
(D) from 70 to 150 phr of silica;wherein the weight ratio of silica to oil in the outer cap is less than 2.2;the inner cap layer comprising a vulcanizable rubber composition comprising:(i) from about 60 to about 40 phr of a solution polymerized styrene-butadiene rubber having a glass transition temperature (Tg) ranging from ?85° C. to ?50° C.;
(ii) from about 40 to about 60 phr of natural rubber;
(iii) from about 5 to 40 phr of a process oil;
(iv) from about 5 to 15 phr of a hydrocarbon traction resin; and
(v) from 60 to 90 phr of silica;wherein the weight ratio of silica to the sum of oil and traction resin is greater than 2.2.
US Pat. No. 10,426,158

POLYMERIC SORBENT FOR REMOVAL OF IMPURITIES FROM WHOLE BLOOD AND BLOOD PRODUCTS

CytoSorbents Corporation,...

1. A device comprising a plurality of porous sorbent polymeric beads for sorbing impurities from blood, said beads comprising a biocompatible polymer comprising particles having a diameter in the range for 0.1 micrometer to 2 centimeters and has a pore structure that the total pore volume of pore size in the range of 50 À to 40,000 À is greater than 0.5 cc/g to 5.0 cc/g dry polymer, and wherein (a) said plurality of beads being housed in a suitable container intended for storage of blood or blood product wherein said beads would be in direct contact with said blood or blood product or (b) said plurality of beads being contained in cartridge that is used (i) to filter the blood or blood product at time of collection as said or blood product is placed in a bag for storage or (ii) at the point of use during transfusion when said blood or blood product is transfused from the bag to a patient, andwherein said beads comprising divinylbenzene and 4-chlorostyrene and having a skeletal density in the range of from about 1.0 g/ml to about 1.3 g/ml.
US Pat. No. 10,428,207

RUBBER COMPOSITION

TOYO TIRE CORPORATION, I...

1. A rubber composition, comprising:a rubber component; and
a completely amorphous olefin based elastomer,
wherein the rubber component is a diene rubber,
wherein the completely amorphous olefin based elastomer has a glass transition temperature Tg of ?40 to 20° C. in an amount of 1 to 40 parts by mass when the entire amount of the rubber component is regarded as 100 parts by mass;
wherein the rubber composition includes terminal modified SBR in an amount of 5 to 80 parts by mass when the entire amount of the rubber component is regarded as 100 parts by mass.
US Pat. No. 10,426,160

COMPOSITIONS AND METHODS FOR PRESERVING RED BLOOD CELLS AND PLATELETS

RythRx Therapeutics, LLC,...

1. A composition comprising:a compound selected from the group consisting of:
((2R,3S,4R,5R)-5-(3-amino-5-methyl-1,4,5,6,8-pentaazaacenaphthylen-1(5H)-y)-3,4-dihydroxytetrahydrofuran-2-yl)methyl dihydrogen phosphate;
3-amino-5-(((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydro-furan-2-yl)amino)-1-methylpyrimido[4,5-c]pyridazin-4(1H)-one; and
((2R,3S,4R,5R)-5-((3-amino-1-methyl-4-oxo-1,4-dihydropyrimido[4,5-c]pyridazin-5-yl)amino)-3,4-dihydroxytetrahydrofuran-2-yl)methyl dihydrogen phosphate; and
donated blood or a component thereof.