US Pat. No. 10,688,066

BUPROPION AND DEXTROMETHORPHAN FOR TREATING NICOTINE ADDICTION

ANTECIP BIOVENTURES II LL...

1. A method of treating nicotine addiction comprising administering a combination of a bupropion and a dextromethorphan to a person suffering from nicotine addiction.
US Pat. No. 10,688,067

STERILIZED CHLORHEXIDINE ARTICLE AND METHOD OF STERILIZING A CHLORHEXIDINE ARTICLE

Sage Products, LLC, Cary...

1. A sterilized chlorhexidine product for topical disinfection, said sterilized chlorhexidine product comprising:a sterilized chlorhexidine gluconate composition;
an applicator for facilitating application of the sterilized chlorhexidine composition; and
a barrier configured to be compromised to impregnate the applicator with the sterilized chlorhexidine gluconate composition;
wherein the sterilized chlorhexidine gluconate composition comprises chlorhexidine gluconate and alcohol.
US Pat. No. 10,688,068

MIXTURE OF CARBOXYLIC ACIDS FOR TREATING PATIENTS WITH KIDNEY FAILURE

1. A mixture comprising:citric acid, succinic acid, fumaric acid and malic acid, in combination with sodium bicarbonate, calcium carbonate and calcium lactate,
wherein the mixture provides, per dose, citric acid from 56 to 600 millimoles (10.8 grams to 116.4 grams), succinic acid from 56 to 600 millimoles (6.6 grams to 70.8 grams), fumaric acid from 56 to 600 millimoles (6.5 grams to 69.6 grams), and malic acid from 56 to 600 millimoles (7.5 grams to 80.4 grams) to reduce uremia in patients with chronic renal failure.
US Pat. No. 10,689,607

ENZYMATIC TRANSESTERIFICATION/ESTERIFICATION PROCESSES EMPLOYING LIPASES IMMOBILIZED ON HYDROPHOBIC RESINS IN THE PRESENCE OF WATER SOLUTIONS

Trans Bio-Diesel Ltd., S...

1. A process for simultaneous and/or sequential enzymatic transesterification and esterification of a fatty acid source with a C1-6 alkyl alcohol, to form fatty acid C1-6 alkyl esters, the process comprising the steps of:(1) providing a fatty acid source in a reaction vessel, wherein said fatty acid source comprises mono-, di- or tri-glycerides and their mixtures at any ratio, in the absence or presence of free fatty acids or their derivatives;
(2) adding to said fatty acid source provided in step (1) water, in an amount of at least 2% wt. of the fatty acid source, to give a mixture of said fatty acid source and water;
(3) adding to said mixture of fatty acid source and water obtained in step (2) an immobilized lipase preparation, wherein the immobilized lipase preparation comprises at least one lipase immobilized on a hydrophobic porous polymeric support selected from the group consisting of a hydrophobic aliphatic polymer-based support, a hydrophobic acrylic polymer-based support, a hydrophobic aromatic polymer-based support;
(4) stepwise adding to the mixture obtained in step (3) a C1-6 alkyl alcohol or alcohol donor whilst mixing to give a reaction medium comprising said fatty acid source, immobilized enzyme, water and C1-6 alkyl alcohol, wherein the reaction medium has a pH from about 4 to about 10;
(5) allowing the reaction between said fatty acid source and said alcohol or alcohol donor to proceed in said vessel under stirring and/or shaking until conversion of the fatty acid acyl groups or free fatty acids comprised in said fatty acid source to fatty acid C1-6 alkyl esters has reached at least 70%, to give fatty acid C1-6 alkyl esters, glycerol and, respectively, water;
(6) filtering off the reaction medium; and
(7) separating the filtered reaction medium obtained in step (6) by phase separation and collecting an upper phase comprising fatty acid C1-6 alkyl esters product and any unreacted residual fatty acid source,wherein said immobilized lipase preparation retains at least 80% of its activity for at least 20 production cycles.
US Pat. No. 10,688,069

SPORTS HEALTH PERFORMANCE COMPOSITION

REV Pharmaceuticals LLC, ...

1. A topical composition comprising about 20-40 wt % L-arginine, about 0.01-1 wt % forskolin, about 10-35 wt % skin penetration enhancer consisting of a mixture of methyl salicylate and menthol, and about 40-70 wt % base or carrier component, the composition dilating blood vessels to thereby allow lactic acid to dissipate from muscular tissue during exercise or during the recovery phase after exercise.
US Pat. No. 10,688,070

SERINE GLYCEROPHOSPHOLIPID PREPARATION AND METHOD FOR TREATMENT OF SEIZURES

ENZYMOTEC LTD., Migdal H...

1. A preparation for the treatment and/or prevention of seizures comprising a mixture of serine glycerophospholipids (PS) conjugates, wherein the mixture comprises Eicosapentaenoic acid (EPA) conjugated to PS and Docosahexaenoic acid (DHA) conjugated to PS, Palmitic acid conjugated to PS, Oleic acid conjugated to PS and Linoleic acid conjugated to PS, wherein the percentage of each of the following fatty acids: EPA, Palmitic acid, DHA, Oleic acid, and Linoleic acid attached to the PS in the preparation relative to the total fatty acids content attached to the PS in the preparation is such that the percentage of EPA is greater than or equal to the percentage of Palmitic acid, the percentage of Palmitic acid is greater than the percentage of DHA, the percentage of DHA is greater than the percentage of Oleic acid, and the percentage of Oleic acid is greater than the percentage of Linoleic acid; wherein the percentage of EPA attached to the PS in the preparation relative to the total fatty acids content attached to the PS in the preparation is greater than 18% and lower than 45%, the percentage of Palmitic acid attached to the PS in the preparation relative to the total fatty acids content attached to the PS in the preparation is greater than 14% and lower than 42%, the percentage of DHA attached to the PS in the preparation relative to the total fatty acids content attached to the PS in the preparation is greater than 6% and lower than 25%, the percentage of Oleic acid attached to the PS in the preparation relative to the total fatty acids content attached to the PS in the preparation is greater than 1% and lower than 15%, the percentage of Linoleic acid attached to the PS in the preparation relative to the total fatty acids content attached to the PS in the preparation is greater than 0.1% and lower than 6%.
US Pat. No. 10,689,352

SOLID STATE FORMS OF TRISODIUM VALSARTAN: SACUBITRIL

TEVA PHARMACEUTICALS INTE...

1. Crystalline form II of trisodium valsartan: sacubitril characterized by an X-ray powder diffraction pattern having peaks at: 7.3, 16.5, 9.4, 10.9 and 14.7 degrees two theta±0.2 degrees two theta, and an absence of a peak at 12.4 degrees two theta±0.2 degrees two theta.
US Pat. No. 10,688,071

TOPICAL FOAM COMPOSITION

MAYNE PHARMA LLC, Greenv...

1. An oil in water emulsion aerosol foam composition comprising an oil phase and a water phase, said composition comprising:i) tazarotene,
ii) water in an amount from about 65% to about 90% by weight,
iii) an oil present in an amount from about 1% to about 10% by weight, wherein the oil is selected from the group consisting of azulene, chamazulene, isoparaffin, linear alpha olefins, cyclohexlidenediphenyl methane, didecene, diethylhexylcyclohexane, eicosane, isododecane, isoeicosane, isohexadecane, longifolene, mineral oil, light mineral oil, paraffin, pentahydrosqualene, petrolatum squalane, squalene, tetradecene, and mixtures thereof,
iv) an oil miscible organic solvent selected from the group consisting of diisopropyl adipate, isopropyl myristate, octyl dodecanol and caprylic/capric triglyceride, and mixtures thereof,
v) a surfactant component comprising a sufficient and effective amount of a hydrophilic ethoxylated fatty alcohol ether regardless of whether any other surfactant is present, in an amount from about 1% to about 8% by weight, and
vi) a propellant comprising one or more hydrocarbon propellants;wherein the surfactant component is selected from the group consisting of steareth-10, ceteareth-12, oleth-10, and mixtures thereof, andwherein the tazarotene is solubilized in the oil phase of the composition, and the particle size of the oil phase is less than about 1000 nm, and wherein all percentages are based on the total weight of the composition.
US Pat. No. 10,690,635

PURIFICATION OF GLUCAGON-LIKE PEPTIDE 1 ANALOGS

BACHEM HOLDING AG, Buben...

1. A method for the purification of Liraglutide, comprising:a) providing a liquid composition C comprising crude Liraglutide and at least one unwanted component;
b) subjecting the composition C to a first reversed phase high performance liquid chromatograph (RP-HPLC) purification at a pH between 7.0 and 7.8, wherein a hydrocarbon bonded silica is used as a stationary phase, a mobile phase comprising an aqueous phosphate buffer AB1 and acetonitrile is used, and elution is effected by gradually increasing the acetonitrile concentration within the mobile phase while collecting Liraglutide containing fractions; and
c) subjecting the pooled Liraglutide containing fractions obtained in step b) to a second reversed phase HPLC purification at a pH below 3.0, wherein a hydrocarbon bonded silica is used as a stationary phase, a mobile phase comprising trifluoroacetic acid and acetonitrile is used, and elution is effected by gradually increasing the acetonitrile concentration within the mobile phase while collecting fractions containing purified Liraglutide.
US Pat. No. 10,688,072

MISOPROSTOL DISPERSIBLE TABLET

1. A method for obtaining cervical ripening or the induction of labor in a subject comprising sublingual or oral administration of a solid pharmaceutical formulation comprising misoprostol or a pharmaceutically acceptable salt thereof, wherein the formulation is administered to the subject as a dosage form that is a tablet having a content of 0.5-50 ?g misoprostol, or an equivalent amount of a pharmaceutically acceptable salt thereof, and wherein said dosage form allows dispersion in 100 ml water at 25° C. within 3 minutes upon stirring, thereby providing a dispersion, said dispersion passing through a sieve screen with a nominal mesh aperture of 710 ?m, wherein the dosage form cannot pass through the sieve screen before the dispersion in water.
US Pat. No. 10,688,073

OPHTHALMIC COMPOSITIONS CONTAINING A NITRIC OXIDE RELEASING PROSTAMIDE

NICOX SA, Valbonne (FR)

1. An ophthalmic aqueous composition in the form of solution comprising 0.005% to 0.18% w/w hexanoic acid, 6-(nitrooxy)-, (1S,2E)-3-[(1R,2R,3S,5R)-2-[(2Z)-7-(ethylamino)-7-oxo-2-hepten-1-yl]-3,5-dihydroxycyclopentyl]-1-(2-phenylethyl)-2-propen-1-yl ester, and from 0.5% w/w to 1.5% w/w macrogol 15 hydroxystearate.
US Pat. No. 10,689,613

METHODS AND SYSTEM FOR INTERFERING WITH VIABILITY OF BACTERIA AND RELATED COMPOUNDS AND COMPOSITIONS

CALIFORNIA INSTITUTE OF T...

1. A method for interfering with viability of phenazine-producing bacteria, the method comprisingreducing the amount of phenazine in the phenazine-producing bacteria to reduce survivability and/or antibiotic resistance of the phenazine-producing bacteria;
wherein the reducing comprises degrading phenazine in the bacteria by providing the phenazine-producing bacteria with one or more phenazine-degrading proteins from Mycobacteria or Streptomyces.
US Pat. No. 10,688,075

METHOD OF TREATING PATIENTS WITH A FACTOR XA INHIBITOR, ASPIRIN, AND VERAPAMIL

MORGANDANE SCIENTIFIC, LL...

1. A method of reducing the risk of stroke and systemic embolism in patients with non valvular atrial fibrillation in a patient in need of treatment with rivaroxaban and verapamil, comprising:(a) administering about 100 to about 480 mg verapamil daily to the patient;
(b) optionally administering about 75 mg to about 325 mg of aspirin to the patient; and
(c) administering 1 mg to 15 mg of rivaroxaban to the patient;
wherein the patient has a creatinine clearance (CLCr) of >50 mL/min to 79 mL/min.
US Pat. No. 10,689,614

CELL CULTURE SUPPORT

AMOLIFESCIENCE CO., LTD.,...

1. A cell culture support comprising:a first fibrous web formed of first accumulated electrospun fibers, first pores, and first beads formed on the first accumulated electrospun fibers, the first beads securing spaces of the first pores;
a second fibrous web laminated on the first fibrous web, the second fibrous web being formed of second accumulated electrospun fibers, second pores, and second beads formed on the second accumulated electrospun fibers, the second beads securing spaces of the second pores; and
a third fibrous web laminated on the second fibrous web, the third fibrous web being formed of third accumulated electrospun fibers, third pores, and third beads formed on the third accumulated electrospun fibers, the third beads securing spaces of the third pores,
wherein the third fibrous web is configured to culture cells adhered to the third accumulated electrospun fibers, and the second fibrous web is configured to grow the cells penetrated into the spaces of the second pores,
wherein the third accumulated electrospun fibers have a diameter smaller than that of the second accumulated electrospun fibers to increase a surface area to which the cells are adhered, and
wherein the first accumulated electrospun fibers have a diameter smaller than that of the second accumulated electrospun fibers to prevent the grown cells to penetrate into the first fibrous web from the second fibrous web, and
wherein the first, second and third accumulated electrospun fibers are obtained by electrospinning a spinning solution having a viscosity from 50 cps to 2000 cps.
US Pat. No. 10,688,076

METHOD OF TREATING CONDITIONS RELATED TO THE PGI2 RECEPTOR

ARENA PHARMACEUTICALS, IN...

1. A method of determining an optimized dose for a patient in need of treatment of pulmonary arterial hypertension comprising:administering to the patient a dose of 2-(((1r,4r)-4(((4-chlorophenyl)(phenyl)carbamoyloxy)methyl)cyclohexyl)methoxy)acetic acid (Compound 1), or a pharmaceutically acceptable salt, hydrate, or solvate thereof, and if the dose is tolerated then
administering to the patient a higher dose of Compound 1, or a pharmaceutically acceptable salt, hydrate, or solvate thereof, until the optimized dose for the patient is administered.
US Pat. No. 10,689,615

TEMPERATURE-RESPONSIVE BASE MATERIAL, METHOD FOR PRODUCING SAME, AND METHOD FOR EVALUATING SAME

DAIKIN INDUSTRIES, LTD., ...

1. A temperature-responsive substrate having on its surface a layer comprising a blend polymer, at least one polymer constituting the blend polymer is responsive to temperature, and at least one polymer constituting the blend polymer comprises a fluorine-containing monomer-derived unit,wherein said temperature-responsive substrate is a cell culture substrate,
wherein the fluorine-containing monomer is represented by formula (1):
CH2?C(—X)—C(?O)—Y—Z—Rf  (1)wherein X is hydrogen, a C1-21 linear or branched alkyl group, fluorine, chlorine, bromine, iodine, CFX1X2— (wherein X1 and X2 are hydrogen, fluorine, chlorine, bromine, or iodine), cyano, a C1-21 linear or branched fluoroalkyl group, a substituted or unsubstituted benzyl group, or a substituted or unsubstituted phenyl group;Y is —O— or —NH—;Z is a C1-10 aliphatic group, a C6-10 aromatic group, or a C6-10 cyclic aliphatic group, —CH2CH2N(R1)SO2— wherein R1 is a C1-4 alkyl group, —CH2CH(OZ)1)CH2— wherein Z1 is hydrogen or acetyl,—(CH2)m—SO2—(CH2)n—, —(CH2)m—S—(CH2)n— wherein m is 1 to 10, and n is 0 to 10, or —(CH2)m—COO— wherein m is 1 to 10:Rf is a C1-20 linear or branched fluoroalkyl group optionally containing a heteroatom, andwherein the blend polymer comprises at least one polymer comprising a fluorine-containing monomer-derived unit in an amount of at least 5 mol %, based on the sum of all monomer units, and at least one temperature-responsive polymer comprising a fluorine-containing monomer-derived unit in an amount of 0 to 1 mol %, based on the sum of all monomer units.
US Pat. No. 10,693,203

METAL-AIR BATTERY AND METAL-AIR BATTERY MODULE

SAMSUNG ELECTRONICS CO., ...

1. A metal-air battery comprising:a negative electrode;
a positive electrode;
an ion conducting membrane disposed between the negative electrode and the positive electrode;
a positive electrode current collector disposed on a surface of the positive electrode and comprising a plurality of pores;
a first insulating gas diffusion layer disposed on an upper surface of the positive electrode current collector; and
a second insulating gas diffusion layer disposed on a lower surface of the positive electrode current collector,
wherein the first insulating gas diffusion layer and the second insulating diffusion layer are separated from each other,
wherein the first insulating gas diffusion layer and the second insulating gas diffusion layer are separated from each other, and
wherein the positive electrode current collector comprises a folded portion forming a “U” shape, and the first and the second insulating gas diffusion layers are respectively positioned on each of the opposite surfaces of the folded positive electrode current collector.
US Pat. No. 10,688,077

INFLAMMASOME ACTIVATION IN MYELODYSPLASTIC SYNDROMES

H. Lee Moffitt Cancer Cen...

1. A method for treating a myelodysplastic syndromes (MDS) in a subject, comprising administering to the subject a therapeutically effective amount of an inflammasome inhibitor, wherein the MDS in the subject is non-del(5q) MDS or del(5q) MDS.
US Pat. No. 10,689,616

T-CELL RECEPTOR-DEFICIENT T CELL COMPOSITIONS

THE TRUSTEES OF DARTMOUTH...

1. An isolated primary human T cell or progeny thereof, which isolated primary human T cell:(i) has been modified to functionally impair and/or to reduce expression of the endogenous T cell receptor (TCR), and
(ii) has been modified to express at least one exogenous non-TCR ligand binding domain which binds to a ligand expressed by tumor cells, which ligand binding domain directly or indirectly mediates T cell signaling upon the binding of the ligand binding domain to a ligand expressed by a tumor cell.
US Pat. No. 10,688,078

METHOD FOR TREATING AN ALLERGIC DISEASE

ARJIL BIOTECH HOLDING COM...

1. A method for treating an allergic disease which comprises administering to a subject in need thereof a therapeutically effective amount of a compound selected from the group consisting of ovatodiolide, 1?-acetoxychavicol acetate, and combination thereof.
US Pat. No. 10,689,617

T-CELL RECEPTOR-DEFICIENT T CELL COMPOSITIONS

THE TRUSTEES OF DARTMOUTH...

1. A method of treating cancer in a human subject in need thereof which comprises administering a pharmaceutically effective amount of isolated primary human T cells or progeny thereof, which isolated primary human T cells:(i) have been modified to functionally impair and/or to reduce expression of the endogenous T cell receptor (TCR); and
(ii) have been modified to express at least one functional exogenous non-TCR receptor comprising a ligand binding domain which binds to a ligand expressed by tumor cells of said subject, which exogenous ligand binding domain directly or indirectly mediates T cell signaling upon the binding of the ligand binding domain to a ligand expressed by a tumor cell in the treated subject.
US Pat. No. 10,689,618

T CELL RECEPTOR-DEFICIENT T CELL COMPOSITIONS

THE TRUSTEES OF DARTMOUTH...

1. A method of producing one or more compositions comprising human T cells which express a heterologous ligand binding domain or a heterologous receptor other than a T cell receptor (TCR), wherein said human T cells are derived from primary human T cells and wherein said method comprises:(i) obtaining one or more compositions comprising isolated primary human T cells, each of said compositions being comprised of primary human T cells isolated from at least one human donor;
(ii) modifying the primary human T cells comprised in said one or more compositions comprising primary human T cells in order to functionally impair or reduce expression of one or more components of the TCR complex endogenously expressed by said human primary T cells; and
(iii) modifying the primary human T cells in the one or more compositions comprising human T cells by introducing a nucleic acid which encodes a desired exogenous ligand binding domain or a desired exogenous receptor, wherein said exogenous ligand binding domain and exogenous receptor do not comprise a TCR and further wherein said exogenous ligand binding domain or exogenous receptor firectly or indirectly mediates T cell signaling upon binding of the ligand binding domain or the exogenous receptor to a ligand expressed by a target cell;thereby producing one or more compositions comprising human T cells which express at least one desired ligand binding domain or desired receptor and further wherein one or more components of the TCR complex endogenously expressed by said human primary T cells is functionally impaired or the expression of one or more components of the TCR complex endogenously expressed by said human primary T cells is reduced.
US Pat. No. 10,689,619

T CELL RECEPTOR-DEFICIENT T CELL COMPOSITIONS

THE TRUSTEES OF DARTMOUTH...

1. A method of treating an infectious condition in an individual in need thereof, comprising administering to the individual a composition comprising a therapeutically effective amount of isolated modified primary human T cells which are derived from a primary human T cell isolated from a human donor, which primary human T cells are:(i) modified to functionally impair or to reduce expression of the endogenous T cell receptor (TCR), and
(ii) modified by the introduction of a nucleic acid construct comprising a nucleic acid which encodes for and results in the expression at least one exogenous non-TCR that comprises a pathogen-associated receptor ligand binding domain and further comprises a nucleic acid encoding a signaling domain, wherein said pathogen-associated receptor ligand binding domain and said signaling domain together mediate T cell signaling upon the binding of the ligand binding domain to a ligand expressed by a pathogen-infected target cell.
US Pat. No. 10,689,620

T CELLS WITH INCREASED IMMUNOSUPPRESSION RESISTANCE

ADAPTIMMUNE LIMITED, Abi...

1. A population of modified T cells which express an antigen receptor which binds specifically to cancer cells and a cAMP phosphodiesterase (PDE) or fragment thereof,wherein said cells comprise a heterologous nucleic acid encoding the cAMP phosphodiesterase (PDE).
US Pat. No. 10,688,083

USE OF CHLOROQUINE AND CLEMIZOLE COMPOUNDS FOR TREATMENT OF INFLAMMATORY AND CANCEROUS CONDITIONS

Eiger Group International...

1. A method of treating a subject who has been diagnosed with liver cancer, comprising:administering to the subject an effective amount of clemizole, a deuterated analog of clemizole, or a clemizole metabolite; and a chemotherapeutic agent.
US Pat. No. 10,689,622

CULTURE MEDIUM FOR PROLIFERATING STEM CELL, WHICH CONTAINS SULFATED COMPOUND

AJINOMOTO CO., INC., Tok...

1. A method for culturing a stem cell, comprisingculturing the stem cell in a medium comprising:
a fibroblast growth factor (FGF), and
a sulfated compound or a pharmaceutically acceptable salt thereof,
wherein said sulfated compound or a pharmaceutically acceptable salt thereof is present in said medium at a concentration that promotes the growth of said stem cell in the presence of FGF, and
wherein said sulfated compound or pharmaceutically acceptable salt thereof is a sulfated polymer that is not a sulfated saccharide, or a pharmaceutically acceptable salt of said sulfated polymer, and
wherein said sulfated polymer or pharmaceutically acceptable salt thereof is at least one compound selected from the group consisting of a sulfo group-containing polyvinyl alcohol, a sulfo group-containing polyvinyl amine, a sulfo group-containing polyallylamine, a sulfo group-containing polyethyleneimine, a sulfo group-containing ?-polylysine, a sulfo group-containing ?-poly methyl glutamate/?-5-hydroxynorvaline (2/8)copolymer, an ?-polyglutamic acid-?-taurine, a sulfo group-containing branched-polyglycerol, a derivative of a sulfo group-containing branched-polyglycerol, and polyethylene sulfonic acid, or a pharmaceutically acceptable salt of said at least one compound.
US Pat. No. 10,689,623

METHOD AND DEVICE FOR PREPARING NON-EMBRYONIC STEM CELLS

LIPOGEMS INTERNATIONAL S....

1. A process for inducing the expression of stem cell markers in the cells of a lipoaspirate, said process comprising the steps of:providing a lipoaspirate obtained by a non-enzymatic minimal manipulation procedure; and
exposing, for at least four hours, said lipoaspirate to vibrations derived from a heart sound by ultrasonography examination by extracting a Doppler signal from echoes of ultrasound waves received by soundproofing with a heart probe, or a part thereof, or a blood vessel, wherein the signal is processed by
1) filtering heart sounds using an IIR filter to remove noise;
2) reconstructing a waveform starting from its digital samples and verifying that the Nyquist limit, the limit that dictates the acquisition of a signal, is at least twice its maximum frequency; and
3) finding the peaks and valleys of the signal, wherein the maximum differential value between adjacent peaks provides a duration to each heart sound to be converted into a music sound, and wherein said vibrations have frequencies ranging from 1 to 10 MHz,
wherein the stem cell markers include at least one of Sox2, Oct4, and Nanog.
US Pat. No. 10,688,085

USE OF STATIN-BASED DRUG FOR TREATMENT OF EML4-ALK-POSITIVE NON-SMALL CELL LUNG CANCER PROGRESSING ON ALK INHIBITOR

UNIVERSITY-INDUSTRY FOUND...

1. A method comprising:confirming whether a resistance to an anaplastic lymphoma kinase (ALK) inhibitor has been acquired in a patient with EML4-ALK positive non-small cell lung cancer,
confirming whether Yes-associated protein (YAP) is activated in the patient,
selecting a statin-based drug for treatment of EML4-ALK positive non-small cell lung cancer when resistance to the ALK inhibitor has been acquired and YAP is activated in the patient, and
administering to the patient who has acquired resistance to the ALK inhibitor and has activated YAP a pharmaceutical composition comprising a statin-based drug.
US Pat. No. 10,688,086

METHOD FOR TREATING CANCER WITH DIHYDROPYRIDINE CALCIUM ANTAGONIST

GERMARK BIOTECHNOLOGY CO....

1. A method for treating a cancer with a dihydropyridine calcium antagonist, comprising administering an effective amount of a dihydropyridine calcium antagonist to a cancer patient, wherein the dihydropyridine calcium antagonist is used at a dosage from 100 mg/90 day to 120 mg/30 day,wherein the administration of the dihydropyridine calcium antagonist to the cancer patient is to inhibit cancer metastasis.
US Pat. No. 10,689,625

GENE THERAPIES FOR LYSOSOMAL DISORDERS

Prevail Therapeutics, Inc...

1. A recombinant adeno-associated virus (rAAV) vector comprising a nucleic acid comprising an expression construct comprising a promoter operably linked to a transgene insert encoding a Progranulin (PGRN) protein, wherein the transgene insert is the nucleotide sequence of SEQ ID NO: 68.
US Pat. No. 10,690,651

SMALL MOLECULE METABOLITES FOR THE DIAGNOSIS OF BACTERIAL VAGINOSIS AND ASSESSMENT OF DISEASE RISK

FRED HUTCHINSON CANCER RE...

1. A method of diagnosing and treating bacterial vaginosis in a subject, the method comprising:collecting a sample from the subject;
assessing a small molecule metabolomic profile by measuring levels of indicative metabolites comprising at least two of:
a metabolite associated with the presence of clue cells;
a metabolite associated with the presence of amine odors; and
a metabolite associated with vaginal discharge;
comparing the small molecule metabolomic profile with a diagnostic metabolomic profile;
determining that there is a match between the small molecule metabolomic profile and the diagnostic metabolomic profile of at least 50%, the match being indicative of bacterial vaginosis; and
administering an antibiotic treatment to the subject.
US Pat. No. 10,689,626

COMPOSITIONS AND METHODS FOR MEASURING BLOOD GLUCOSE LEVELS

SmartZyme Innovations Ltd...

1. A mutated Flavoprotein Glucose Dehydrogenase subunit alpha (FAD-GDH?) protein, wherein the mutated FAD-GDH? protein has glucose dehydrogenase activity, and comprises an amino acid sequence having at least 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 38 and wherein the amino acid of the mutated FAD-GDH? protein at the position corresponding to residue 406 of the amino acid sequence of SEQ ID NO: 38 is an amino acid other than F or W.
US Pat. No. 10,690,652

METHOD FOR DETECTING SICKLE-CELL DISEASE AND KIT FOR IMPLEMENTING SAME

SCREENCELL, Sarcelles (F...

1. A method of testing for sickle cell disease in an individual, comprising the following successive steps, steps a) and b) being carried out successively or simultaneously:a) bringing a blood sample from the individual into contact with an agent for inducing sickling of sickle red blood cells placing red blood cells contained in the blood sample in a hypoxic condition, wherein the agent for inducing sickling is metabisulfite salt, and mixing said blood sample with a buffer solution having a pH of between 6.8 and 7.4, containing the agent for inducing sickling and free of a cell lysis agent;
b) filtering said blood sample containing the red blood cells through a porous membrane having a pore size that retains the red blood cells which have undergone said sickling, and allows the red blood cells which have not undergone said sickling to pass through; and
c) detecting a presence of a residue on the porous membrane, during or at an end of the filtering step, wherein the presence of the residue indicates that the individual has a sickle cell disease.
US Pat. No. 10,688,088

PHARMACEUTICAL COMPOSITION, USE OF MEFLOQUINE IN FIXED DOSE, AND METHOD FOR TREATING TUBERCULOSIS

Fundacao Oswaldo Cruz, R...

1. A pharmaceutical composition comprising:mefloquine;
pyrazinamide; and
one or more excipients,
wherein the ratio of mefloquine to pyrazinamide is about 0.5 to about 1.0.
US Pat. No. 10,689,627

P450-BM3 VARIANTS WITH IMPROVED ACTIVITY

Codexis, Inc., Redwood C...

1. A recombinant cytochrome P450-BM3 variant having cytochrome P450-BM3 activity and comprising the amino acid sequence of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 20, 36, 38, 40, 44, 50, 52, 56, 58, 60, 64, 66, or 68.
US Pat. No. 10,688,089

COMPOSITIONS AND KITS USEFUL FOR TREATMENT OF RESPIRATORY ILLNESS

1. A stable liquid composition in a clear bottle comprising:(a) from about 0.001% to about 0.5% of phenylephrine hydrochloride, by weight of the stable liquid composition;
(b) one or more additional actives selected from the group consisting of dextromethorphan, acetaminophen, doxylamine, guaifenesin, the free and addition salts thereof, and mixtures thereof, from about 0.0001% to about 10% of total additional actives, by weight of the liquid composition;
(c) a flavoring agent comprising one or more non-aldehydic aesthetic agents and mixtures thereof, from about 0.0001% to about 5% of total non-aldehydic aesthetic agents, by weight of the liquid composition;
(d) an artificial sweetener selected from the group consisting of sodium saccharine, acesulfame potassium, sucralose, aspartame, monoammonium glycyrrhizinate, neohesperidin dihydrochalcone, thaumatin, neotame, cyclamates, and mixtures thereof;
(e) a solvent selected from the group consisting of water, propylene glycol, ethanol, and mixtures thereof, from about 40% to about 95% of total solvent, by weight of the liquid composition; and
(f) a chelating agent selected from the group consisting of disodium and calcium salts of ethylene diamine tetraacetic acid (EDTA), terasodium EDTA, sodium hexametaphosphate (SHMP), citric acid, phosphoric acid, di(hydroxyethyl)glycine, 8-hydroxyquinoline, and mixtures thereof;
wherein the stable liquid corn position has a pH of from about 2 to about 6.5; wherein the stable liquid composition is a solution; and wherein the stable liquid composition comprises less than about 0.05% of total aldehydes, by weight of the liquid composition; and wherein the clear bottle comprises a material selected from the group consisting of Polyethylene Terephthalate (PET), Glycol-modified Polyethylene Terephthalate (PETG), Oriented Polypropylene (OPP), Polyvinylchloride (PVC), Polyvinylidene Chloride (PVDC), Nylon, Polyethylene Terphthalate Polyester (PETP), Polyphene, and combinations thereof.
US Pat. No. 10,689,628

METHOD OF MAKING VARIANT LOVD POLYPEPTIDES

THE REGENTS OF THE UNIVER...

1. A method of making a variant of a LovD polypeptide set forth in SEQ ID NO: 1 comprising:generating a population of mutants of the LovD polynucleotide set forth in SEQ ID NO: 5 using a polynucleotide mutagenesis procedure, wherein the population of mutant LovD polynucleotides encodes LovD polypeptide variants having at least one amino acid substitution selected from the group consisting of K26E, G275S, and L361M; and expressing a population of LovD polypeptide variants encoded by the population of mutant LovD polynucleotides;
so that the variant of a LovD polypeptide set forth in SEQ ID NO: 1 is made.
US Pat. No. 10,688,090

VILAZODONE INCLUSION COMPLEXES, COMPOSITIONS AND PREPARATION THEREOF

Sunshine Lake Pharma Co.,...

1. A composition comprising an inclusion complex comprising an active ingredient included in an inclusion material, wherein the active ingredient is vilazodone or a pharmaceutically acceptable salt thereof, wherein the weight ratio of the active ingredient to the inclusion material is from 1:5 to 1:45.4.
US Pat. No. 10,689,629

INHIBITION OF NUCLEIC ACID POLYMERASES BY ENDONUCLEASE V-CLEAVABLE CIRCULAR OLIGONUCLEOTIDE LIGANDS

Cepheid, Sunnyvale, CA (...

1. A method of activating an aptamer-inactivated DNA polymerase, comprising:providing a reaction mixture suitable for DNA synthesis, the reaction mixture comprising (i) a DNA polymerase, (ii) an endonuclease V-cleavable circular oligonucleotide aptamer that binds to the DNA polymerase, wherein the oligonucleotide aptamer is present in an amount effective to inhibit DNA synthesis activity of the DNA polymerase in the reaction mixture, and (iii) an endonuclease V enzymatic activity; and
cleaving the aptamer by the endonuclease V enzymatic activity to reduce or eliminate binding of the oligonucleotide aptamer to the DNA polymerase, thereby activating the DNA synthesis activity of the DNA polymerase, to increase DNA synthesis in the reaction mixture.
US Pat. No. 10,689,630

PROCESSES FOR PRODUCING FERMENTATION PRODUCTS

1. A process for producing fermentation products from starch-containing material comprising the steps of:i) liquefying the starch-containing material at a temperature above the initial gelatinization temperature using:
an alpha-amylase;
a GH10 xylanase having a Melting Point (DSC) above 80° C.;
ii) saccharifying using a glucoamylase enzyme;
iii) fermenting using a fermenting organism, wherein the starch-containing material is corn.
US Pat. No. 10,688,092

COMPOSITIONS AND METHODS OF USING NINTEDANIB FOR IMPROVING GLAUCOMA SURGERY SUCCESS

Cloudbreak Therapeutics, ...

1. A method for improving success rate of glaucoma surgery, comprising administering to an eye of a subject in need thereof a therapeutically effective amount of axitinib, pazopanib, or regorafenib.
US Pat. No. 10,689,631

GENE CONSTRUCT ENCODING MUTANT THIOESTERASE, MUTANT THIOESTERASE ENCODED THEREBY, TRANSFORMED HOST CELL CONTAINING THE GENE CONSTRUCT, AND METHOD OF USING THEM TO PRODUCE MEDIUM-CHAIN FATTY ACIDS

WISCONSIN ALUMNI RESEARCH...

1. An unnatural, mutated protein comprising an amino acid sequence that is at least 85% identical to SEQ ID NO:1 and comprises a substitution at a position aligning to I107 of SEQ ID NO:1, a position aligning to R108 of SEQ ID NO:1, a position aligning to S122 of SEQ ID NO:1, a position aligning to M141 of SEQ ID NO:1, a position aligning to Y145 of SEQ ID NO:1, a position aligning to L146 of SEQ ID NO:1, or a combination thereof, wherein:the protein comprises at least one of:
a lysine at the position aligning to S122 of SEQ ID NO:1;
a lysine at the position aligning to Y145 of SEQ ID NO:1; and
a lysine at the position aligning to L146 of SEQ ID NO:1; and
the protein has at least one of enhanced thioesterase activity and enhanced thioesterase specificity in catalyzing the hydrolysis of a medium-chain acyl-acyl carrier protein substrate or a medium-chain acyl-CoA substrate to yield a free fatty acid or a free fatty acid derivative compared to an unaltered protein of SEQ ID NO:1.
US Pat. No. 10,688,093

METHODS, COMPOSITIONS, AND USES OF NOVEL FYN KINASE INHIBITORS

1. A method of treating a condition associated with Fyn kinase activity, said method comprising administering a therapeutically effective amount of at least one compound, or pharmaceutically acceptable salt or solvate of the compound to a patient in need thereof, wherein the compound is selected from N-[3-(dimethyl-amino)-propyl]-4-[3-(4-hydroxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]-benzamide, N-[2-(dimethyl-amino)-ethyl]-4-[3-(4-hydroxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]-benzamide, N-(2-hydroxy-ethyl)-4-[3-(4-hydroxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]benzamide, N-[3-(dimethyl-amino)-propyl]-4-[3-(4-hydroxy-3-methoxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]benzamide, N-(2-hydroxy-ethyl)-3-[3-(4-hydroxy-3-methoxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]benzamide, N-[2-(dimethyl-amino)ethyl]-4-[3-(4-phenoxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]-benzamide, N-[3-(dimethyl-amino)-propyl]-4-[3-(4-phenoxy-phenyl) imidazo[1,2-a]pyrazin-6-yl]benzamide, N-[2-(dimethyl-amino)ethyl]-4-[3-(4-hydroxy-3-methoxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]benzamide, N-(2-hydroxy-ethyl)-4-[3-(4-phenoxy-phenyl)-imidazo-[1,2-a]-pyrazin-6-yl]benzamide, and 3-[3-(4-hydroxy-phenyl)-imidazo[1,2-a]pyrazin-6-yl]-N,N-dimethyl-benzamide, wherein the condition associated with Fyn kinase activity is selected from Type 1 diabetes, Type II diabetes, pre-diabetes, and obesity.
US Pat. No. 10,689,632

THERMOSTABLE CAS9 NUCLEASES

Purac Biochem B.V., Gori...

1. A ribonucleoprotein complex comprising a Cas protein having an amino acid sequence of SEQ ID NO: 1 or a sequence of at least 92% identity therewith, and comprising at least one targeting RNA molecule which recognizes a sequence in a target polynucleotide to be cleaved, wherein the targeting RNA molecule is a single guide RNA (sgRNA), further wherein the targeting RNA molecule is a single guide RNA (sgRNA) comprising a CRISPR RNA (crRNA) and a trans-activating small RNA (tracrRNA) linked by a synthetic loop.
US Pat. No. 10,689,633

EXPRESSION OF ?-MANNANASE IN CHLOROPLASTS AND ITS UTILIZATION IN LIGNOCELLULOSIC WOODY BIOMASS HYDROLYSIS

The Trustees of the Unive...

1. A method for producing plant degrading cocktail consisting of extracts of chloroplast produced ?-mannanase, xylanase encoded by sequences obtained from Trichoderma reesei, acetyl xylan esterase encoded by sequences obtained from Trichoderma reesei, recombinant CelD endoglucanase encoded by sequences obtained from Clostridium termocellum, Eg1 endoglucanase, CelO exoglucanase encoded by sequences obtained from Clostridium thermocellum, recombinant Beta glucosidase encoded by sequences obtained from Trichoderma reesei, PelA pectate lyase, recombinant PelB pectate lyase encoded by sequences obtained from Fusarium solani, and PelD pectate lyase encoded by sequences obtained from Fusarium solani plant degrading enzymes and swollenin encoded by sequences obtained from Trichoderma reesei, wherein nucleic acids encoding said plant degrading enzymes and swollenin are introduced into chloroplasts of at least one plant, thereby producing transplastomic plants; said method comprisinga) grinding said transplastomic plants in liquid nitrogen;
b) suspending ground transplastomic plant material of step a) in a buffer in the presence of a protease inhibitor cocktail, thereby forming a suspension;
c) subjecting said suspension to centrifugation and harvesting said enzymes in the resultant supernatant; and
d) filtering said supernatant to remove any sugars present, thereby producing a crude plant enzyme extract for said plant degrading cocktail.
US Pat. No. 10,689,634

METHODS OF COMBINED BIOPROCESSING AND RELATED MICROORGANISMS, THERMOPHILIC AND/OR ACIDOPHILIC ENZYMES, AND NUCLEIC ACIDS ENCODING SAID ENZYMES

Battelle Energy Alliance ...

1. A genetically modified bacteria or fungus comprising:at least one exogenous nucleic acid encoding a polypeptide having at least 90% sequence identity to SEQ ID NO: 304; and
wherein the polypeptide has carboxylesterase type B activity.
US Pat. No. 10,689,635

ALPHA-AMYLASE VARIANTS AND POLYNUCLEOTIDES ENCODING SAME

1. An alpha-amylase variant comprising a substitution at position 185 with Pro and a substitution at position 201 with Tyr, wherein(a) each position corresponds to SEQ ID NO: 1,
(b) the alpha-amylase variant has at least 80% and less than 100% sequence identity to amino acids 1 to 481 of SEQ ID NO: 14, and
(c) the alpha-amylase variant has alpha-amylase activity.
US Pat. No. 10,690,661

YEAST-BASED BIOSENSOR

Northwestern University, ...

1. A yeast-based biosensor comprising a yeast cell expressing:(a) a recognition element that is a modified version of a native yeast cell-surface receptor, wherein the recognition element binds to a peptide analyte that is not a natural ligand for the native yeast cell-surface receptor, and wherein the peptide analyte comprises less than 50% sequence identity with the natural ligand for the native yeast cell-surface receptor; and
(b) a reporter, expression of which is linked to binding of the recognition element to the peptide analyte.
US Pat. No. 10,689,636

METHODS OF INCREASING THE CELLULOLYTIC ENHANCING ACTIVITY OF A POLYPEPTIDE

Novozymes, Inc., Davis, ...

1. A method for producing a fermentation product, comprising:(a) saccharifying a cellulose-containing material with a cellulolytic enzyme composition and an effective amount of a GH61 polypeptide having cellulolytic enhancing activity and a soluble activating divalent metal cation, wherein the soluble activating divalent metal cation is present at an effective concentration of 0.001 mM to 50 mM, wherein the presence of the soluble activating divalent metal cation and the GH61 polypeptide having cellulolytic enhancing activity increases the saccharification of the cellulose-containing material by the cellulolytic enzyme composition compared to the presence of the GH61 polypeptide having cellulolytic enhancing activity and the absence of the soluble activating divalent metal cation, wherein the soluble activating divalent metal cation is selected from the group consisting of Mn++, Co++, Mg++, Ca++, and a combination thereof;
(b) fermenting the saccharified cellulose-containing material of step (a) with one or more fermenting microorganisms to produce the fermentation product; and
(c) recovering the fermentation product from the fermentation.
US Pat. No. 10,688,098

MODULATION OF THE NITRIC OXIDE SYNTHASE PATHWAY FOR ORAL HEALTH

Meharry Medical College, ...

1. A method of treatment of at least one of xerostomia and periodontal disease in a subject in need thereof, the method comprising administering an agent comprising sepiapterin, or a pharmaceutically acceptable salt thereof to the subject in a therapeutically effective amount.
US Pat. No. 10,689,380

CRYSTALLINE FORMS OF VALBENAZINE DITOSYLATE

Farmhispania S.A., Barce...

1. Crystalline valbenazine ditosylate having an X-ray powder diffractogram pattern comprising peaks at 2-theta angles of 6.1, 16.9, 17.2, 19.1 and 19.6±0.2 degrees 2-theta.
US Pat. No. 10,689,637

COMPLEMENT FACTOR B ANALOGS AND THEIR USES

Wellstat ImmunoTherapeuti...

1. A polypeptide comprising a human complement factor B protein analog,wherein the human complement factor B analog comprises a substitution of a free cysteine amino acid corresponding to amino acid 292 of SEQ ID NO:1 as determined by alignment of the amino acid sequence of the human complement factor B analog with the amino acid sequence of SEQ ID NO: 1; and
the human complement factor B protein analog is at least 90% identical to amino acids 26-764 of SEQ ID NOs:1, 2 or 3; to amino acids 26-990 of SEQ ID NOs:22 or 23; to amino acids 26-480 of SEQ ID NO:2; or to amino acids 26-1003 of SEQ ID NO:26.
US Pat. No. 10,689,381

VINBLASTINE 20? AMIDES: SYNTHETIC ANALOGS THAT MAINTAIN OR IMPROVE POTENCY AND SIMULTANEOUSLY OVERCOME PGP-DERIVED EFFLUX AND RESISTANCE

The Scripps Research Inst...

whereinY— is fluoro (—F) or hydrido (—H), and
Ra— is a ring system containing up to a total of three 5-, 6- or 7-membered rings that are fused or otherwise directly bonded to each other,
said ring system being carbocyclic or heterocyclic in which ring atoms other than carbon are the same or different and are nitrogen (N), oxygen (O) or sulfur (S), and said heterocyclic ring system contains up to three ring heteroatoms, and
up to four substituents that are the same or different are present bonded to ring atoms of said ring system, said substituents being selected from the group consisting of C1-C7 hydrocarbyl, trifluoromethyl, phenyl, halogen (fluoro, chloro or bromo), cyano, nitro, C1-C7 acyl, amino, mono- or di-C1-C7 hydrocarbylamino, a nitrogen-bonded heterocyclic ring of 5- or 6 members that can contain 1 or 2 additional ring hetero atoms selected from oxygen, nitrogen, and sulfur, acylamido containing 1-7 carbon atoms, sulfonylamido containing 1-7 carbon atoms, oxycarbonylamido containing 1-7 carbon atoms, C1-C7 hydrocarbyloxy, N—C1-C7 hydrocarbyl acylamido containing 1-7 carbon atoms in the acyl group, N—C1-C7 hydrocarbyl sulfonylamido containing 1-7 carbon atoms in the sulfonamido group, N—C1-C7 hydrocarbyl oxycarbonylamido containing 1-7 carbon atoms in the oxycarbonyl group, trifluoromethoxy, trifluoromethylamino, trifluoromethylamino oxycarbonyl containing 1-7 carbon atoms in the oxycarbonyl group, and C1-C7 hydrocarbylthioxy group.
US Pat. No. 10,689,638

THERMOPHILIC AND THERMOACIDOPHILIC METABOLISM GENES AND ENZYMES FROM ALICYCLOBACILLUS ACIDOCALDARIUS AND RELATED ORGANISMS, METHODS

1. An expression vector comprising an isolated polynucleotide encoding a polypeptide having at least 95% sequence identity to SEQ ID No. 1225 and a nucleotide sequence heterologous to the polynucleotide, wherein the encoded polypeptide has aldehyde dehydrogenase enzymatic activity.
US Pat. No. 10,688,100

MACROCYLIC COMPOUNDS AS ROS1 KINASE INHIBITORS

Array BioPharma Inc., Bo...

1. A method for treating a ROS1-associated cancer in a subject in need thereof, wherein the subject has been administered a first TRK inhibitor that is entrectinib, and the ROS1-associated cancer has developed resistance to the first TRK inhibitor, the method comprising administering(6R,15R)-9-fluoro-15-methyl-2,11,16,20,21,24-hexaazapentacyclo[16.5.2.02,6.07,12.021,25]pentacosa-1(24),7,9,11,18(25),19,22-heptaen-17-one;
or a pharmaceutically acceptable salt thereof;
wherein the ROS1-associated cancer is selected from non-small-cell lung cancer or papillary thyroid carcinoma and has a point mutation in the ROS1 gene results in the production of a ROS1 kinase having one or more amino acid substitutions selected from the group consisting of A15G, R118N, A122T, R245I, G1025R, S1186F, P1539S, T1735M, R1948H, D2033Y, R2072N, R2162W, R2162Q, R2162L, and E2308W.
US Pat. No. 10,690,665

MARKER, IMMUNOASSAY METHOD, IMMUNOASSAY REAGENT, METHOD FOR ASSAYING ANALYTE, ANALYTE MEASUREMENT KIT, AND LATERAL-FLOW CHROMATOGRAPHIC TEST STRIP

1. A marker, comprising a resin-gold composite with a structure formed by immobilizing old particles on a resin particle, characterized byhaving
the average particle size of the resin-gold composite being in a range of 300 nm to 1000 nm;
the average particle size of the gold particles being in a range of 20 nm to 70 nm;
wherein the gold particles comprise
a first portion of the gold particles completely encased in the resin particle,
a second portion of the gold particles having a part embedded in the resin particle and another part exposed from the resin particle, and
a remaining portion of the gold particles adsorbed on the surface of the resin particle;
wherein 75% to 100% of the gold particles exist in a range of 50% of particle radius in a depth direction from a surface of the resin particle;
wherein the resin particle comprises a nitrogenous polymer having nitrogen ions on the main chain or the side chain, and the nitrogenous polymer is selected from the group consisting of poly-2-vinylpyridine, poly-3-vinylpyridine, poly-4-vinylpyridine and 2-(diisopropylamino)ethyl methacrylate.
US Pat. No. 10,689,640

METHOD FOR RAPIDLY SCREENING MICROBIAL HOSTS TO IDENTIFY CERTAIN STRAINS WITH IMPROVED YIELD AND/OR QUALITY IN THE EXPRESSION OF HETEROLOGOUS PROTEINS

Pfenex Inc., San Diego, ...

1. A method for selecting at least one optimal expression system for use in the expression of at least one heterologous recombinant protein, the method comprising:a. obtaining an array assembled using a method comprising:
placing in separate addressable locations on the array at least 10 nonidentical test expression systems, said at least 10 nonidentical test expression systems each comprising a different combination of
i. a Pseudomonad or E. coli host cell population, and
ii. at least one expression vector encoding the at least one heterologous recombinant protein,
wherein the array includes at least 5 different host cell populations and at least 2 different expression vectors, and further wherein at least 3 of said at least 5 different host cell populations are deficient in their expression of at least one protease;
b. simultaneously screening the at least 10 nonidentical test expression systems on the array, wherein at least one of the nonidentical test expression systems overexpresses the heterologous recombinant protein as compared to an indicator strain; and
c. selecting at least one optimal expression system based on improved expression of each at least one heterologous recombinant protein in the optimal expression system.
US Pat. No. 10,690,666

METHODS AND COMPOSITIONS FOR MODULATING TH-GM CELL FUNCTION

NATIONAL UNIVERSITY OF SI...

1. A method of treating an inflammatory disorder in a patient, comprising administering an effective amount of a modulating agent that inhibits Th-GM function,wherein the patient exhibits a limited response or no response to a TNF-? inhibitor therapy, wherein the inflammatory disorder is mediated by granulocyte macrophage colony-stimulating factor (GM-CSF)-secreting T-helper (Th-GM) cells
wherein the modulating agent is a signal transducer and activator of transcription 5 (STAT5) inhibitor, and
wherein the inflammatory disorder is rheumatoid arthritis.
US Pat. No. 10,688,102

COMBINATION TREATMENT FOR MIGRAINE AND OTHER PAIN

AXSOME THERAPEUTICS, INC....

1. A method of treating migraine, comprising administering a meloxicam and about 8 mg to about 13 mg of a rizatriptan, based upon the weight of the free base form of rizatriptan, to a human being who is suffering from an acute attack of migraine pain or migraine aura, wherein the meloxicam and the rizatriptan are administered within about 30 minutes of one another, wherein administering the meloxicam to the human being results in a Tmax of meloxicam of 110 minutes or less, and an AUC0-24 of meloxicam of about 30 ?g·hr/mL to about 50 ?g·hr/mL, and wherein two hours after the meloxicam and the rizatriptan are administered, the human being experiences greater relief from nausea than the human being would have experienced two hours after receiving the same amount of the meloxicam without the rizatriptan.
US Pat. No. 10,688,103

METHODS FOR TREATING HYPERSOMNIA

BALANCE THERAPEUTICS, INC...

1. A method for treating idiopathic hypersomnia in a subject comprising administering pentylenetetrazol (PTZ) to the subject having idiopathic hypersomnia, wherein the administering is effective to treat the idiopathic hypersomnia.
US Pat. No. 10,688,104

COMBINATION THERAPY WITH NOTCH AND PD-1 OR PD-L1 INHIBITORS

Eli Lilly and Company, I...

1. A method of treating colorectal cancer, comprising administering to a patient in need of treatment of colorectal cancer an effective amount of 4,4,4-trifluoro-N-[(1S)-2-[[(7S)-5-(2-hydroxyethyl)-6-oxo-7H-pyrido[2,3-d][3]benzazepin-7-yl]amino]-1-methyl-2-oxo-ethyl]butanamide, or a pharmaceutically acceptable salt or hydrate thereof, and an effective amount of a PD-1 or PD-L1 inhibitor selected from pembrolizumab, nivolumab, atezolizumab, durvalumab, and avelumab.
US Pat. No. 10,689,643

TARGETED TRANSPOSITION FOR USE IN EPIGENETIC STUDIES

ACTIVE MOTIF, INC., Carl...

1. A method of making a nucleic acid sequence library comprising:a. extracting chromatin from cells to provide a sample containing chromatin;
b. adding to said sample containing chromatin at least one assembled conjugate comprising a targeting protein covalently conjugated to a stable transposase:transposon complex containing a transposase complexed with a transposon cassette, wherein:
(i) the targeting protein binds a target protein or a target DNA-binding site; and
(ii) the transposon cassette comprises:
(1) transposase recognition sequences required for catalysis of a DNA integration reaction;
(2) one or more oligonucleotide bar code sequences to uniquely identify the conjugated protein; and
(3) primer sites for DNA amplification;
c. allowing said at least one conjugate to locate at its/their target proteins and/or target DNA-binding sites in said chromatin;
d. tagging nucleic acid in said chromatin with said conjugate by inducing an intermolecular reaction between said transposase recognition sequences and said nucleic acid; and
e. performing PCR amplification of the tagged nucleic acid using the primer sites.
US Pat. No. 10,690,670

ASSAYS FOR DETERMINING LEVELS OF PLASMA PROTEASE C1 INHIBITOR

Dyax Corp., Lexington, M...

1. A method, comprising:contacting a sample containing plasma protease C1 inhibitor (C1-INH) with a capture reagent, and
measuring a level of the C1-INH in the sample that binds to the capture reagent;
wherein the capture reagent comprises:
i) an active form of Factor XII,
ii) an active form of plasma kallikrein, or
iii) a combination of i) and ii);
wherein the active form of plasma kallikrein retains protease activity of a naturally occurring plasma kallikrein and the active form of Factor XII retains blood coagulation activity of a naturally occurring Factor XII.
US Pat. No. 10,687,594

HAIR COLOURATION, METHOD AND KIT THEREOF

Noxell Corporation, Hunt...

1. A method for treating hair comprising:a) carrying out the following sequence of steps:
i) applying a first composition comprising cationic polymer to a first portion of the hair wherein the cationic polymer is linear polyethylene imine and present from 0.1 g/L to 100 g/L; and
ii) applying a second composition comprising anionic polymer to a second portion of the hair wherein the anionic polymer is polystyrene sulfonate sodium salt and present from 0.1 g/L to 100 g/L;
the first and the second portions of the hair having at least one common area; and
b) repeating step a) at least once, wherein the common area of each of the repeated steps a) has at least one common area with:
the common area of step a); and
wherein step i) or ii) further comprises the subsequent sub-steps of removing the excess of respectively the first composition or the second composition from the hair or applying energy to the hair in the form of heat, ultrasounds, infrared or microwaves or washing or rinsing the hair.
US Pat. No. 10,690,671

ULTRAPURIFIED DSBA AND DSBC AND METHODS OF MAKING AND USING THE SAME

Genentech, Inc., South S...

1. A method for quantifying disulfide oxidoreductase C (Dsb C) in a sample, comprising detecting DsbC in the sample using a detection system and comparing the amount of DsbC detected in the sample with the detection of one or more concentrations of an ultrapure DsbC reference standard, wherein ultrapure DsbC comprises at least about 95% monomeric DsbC.
US Pat. No. 10,688,107

SCALABLE VITAMIN COMPOSITION UNIT DOSAGE FOR THE TREATMENT OF FAT-SOLUBLE VITAMIN DEFICIENCIES

Callion Pharma, LLC, Jon...

1. A scalable oral vitamin composition unit dosage adapted to treat a fat-soluble vitamin deficiency in a subject suffering from chronic malabsorption of fat-soluble vitamins, the unit dosage consisting essentially of:from about 500 to about 4000 IU vitamin D in the form of cholecalciferol;
from about 18 to about 300 IU vitamin E in the form of d-alpha tocopheryl polyethylene glycol 1000 succinate (TPGS) or a combination of TPGS and another form of vitamin E;
from about 500 to about 4000 mcg vitamin K in the form of phytonadione; and
from about 500 to about 4000 IU vitamin A in the form of a combination of retinyl palmitate and beta-carotene;
wherein the unit dosage is substantially free of additional vitamins, and wherein the unit dosage is scalable to satisfy fat-soluble vitamin supplementation requirements of the subject suffering from chronic malabsorption without inducing adverse toxic effects.
US Pat. No. 10,689,389

PROCESS FOR PREPARING OXYCODONE COMPOSITIONS

PURDUE PHARMA L.P., Stam...

1. A process for purifying a composition comprising an oxycodone free base or acid addition salt thereof comprising performing the following steps sequentially:(i) hydrogenating the composition in the presence of a hydrogenation catalyst under acidic conditions;
(ii) increasing the pH of the composition;
(iii) removing the hydrogenation catalyst; and
(iv) isolating the purified oxycodone free base or acid addition salt thereof.
US Pat. No. 10,689,646

TREATMENT OF GENETIC DISORDERS ASSOCIATED WITH DNA REPEAT INSTABILITY

BioMarin Technologies B.V...

1. A method for treating myotonic dystrophy type 1 in a subject, comprising administering to the subject an oligonucleotide comprising 10 to 50 nucleotides that is complementary to a repetitive nucleotide unit sequence of a pre-mRNA transcript, wherein the repetitive nucleotide unit is a CUG repetitive nucleotide unit.
US Pat. No. 10,690,672

METHODS FOR BREAST CANCER TREATMENT

George Mason Research Fou...

1. A method for treating breast cancer regardless of ER, PR and/or HER2 status, comprising, treating a subject identified as having breast cancer regardless of ER, PR and/or HER2 status with at least one tyrosine kinase inhibitor (“TKI”) that targets EGFR and HER2, wherein the efficacy of the at least one TKI has been determined by a) measuring protein levels of one or more biomarkers in cellular samples from the subject prior to treatment with the TKI, and b) comparing the measured protein levels of the one or more biomarkers from the subject to a baseline value for the respective one or more biomarkers, wherein an elevated or decreased level of the proteins of the one or more biomarkers indicates that the subject is a responder to the TKI, wherein a biomarker is selected from one or more of the following: ALK.Y1586; Cyclin.B1 total; EGFR.Y1068; EGFR.Y1173; EGFR.Y992; eIF4G.S1108; ERBB2.total; ERBB2.Y1248; ERBB2.Y877; ERBB4.Y1284; RET Y905; SHC Y317; an mTOR pathway score (which is the sum of the measurements for 4EBP1 S65; eIF4E S209; eIF4G S1108; eIF4G S1108; eIF4G S1108; mTOR S2448; p70S6K S371; p70S6K T389; p70S6K T412; S6RP S240/S244); a HER Family pathway score (which is the sum of the measurements for EGFR Y1068; EGFR Y1173; EGFR Y992; ERBB2 Y1248; ERBB3 Y1289; FAK Y576/Y577; SHC Y317; STAT5 Y694; RET Y905); and a RTK pathway score (which is the sum of the measurements for ALK Y1604; EGFR Y1068; EGFR Y1173; EGFR Y992; ERBB2 Y1248; ERBB3 Y1289; FAK Y576/Y577; SHC Y317; STAT5 Y694; ERBB2 Y877; ERBB4 Y1284; MET Y1234-Y1235; ROS Y2274; RET Y905), or combinations thereof.
US Pat. No. 10,688,108

PHARMACEUTICAL SPRAY COMPOSITION COMPRISING A VITAMIN D ANALOGUE AND A CORTICOSTEROID

1. A method of treating psoriasis, comprising administering to a patient a therapeutically effective amount of a sprayable, substantially anhydrous topical composition comprisingcalcipotriol or calcipotriol monohydrate,
betamethasone dipropionate,
a pharmaceutically acceptable propellant, present in amount between 45-95% w/w of the total composition,
a pharmaceutically acceptable lipid carrier, present in an amount between 5-55% w/w of the total composition, and
a pharmaceutically acceptable antioxidant,
wherein the composition does not include propylene glycol, and
wherein no more than 10% by weight of the calcipotriol or calcipotriol monohydrate has degraded after storage of the composition for 3 months at about 40° C.
US Pat. No. 10,689,647

METHODS AND COMPOSITIONS FOR THE SPECIFIC INHIBITION OF ANTITHROMBIN 3 (AT3) BY DOUBLE-STRANDED RNA

Dicerna Pharmaceuticals, ...

1. A nucleic acid comprising an oligonucleotide strand of 15-80 nucleotides in length, wherein said oligonucleotide strand is sufficiently complementary to a target AT3 mRNA sequence selected from SEQ ID NOs: 1921-2304 along at least 15 nucleotides of said oligonucleotide strand length to reduce AT3 target mRNA expression when said nucleic acid is introduced into a mammalian cell, wherein said oligonucleotide strand comprises a sequence selected from the group consisting of SEQ ID NOs: 385-768, and wherein said oligonucleotide strand comprises one or more modified nucleotides.
US Pat. No. 10,688,109

METHODS OF PREVENTING PLATELET ACTIVATION

Vanderbilt University, N...

1. A composition for reducing or substantially preventing platelet activation in drawn blood, comprising:an irreversible inhibitor of COX-1;
a compound for blocking activation of the purinergic receptors;
a compound for blocking the thromboxane receptor;
a compound for increasing intracellular cAMP concentration; and
a compound that blocks potassium-dependent coagulation factors.
US Pat. No. 10,689,648

SHORT INTERFERING NUCLEIC ACID (SINA) COMPOSITIONS

SIRNA THERAPEUTICS, INC.,...


wherein,
(a) the upper strand is the passenger strand and the lower strand is the guide strand of the double-stranded nucleic acid molecule; the guide strand is complementary to the target sequence and the passenger strand is complementary to the guide strand, wherein one or more mismatches between the guide strand and passenger strand and/or between the guide strand and the target sequence are tolerated so long as RNAi activity is maintained;
(b) each N is independently a nucleotide wherein one or more Ns may be substituted with a non-nucleotide moiety so long as RNAi activity is maintained;
(c) each B1, B2, and B3 is independently a terminal cap optionally including a ligand, polymer, protein or peptide transduction domain, nuclear localization sequence, cell penetrating peptide, receptor, steroid, vitamin, antibody, protamine, and/or hormone, optionally attached via a linker, wherein any of B1, B2, and/or B3 is optionally absent;
(d) x is an integer from 0 to 4, provided that when x is 1, 2, 3, or 4, one or more of the (N)x nucleotides can be complementary to nucleotides in target sequence, and one or more phosphorothioate internucleotide linkage(s) “s” can be present in the (N)x region when x is 1, 2, 3, or 4;
(e) y is an integer from 0 to 4, provided that when y is 1, 2, 3, or 4, one or more of the (N)y nucleotides can be complementary to nucleotides in target sequence, and one or more phosphorothioate internucleotide linkage(s) “s” can be present in the (N)y region when y is 1, 2, 3, or 4;
(f) N nucleotides of the guide strand are 2?-deoxy-2?-fluoro nucleotides and N nucleotides of the guide strand are 2?-O-methyl nucleotides, with an optional variance of 1 or 2 N or N nucleotides being tolerated provided that as RNAi activity is maintained;
(g) S=a phosphorothioate or phosphorodithioate internucleotide linkage wherein S1 is required and S2 and S3 are optional; and
(h) N nucleotides of the passenger strand are independently selected from ribonucleotide, 2?-O-alkyl nucleotide, 2?-deoxy-2?-fluoro nucleotide, 2?-deoxy nucleotide, and LNA.
US Pat. No. 10,690,674

ANTI-GITR ANTIBODIES FOR CANCER DIAGNOSTICS

BRISTOL-MYERS SQUIBB COMP...

1. A method for determining the level of expression of glucocorticoid-induced tumor necrosis factor receptor (GITR) on tumor infiltrating lymphocytes (TILs) and/or tumor cells in a tissue sample, comprising:(a) contacting a tissue sample from a patient with an antibody, or antigen-binding portion thereof, comprising heavy chain variable region CDR1, CDR2, and CDR3 comprising the amino acid sequences set forth in SEQ ID NOs: 5-7, respectively, and light chain variable region CDR1, CDR2, and CDR3 comprising the amino acid sequences set forth in SEQ ID NOs: 8-10, respectively, wherein the antibody or antigen binding portion thereof binds to human GITR,
(b) detecting the binding of the antibody to GITR on TILs and/or tumor cells of the tissue sample, and optionally
(c) staining the tissue sample with markers of TILs and/or tumor cells, and/or with hematoxylin and eosin, to identify the TILs and/or tumor cells that were identified as GITR positive in step (b).
US Pat. No. 10,688,110

COMPLEXES OF CELECOXIB AND ITS SALTS AND DERIVATIVES, PROCESS FOR THE PREPARATION THEREOF AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM

NanGenex Nanotechnology I...

1. A pharmaceutical composition in the form of liquid dispersible granules comprising:amorphous celecoxib;
at least one complexation agent that is a copolymer of vinylpyrrolidone and vinyl acetate;
at least one pharmaceutically acceptable excipient that is sodium lauryl sulfate; and
at least one sweetener chosen from aspartame, neotame, sucralose, acesulfame potassium, saccharin, and saccharin sodium,
said complex characterized in that it has a PAMPA permeability of at least 0.5×10?6 cm/s when dispersed in FaSSIF or FeSSIF biorelevant media, which does not decrease in time at least for 1 month.
US Pat. No. 10,689,392

ANTI-CANCER COMPOUNDS TARGETING RAL GTPASES AND METHODS OF USING THE SAME

THE REGENTS OF THE UNIVER...

1. A compound selected from the group consisting of:3-(3,4-dimethoxyphenyl)-1-methyl-1H-pyrazol-5(4H)-one
3-(3,4-dimethoxyphenyl)-1-phenyl-1H-pyrazol-5(4H)-one
3-(4-methoxyphenyl)-1-methyl-1H-pyrazol-5(4H)-one
6-amino-3-methyl-1,4-diphenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-fluorophenyl)-3-methyl-1-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-1,3-dimethyl-4-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-1-methyl-3,4-diphenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-1,3,4-triphenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3-(4-methoxyphenyl)-1,4-diphenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3-(4-methoxyphenyl)-1-methyl-4-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3-(3,4-dimethoxyphenyl)-1-methyl-4-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-fluorophenyl)-1,3-dimethyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-fluorophenyl)-1-methyl-3-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-fluorophenyl)-1,3-diphenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3-(3,4-dimethoxyphenyl)-4-(4-fluorophenyl)-1-methyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-fluorophenyl)-3-(4-methoxyphenyl)-1-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3-(3,4-dimethoxyphenyl)-4-(4-fluorophenyl)-1-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-fluorophenyl)-3-(4-methoxyphenyl)-1-methyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-methoxyphenyl)-3-methyl-1-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-methoxyphenyl)-1,3-dimethyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-methoxyphenyl)-1-methyl-3-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-4-(4-methoxyphenyl)-1,3-diphenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3,4-bis(4-methoxyphenyl)-1-phenyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile
6-amino-3,4-bis(4-methoxyphenyl)-1-methyl-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile and salts thereof.
US Pat. No. 10,689,649

PHARMACEUTICAL COMPOSITION FOR TREATING AND/OR PREVENTING CANCER

TORAY INDUSTRIES, INC., ...

1. A method for treating a cancer in a subject who suffers or has suffered from the cancer, comprising administering a pharmaceutical composition for treating a cancer to the subject, wherein the pharmaceutical composition comprises, as an active ingredient, a polynucleotide comprising the nucleotide sequence as set forth in SEQ ID NO:1 or 2 and, wherein the polynucleotide further comprises a nucleotide sequence of the following (a) or (b) on the 3? terminal side of the nucleotide sequence asset forth in SEQ ID NO:1 or 2:(a) the nucleotide sequence as set forth in any one of SEQ ID NOs: 3 to 5, or
(b) a nucleotide sequence comprising a deletion, substitution or insertion of 1 to 3 nucleotides in the nucleotide sequence as set forth in any one of SEQ ID NOs: 3 to 5,and wherein the cancer is pancreatic cancer, breast cancer, lung cancer, stomach cancer, liver cancer, or colorectal cancer.
US Pat. No. 10,688,111

LIQUID FORMULATIONS OF COMPOUNDS ACTIVE AT SULFONYLUREA RECEPTORS

Biogen Chesapeake LLC, C...

1. A stable liquid formulation suitable for parenteral administration to a patient, comprising:10 mM to 50 mM meglumine;
glibenclamide or a pharmaceutically acceptable salt thereof at a concentration of about 0.5 mg/ml to about 1 mg/ml;
a pharmaceutically acceptable infusion solution comprising water, a pharmaceutically acceptable base, and a sugar alcohol;
said liquid formulation has a pH of about pH 9 or higher and is formulated for parenteral administration, wherein the glibenclamide or pharmaceutically acceptable salt thereof has stability and solubility properties such that it does not precipitate out of the solution during or following dilution or when frozen or refrigerated, and
wherein said formulation has stability and solubility properties such that it is stable upon storage for six months, and
wherein said formulation has stability and solubility properties such that it remains free from visible particles upon storage for at least one month.
US Pat. No. 10,689,650

METHOD OF FIXING AND EXPRESSING PHYSIOLOGICALLY ACTIVE SUBSTANCE

(NATIONAL UNIVERSITY CORP...

1. A method of treating an inflammatory bowel disease, comprising:directly injecting a formulation comprising siRNA into a target site of a submucous tissue of large intestine in a subject such that the siRNA suppresses expression of a targeted sequence,
wherein the formulation comprises the siRNA in a naked form without any viral vector, and the siRNA comprises sequences of SEQ ID NO: 1 and SEQ ID NO: 2 and suppresses expression of GalNAc4S-6ST gene.
US Pat. No. 10,689,651

METHOD OF INHIBITING MACROPHAGE ACTIVATION USING AN INHIBITOR OF PARP9

1. A method of inhibiting macrophage activation comprising contacting a population of monocytes or macrophages with an effective amount of a composition comprising a lipid encapsulation formulation of an inhibitor of poly (ADP-ribose) polymerase family, member 9 (PARP9), wherein the inhibitor is an siRNA consisting of the sequence of SEQ ID NO: 33.
US Pat. No. 10,690,677

REAL TIME ELECTRONIC CELL SENSING SYSTEMS AND APPLICATIONS FOR CELL-BASED ASSAYS

ACEA Biosciences, Inc., ...

1. A method for identifying compounds that modulate cellular responses stimulated by IgE, the method comprising:a) providing an impedance-based system that monitors cell-substrate impedance of cells on a substrate;
b) introducing cells to the substrate of the system;
c) adding at least one test compound and IgE to the cells, wherein the at least one test compound is suspected of modulating cell responses stimulated by the IgE;
d) adding an antigen to the cells;
e) monitoring the cell-substrate impedance of cells on the substrate; and
f) analyzing the cell-substrate impedance to evaluate whether the at least one test compound alters a cellular response to stimulation with the IgE.
US Pat. No. 10,688,113

METHODS OF TREATING EYE PAIN WITH AMINOPHOSPHINIC DERIVATIVES

PHARMALEADS, Paris (FR)

1. A method for treating eye pain in a subject in need thereof, the method comprising:administering a compound having formula (I) to the subject, the compound having formula (I) being:
R1—NH—CH(R2)—P(?O)(OH)—CH2—C(R3)(R4)—CONH—C(R5)(R6)—COOR7 wherein:R1 is:
a hydrogen, or
an (acyloxy)alkyl carbamate group —C(?O)—O—C(R)(R?)—OC(?O)—R? wherein R and R? are each independently a hydrogen, an alkyl group and R? is an alkyl group;
R2 is:
a linear or branched, saturated or unsaturated hydrocarbon chain having from 1 to 6 carbon atoms;
R3 and R4 are each independently:
a hydrogen
a phenyl or benzyl group, optionally substituted on the phenyl ring by:
*1 to 5 halogen atoms;
*an OH, SH, OR? or SR? radical, R? is an alkyl group;
*an amino group optionally mono- or di-substituted by a cyclic or linear aliphatic group having from 1 to 6 carbon atoms;
*a trifluoromethyl group;
*an aromatic or heteroaromatic group having 5 or 6 atoms;
a heteroaromatic group having 5 or 6 atoms, containing 1 or 2 heteroatom(s) selected from oxygen, nitrogen or sulphur, wherein the sulphur and nitrogen atoms may be oxidized in S-oxide or N-oxide form; or
a methylene substituted by an aromatic or saturated heterocycle having 5 or 6 atoms, the heteroatom being an oxygen, a nitrogen or a sulphur, wherein the nitrogen and sulphur atoms may be oxidized in N-oxide or S-oxide form;
R3 and R4 are not simultaneously a hydrogen atom;
R5 and R6 are each independently:
a hydrogen atom; or
a linear or branched, saturated or unsaturated hydrocarbon chain having from 1 to 6 carbon atoms; and
R7 is:
a hydrogen;
a CH2COOR?? or CH(CH3)COOR?? radical, R?? being:
*a saturated hydrocarbon chain having from 1 to 6 carbon atoms, optionally substituted by a C1 to C3 alkoxy group;
*a C5 to C8 cycloalkyl group;
*a phenyl, benzyl or alkyl group; or
a CH(R)O—C(O)OR? or CH(R)OC(O)R? group wherein R and R? are each independently a hydrogen or an alkyl group;
or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,689,652

METHODS FOR IMMORTALIZATION OF EPITHELIAL CELLS

The Regents of the Univer...

1. A method of identifying an agent that prevents cell immortalization, comprising:culturing pre-stasis epithelial cells in a low stress-inducing medium;
measuring the level of cyclin-dependent kinase inhibitor 2A (p16) in the pre-stasis epithelial cells to determine status of induction of p16 in the pre-stasis epithelial cells;
prior to induction of p16 in the pre-stasis epithelial cells, introducing into the pre-stasis epithelial cells a polynucleotide that prevents the retinoblastoma protein (RB) from staying in an active form, to produce post-stasis epithelial cells, wherein the polynucleotide that prevents RB from staying in an active form is a p16 shRNA;
prior to telomere dysfunction, introducing:
an agent; and
a polynucleotide that induces telomerase activity, wherein the polynucleotide that induces telomerase activity encodes c-MYC,
into the post-stasis epithelial cells; and
subsequent to introducing the agent and the polynucleotide that induces telomerase activity, culturing the epithelial cells to determine whether the cells are immortalized, wherein when the cells are not immortalized, the agent is identified as an agent that prevents cell immortalization, wherein the method does not introduce gross genomic errors into the epithelial cells.
US Pat. No. 10,690,678

CELL-BASED ASSAY FOR DETECTING ANTI-CD3 HOMODIMERS

Genentech, Inc., South S...

1. A method for detecting anti-CD3 homodimers in a composition comprising a T cell dependent bispecific antibody (TDB) wherein the bispecific antibody comprises a target antigen binding fragment and a CD3 binding fragment, the method comprisingcontacting a population of T cells with the composition, wherein the T cells comprise nucleic acid encoding a reporter operably linked to a response element that is responsive to T cell activation, and wherein the population of T cells does not comprise the target antigen,
wherein expression of the reporter indicates the presence of anti-CD3 homodimers.
US Pat. No. 10,688,114

COMPOSITION AND METHODS OF USE OF SMALL MOLECULES AS BINDING LIGANDS FOR THE MODULATION OF PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9(PCSK9) PROTEIN ACTIVITY

SXR Cardio, LLC, Pittsfo...

1. A method, comprising binding an allosteric small molecule compound to a PCSK9 protein to modulate the uptake of low-density lipoprotein by a plurality of hepatocytes.
US Pat. No. 10,689,653

COMPOSITIONS AND METHODS FOR MODULATING DYSFERLIN EXPRESSION

University of Massachuset...

1. A method of modulating splicing in a cell that contains a DYSF gene comprising a c.4886+1249 (G>T) mutation, the method comprising:delivering to the cell an antisense nucleic acid that targets a pre-messenger RNA expressed from the DYSF gene and alters splicing of the pre-messenger RNA such that exons 44 and 45 of the pre-messenger RNA are spliced together without an intervening pseudoexon, wherein the antisense nucleic acid is complementary to the entirety of SEQ ID NO: 56 or SEQ ID NO: 58.
US Pat. No. 10,690,679

METHODS AND SYSTEMS FOR DISTINGUISHING IRRITABLE BOWEL SYNDROME FROM INFLAMMATORY BOWEL DISEASE AND CELIAC DISEASE

Cedars-Sinai Medical Cent...

1. An assay system for distinguishing irritable bowel syndrome (IBS) from inflammatory bowel disease (IBD) and celiac disease, comprising:a biological sample obtained from a subject desiring a diagnosis to distinguish IBS from both IBD and celiac disease,
vinculin or a fragment thereof and cytolethal distending toxin subunit B (CdtB) or a fragment thereof; and
one or more assays to detect in the biological sample, levels of anti-vinculin antibodies and anti-cytolethal distending toxin subunit B (CdtB) antibodies.
US Pat. No. 10,688,115

COMPOSITION COMPRISING KETONE BODY AND NICOTINAMIDE ADENINE DINUCLEOTIDE MODULATOR AND METHYL DONOR

Tecton Group, LLC, Memph...

1. A composition comprising a therapeutically effective amount of:(i) an exogenous ketone body, wherein the ketone body comprises an ester of BHB;
(ii) an exogenous nicotinamide adenine dinucleotide (“NAD”) modulator; and
(iii) betaine in an amount from 0.001 mg to 5,000 mg, wherein the ratio (w/w) of the exogenous ketone body to the exogenous NAD modulator is from 160:1 to 10:1.
US Pat. No. 10,689,654

BIVALENT SIRNA CHIMERAS AND METHODS OF USE THEREOF

Augusta University Resear...

1. A bivalent aptamer-siRNA chimera comprising:first and second ends, wherein the first and second ends comprise an aptamer that specifically binds a target protein; and
an siRNA construct between the first and second ends, wherein the siRNA construct is processed by cellular RNAi machinery to produce at least two different siRNAs that specifically inhibit expression of two or more different genes in a cell expressing the target protein.
US Pat. No. 10,690,681

METHODS TO DETECT MYOCARDIAL INJURY AND USES THEREOF

Washington University, S...

1. A method to detect an acute cardiovascular syndrome or disorder in a subject, the method comprising:a) detecting a level of cardiac troponin I (cTnI), fatty acid binding protein (FABP3) and ventricular myosin alkali light chain (MYL3) in a first, second and third biological sample obtained from the subject about 30 minutes apart;
b) comparing the level of cTnI, FABP3 and MYL3 detected in (a) to a reference level and comparing the level of cTnI, FABP3 and MYL3 between the first, second and third biological samples;
c) identifying the subject as having an acute cardiovascular syndrome or disorder when the level of cTnI, FABP3 and MYL3 is significantly increased relative to the reference level, wherein high levels of FABP3 in combination with the presence of cTnI and MYL3 indicates an acute cardiovascular syndrome or disorder from about 30 minutes to about 15 hrs from onset, wherein high levels mean greater than about 30 ng/ml, and wherein a positive rate of change and a positive change in the rate of change in cTnI, a positive rate of change in FABP3, and a positive then negative change in the rate of change in FABP3 indicates an acute cardiovascular disorder <4 hrs from onset; and
d) administering treatment to the identified subject of step c, wherein the treatment is one or more of antiplatelet agents, aspirin, clopidogrel, supplemental oxygen, nitrates, pain medication, beta blockers, metoprolol, atenolol, carvedilol, unfractionated heparin, low-molecular-weight heparain, dalteparin, enoxaparin, warfarin, fibrinolytics, angiotensin-converting enzyme inhibitors, angiotensin receptor blockers, captopril, Ramipril, Lisinopril, glycoprotein IIb/IIIa antagonists, abciximab, eptifibatide, tirofiban, statin therapy, aldosterone antagonists, percutaneous coronary intervention, surgical revascularization or implantable cardiac defibrillators.
US Pat. No. 10,688,117

TOPICAL WASH COMPOSITION FOR USE IN ACNE PATIENTS

GALDERMA S.A., Cham (CH)...

1. A foaming topical wash composition consisting of:(a) between 1% and 10% by weight of zinc coceth sulfate of active material (AM) relative to the total weight of the composition;
(b) between 0.15% and 0.3% by weight of zinc gluconate relative to the total weight of the composition; and
(c) between 0.25% and 0.3% by weight of dipotassium glycyrrhizate relative to the total weight of the composition; and
(d) one or more pharmaceutically acceptable excipients selected from the group consisting of: (i) gelling agents; (ii) viscosity increasing agents; (iii) emulsifiers; (iv) antioxidants selected from the group consisting of vitamin E and its derivatives, vitamin C and its derivatives, butylated hydroxytoluene, butylated hydroxyanisole, acetyl cysteine, citric acid, sodium metabisulfite, sodium sulfite, and combinations thereof; (v) vitamins and/or vitamin derivatives selected from the group consisting of vitamin E and its derivatives, vitamin C and its derivatives, vitamin B3, niacinamide, and combinations thereof; (vi) soothing agents and/or anti-irritants selected from the group consisting of PPG-12/SMDI copolymer, allantoin and its derivatives, hyaluronic acid, polyquaternium-51, D-panthenol, and aloe vera; (vii) lecithins and/or phospholipids; (viii) cholesterol and/or cholesterol derivatives; (ix) preservatives; (x) acids and/or bases; (xi) chelating agents; (xii) humectants; (xiii) wetting agents; (xiv) foam boosters; (xv) ingredients providing a smoothness of the foam; (xvi) perfume solubilizing agents; (xvii) perfumes and/or fragrances; (xviii) refatting agents; (xix) mineral, synthetic, or silicone oils; and (xx) water,
wherein the foaming topical wash composition does not contain ethanol.
US Pat. No. 10,689,656

EXPRESSION CONSTRUCTS AND METHODS OF GENETICALLY ENGINEERING METHYLOTROPHIC YEAST

Impossible Foods Inc., R...

1. A methylotrophic yeast cell comprising a recombinant nucleic acid molecule, wherein the recombinant nucleic acid molecule comprises a first exogenous nucleic acid encoding a methanol expression regulator 1 (Mxr1) transcriptional activator operably linked to at least one methanol-inducible promoter element comprising a sequence to which the Mxr1 transcriptional activator binds, wherein the recombinant nucleic acid molecule comprises a second exogenous nucleic acid encoding a heterologous polypeptide operably linked to at least one methanol-inducible promoter element.
US Pat. No. 10,688,118

NICOTINAMIDE RIBOSIDE COMPOSITIONS FOR TOPICAL USE IN TREATING SKIN CONDITIONS

ChromaDex Inc., Irvine, ...

1. A method for repairing a wound in the skin of an individual, comprising topically administering to the individual in need of such treatment over at least about 24 hours, or more, a therapeutically effective amount of the compound nicotinamide riboside, or a salt thereof, wherein skin cells in the skin have increased motility effecting wound repair.
US Pat. No. 10,689,657

REGULATORY NUCLEIC ACID MOLECULES FOR ENHANCING CONSTITUTIVE GENE EXPRESSION IN PLANTS

BASF PLANT SCIENCE COMPAN...

1. A method for production of a high expression constitutive plant promoter, comprising functionally linking to a constitutive promoter one or more nucleic acid expression enhancing nucleic acid (NEENA) molecule heterologous to said promoter, wherein said NEENA consists of the nucleic acid sequence of SEQ ID NO: 4; wherein said high expression constitutive plant promoter has higher constitutive expression activity as compared to the constitutive promoter without said one or more NEENA.
US Pat. No. 10,688,119

INHIBITORS OF PCSK9 FOR TREATMENT OF LIPOPROTEIN METABOLISM DISORDERS

Aarhus Universitet, Aarh...

1. An antibody or antigen-binding fragment thereof that specifically binds a binding region within the HSPG binding site of PCSK9 (SEQ ID NO: 1), said site within amino acid residues 78 to 167 of PCSK9 (SEQ ID NO: 1), wherein:(a) the antibody or antigen-binding fragment thereof comprises:
(i) a heavy chain variable region or a humanized version thereof, comprising three CDRs, wherein heavy chain CDR1 comprises SEQ ID NO: 10: heavy chain CDR2 comprises SEQ ID NO: 11; and heavy chain CDR3 comprises SEQ ID NO: 12, and
(ii) a light chain variable region or a humanized version thereof, comprising three CDRs, wherein light chain CDR1 comprises SEQ ID NO: 13; light chain CDR2 comprises SEQ ID NO: 14; and light chain CDR3 comprises SEQ ID NO: 15; or
(b) the antibody or antigen-binding fragment thereof comprises:
(i) a heavy chain variable region or a humanized version thereof, comprising three CDRs, wherein heavy chain CDR1 comprises SEQ ID NO: 16; heavy chain CDR2 comprises SEQ ID NO: 17; and heavy chain CDR3 comprises SEQ ID NO: 18, and
(ii) a light chain variable region or a humanized version thereof, comprising three CDRs, wherein light chain CDR1 comprises SEQ ID NO: 19; light chain CDR2 comprises SEQ ID NO: 20; and light chain CDR3 comprises SEQ ID NO: 21.
US Pat. No. 10,689,658

NUCLEIC ACID ENCODING N-METHYLPUTRESCINE OXIDASE AND USES THEREOF

22nd Century Limited, LLC...

1. A tobacco plant comprising plant cells into which one or more mutations are introduced into the region of SEQ ID NO: 1 or SEQ ID NO: 2 that encodes a polypeptide having the amino acid sequence set forth in SEQ ID NO: 3, wherein the plant exhibits reduced expression of a gene product encoded by SEQ ID NO: 1 or SEQ ID NO: 2 as compared to a control tobacco plant.
US Pat. No. 10,688,120

ALLERGY VACCINE COMPOSITION

NITTO DENKO CORPORATION, ...

1. A method of inducing immune tolerance to an allergen in a mammalian subject comprising administering to the subject a composition comprising a mixture of the allergen and an immunomodulator, whereinthe allergen-specific IgE titer of the mammalian subject is reduced compared to the allergen-specific IgE titer induced in a corresponding mammalian subject administered with the allergen without the immunomodulator,
the mass ratio of the total mass of the immunomodulator to the total mass of the allergen in the composition is in the range of 0.01 to 10;
the immunomodulator is a lipopolysaccharide isolated from the gram-negative bacterium Pantoea or a salt of the lipopolysaccharide; and
the allergen is a tree pollen selected from the group consisting of tree pollens from Acacia, Alder, Ash, American Beech, Birch, Box Elder, Mountain Cedar, Red Cedar, Cottonwood, Japanese Cypress, American Elm, Chinese Elm, Japanese Douglas fir, Sweetgum, Eucalyptus, Hackberry, Hickory, Linden, Sugar Maple, Mesquite, Mulberry, Oak, Olive, Pecan, Pepper Tree, Pine, Privet, Russian Olive, American Sycamore, Tree of Heaven, Walnut, and Black Willow.
US Pat. No. 10,689,659

WHEAT WITH REDUCED LIPOXYGENASE ACTIVITY

ARCADIA BIOSCIENCES, INC....

1. A food or a food product comprising wheat grain or flour from said wheat grain, wherein said wheat grain or flour comprises a human induced alteration in an Lpx1 gene in a D genome, wherein the wheat grain or the flour has a property selected from the group consisting of: (a) increased shelf-life; (b) increased oxidative stability; (c) decreased production of Lpx1 protein; (d) decreased lipoxygenase activity; (e) decreased hexanal production; (f) decreased pinellic acid production; (g) decreased decomposition products from fatty acids; and (h) improved sensory characteristics as compared to grain from a wild type wheat plant or flour from wild type wheat grain.
US Pat. No. 10,688,121

GRANULAR COMPOSITION FOR ORAL ADMINISTRATION

ALPEX PHARMA S.A., Mezzo...

1. A granular composition for oral administration comprising a non soluble resin and a highly porous silica gel having a mesoporous structure, wherein the highly porous silica gel is in the range of 0.1%-5% (w/w).
US Pat. No. 10,689,660

COMPOSITIONS AND METHODS FOR MEDIATING PLANT STOMATAL DEVELOPMENT IN RESPONSE TO CARBON DIOXIDE AND APPLICATIONS FOR ENGINEERING DROUGHT TOLERANCE IN PLANTS

THE REGENTS OF THE UNIVER...

1. A method for:increasing the number of stomatal cores corn oared to the total number of cells, or increasing the stomatal density, stomatal index and/or stomatal size, in a plant, plant part, a plant organ, a plant leaf;
up-regulating or increasing carbon dioxide (CO2) and/or water exchange in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
decreasing the water use efficiency of a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
decreasing or desensitizing the carbon dioxide (CO2) sensitivity of a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
upregulating or increasing carbon dioxide (CO2) and/or water exchange in a guard cell, a root cell, a stomatal lineage stage-specific rev, a plant leaf, a plant organ, a plant part or a plant;
increasing the uptake of CO2 in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
decreasing drought tolerance in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant; or
increasing the heat resistance or tolerance, optionally increasing the heat resistance or tolerance, under conditions of drought or increased atmospheric carbon dioxide;
comprising:
decreasing the expression and/or activity of:
(1) a nucleic acid encoding an ATSBT5.2-like protein; or
(2) an ATSBT5.2-like protein;
wherein the ATSBT5.2-like protein comprises:
a) the amino acid sequence as set forth in SEQ ID NO: 5, and
wherein the decreasing of expression and/or activity of the ATSBT5.2-like protein, is by:
introducing to a guard cell, root cell, stomatal lineage stage-specific cell, plant leaf, plant organ, plant part or plant a nucleic acid encoding a heterologous antisense nucleotide, interfering RNA, or microRNA that targets the ATSBT5.2-like protein-encoding nucleic acid sequence; and,
expressing the heterologous antisense nucleotide, interfering RNA, or microRNA, in the guard cell, root cell, stomatal lineage stage-specific cell, plant leaf, plant organ, plant part or plant,
or introducing to a guard cell, root cell, stomatal lineage stage-specific cell, plant leaf, plant organ, plant part or plant a heterologous antisense nucleotide, interfering RNA or microRNA that targets the ATSBT5.2-like protein-encoding nucleic acid sequence
wherein the heterologous antisense nucleotide, interfering RNA or microRNA comprises a nucleotide sequence having at least about 11, 12, 13, 14, 15, 16, 17, 18, or 19 or more consecutive nucleotides of a nucleotide sequence encoding the sequence of SEQ ID NO:5, or the complement thereof;
thereby:
increasing the number of stomatal pores compared to the total number of cells, or increasing the stomatal density, stomatal index and/or stomatal size, in a plant, plant part, a plant organ, a plant leaf;
up-regulating or increasing carbon dioxide (002) and/or water exchange in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
decreasing the water use efficiency of a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
decreasing or desensitizing the carbon dioxide (CO2) sensitivity of a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
upregulating or increasing carbon dioxide (CO2) and/or water exchange in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
increasing the uptake of CO2 in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant;
decreasing drought tolerance in a guard cell, a root cell, a stomatal lineage stage-specific cell, a plant leaf, a plant organ, a plant part or a plant; or
increasing the heat resistance or tolerance, optionally increasing the heat resistance or tolerance under conditions of drought or increased atmospheric carbon dioxide.
US Pat. No. 10,690,686

ANTIBODIES TO RISPERIDONE AND USE THEREOF

JANSSEN PHARMACEUTICA NV,...

1. An isolated antibody or a binding fragment thereof, which binds to risperidone comprising:a) a light chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:3, and a heavy chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:4, wherein the light chain CDR1 sequence comprises amino acid residues 44 to 60 of SEQ ID NO:3; the light chain CDR2 sequence comprises amino acid residues 76 to 82 of SEQ ID NO:3; the light chain CDR3 sequence comprises amino acid residues 115 to 123 of SEQ ID NO:3; the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:4; the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:4; and the heavy chain CDR3 sequence comprises amino acid residues 118 to 122 of SEQ ID NO:4;
b) a light chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:68, SEQ ID NO:70, or SEQ ID NO:72, and a heavy chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, or SEQ ID NO:66, wherein
i) the light chain CDR1 sequence comprises amino acid residues 44 to 54 of SEQ ID NO:68, the light chain CDR2 sequence comprises amino acid residues 70 to 76 of SEQ ID NO:68, and the light chain CDR3 sequence comprises amino acid residues 109 to 117 of SEQ ID NO:68,
ii) the light chain CDR1 sequence comprises amino acid residues 44 to 58 of SEQ ID NO:70, the light chain CDR2 sequence comprises amino acid residues 74 to 80 of SEQ ID NO:70, and the light chain CDR3 sequence comprises amino acid residues 113 to 121 of SEQ ID NO:70, or
iii) the light chain CDR1 sequence comprises amino acid residues 44 to 58 of SEQ ID NO:72, the light chain CDR2 sequence comprises amino acid residues 74 to 80 of SEQ ID NO:72, and the light chain CDR3 sequence comprises amino acid residues 113 to 121 of SEQ ID NO:72, and
iv) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:58, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:58, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 125 of SEQ ID NO:58,
v) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:60, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:60, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 128 of SEQ ID NO:60,
vi) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:62, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:62, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 128 of SEQ ID NO:62,
vii) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:64, the heavy chain CDR2 sequence comprises amino acid residues 69 to 87 of SEQ ID NO:64, and the heavy chain CDR3 sequence comprises amino acid residues 120 to 127 of SEQ ID NO:64, or
viii) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:66, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:66, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 126 of SEQ ID NO:66;
c) a light chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:76 or SEQ ID NO:78, and a heavy chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:74, wherein
i) the light chain CDR1 sequence comprises amino acid residues 44 to 54 of SEQ ID NO:76, the light chain CDR2 sequence comprises amino acid residues 70 to 76 of SEQ ID NO:76, and the light chain CDR3 sequence comprises amino acid residues 109 to 117 of SEQ ID NO:76; or
ii) the light chain CDR1 sequence comprises amino acid residues 46 to 55 of SEQ ID NO:78, a light chain CDR2 sequence comprises amino acid residues 71 to 77 of SEQ ID NO:78, and a light chain CDR3 sequence comprises amino acid residues 110 to 117 of SEQ ID NO:78; and
iii) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:74, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:74, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 126 of SEQ ID NO:74;
d) a light chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:86, SEQ ID NO:88, or SEQ ID NO:90, and a heavy chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:80, SEQ ID NO:82, or SEQ ID NO:84, wherein
i) the light chain CDR1 sequence comprises amino acid residues 43 to 58 of SEQ ID NO:86, the light chain CDR2 sequence comprises amino acid residues 74 to 80 of SEQ ID NO:86, and the light chain CDR3 sequence comprises amino acid residues 113 to 121 of SEQ ID NO:86;
ii) the light chain CDR1 sequence comprises amino acid residues 44 to 59 of SEQ ID NO:88, the light chain CDR2 sequence comprises amino acid residues 75 to 81 of SEQ ID NO:88, and the light chain CDR3 sequence comprises amino acid residues 114 to 122 of SEQ ID NO:88; or
iii) the light chain CDR1 sequence comprises amino acid residues 44 to 54 of SEQ ID NO:90, the light chain CDR2 sequence comprises amino acid residues 70 to 76 of SEQ ID NO:90, and the light chain CDR3 sequence comprises amino acid residues 109 to 117 of SEQ ID NO:90, and
iv) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:80, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:80, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 125 of SEQ ID NO:80;
v) the heavy chain CDR1 sequence comprises amino acid residues 44 to 53 of SEQ ID NO:82, the heavy chain CDR2 sequence comprises amino acid residues 68 to 84 of SEQ ID NO:82, and the heavy chain CDR3 sequence comprises amino acid residues 117 to 122 of SEQ ID NO:82; or
vi) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:84, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:84, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 130 of SEQ ID NO:84;
e) a light chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:94, and a heavy chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:92, wherein the light chain CDR1 sequence comprises amino acid residues 44 to 60 of SEQ ID NO:94, the light chain CDR2 sequence comprises amino acid residues 76 to 82 of SEQ ID NO:94, the light chain CDR3 sequence comprises amino acid residues 115 to 123 of SEQ ID NO:94, the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:92, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:92, and the heavy chain CDR3 sequence comprises amino acid residues 118 to 124 of SEQ ID NO:92;
or
f) a light chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:100, and a heavy chain variable region comprising CDR1, CDR2 and CDR3 of SEQ ID NO:96 or SEQ ID NO:98, wherein the light chain CDR1 sequence comprises amino acid residues 44 to 54 of SEQ ID NO:100, the light chain CDR2 sequence comprises amino acid residues 70 to 76 of SEQ ID NO:100, and the light chain CDR3 sequence comprises amino acid residues 109 to 117 of SEQ ID NO:100, and
i) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:96, the heavy chain CDR2 sequence comprises amino acid residues 69 to 87 of SEQ ID NO:96, and the heavy chain CDR3 sequence comprises amino acid residues 120 to 128 of SEQ ID NO:96; or
ii) the heavy chain CDR1 sequence comprises amino acid residues 45 to 54 of SEQ ID NO:98, the heavy chain CDR2 sequence comprises amino acid residues 69 to 85 of SEQ ID NO:98, and the CDR3 sequence comprises amino acid residues 118 to 127 of SEQ ID NO:98.
US Pat. No. 10,689,661

NUCLEOTIDE SEQUENCES AND POLYPEPTIDES ENCODED THEREBY USEFUL FOR MODIFYING PLANT CHARACTERISTICS IN RESPONSE TO COLD

CERES, INC., Thousand Oa...

1. A method of producing a plant and/or plant tissue, said method comprising growing a plant cell comprising an exogenous nucleic acid, said exogenous nucleic acid comprising a regulatory region operably linked to a nucleotide sequence encoding a polypeptide, wherein said polypeptide has 90% or greater sequence identity to the amino acid sequence of SEQ ID NO:2 and wherein a plant produced from said plant cell has an increased level of cold tolerance as compared to the corresponding level of cold tolerance of a control plant that does not comprise said nucleic acid.
US Pat. No. 10,688,124

AMORPHOUS CALCIUM CARBONATE FOR THE TREATMENT OF CALCIUM MALABSORPTION AND METABOLIC BONE DISORDERS

AMORPHICAL LTD, Beer-She...

1. A method for enhancement of bone mineral density in a subject suffering from a bone metabolism associated disorder, disease, or condition, the method comprising:orally administering to said subject an effective amount of a composition comprising stable amorphous calcium carbonate (ACC) having at least one stabilizer, in combination with a bisphosphonate, wherein the bisphosphonate is administered in a dose lower than a standard therapeutic dose, wherein the composition is present in an oral dosage form, and wherein each dosage form comprises at least 1% of elemental calcium from ACC and wherein the method comprises administering at least 2 ?g/kg of bisphosphonates.
US Pat. No. 10,689,405

TITANIUM-CONTAINING FILM FORMING COMPOSITIONS FOR VAPOR DEPOSITION OF TITANIUM-CONTAINING FILMS

1. A titanium-containing film forming composition comprising a titanium halide-containing precursor having the following formula:TiXb:Ac
with b=3 or 4; c=1-3; X=Br or I; A=SRR?, SeRR?, or TeRR?, and R and R? are independently H or a C1-C5 hydrocarbon, wherein the Ti halide-containing precursor is a liquid at standard temperature and pressure.
US Pat. No. 10,689,662

ISOLATED POLYNUCLEOTIDES AND POLYPEPTIDES FOR INCREASING PLANT YIELD AND/OR AGRICULTURAL CHARACTERISTICS

Evogene Ltd., Rehovot (I...

1. A method of increasing yield, biomass, growth rate, abiotic stress tolerance, and/or nitrogen use efficiency of a plant, the method comprising:(a) expressing within the plant a heterologous polynucleotide comprising a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 618 or a naturally occurring orthologue thereof comprising an amino acid sequence having at least 96% sequence identity to SEQ ID NO: 618 and having conservative amino acid substitutions with respect to SEQ ID NO: 618, and
(b) selecting plants resultant from step (a) expressing said heterologous polynucleotide for an increased yield, biomass, growth rate, abiotic stress tolerance, and/or nitrogen use efficiency of a plant as compared to a wild type plant of the same species which is grown under the same growth conditions, wherein said abiotic stress comprises nitrogen-limiting conditions,thereby increasing the yield, biomass, growth rate, abiotic stress tolerance, and/or nitrogen use efficiency of the plant.
US Pat. No. 10,689,406

MODIFIED LECITHIN FOR ASPHALT APPLICATIONS

CARGILL, INCORPORATED, W...

1. A method, comprising:(a) obtaining a lecithin-containing material, comprising 20-80 wt % acetone insoluble matter, 1-30 wt % free fatty acid, and less than 10 wt % water;
(b) adding a fatty acid source to the lecithin-containing material to obtain a lecithin fatty acid blend; and
(c) incorporating the lecithin fatty acid blend into asphalt or oil field applications.
US Pat. No. 10,688,126

SILVER NANOPLATE COMPOSITIONS AND METHODS

nanoComposix, Inc., San ...

1. A process for making concentrated silver nanoplates that preserve shape post-concentration while increasing optical density, the process comprising:adding a stabilizing agent to a pre-concentrated solution, wherein the stabilizing agent comprises at least one of the group consisting of: an aminopropyltriethoxysilane (APTES), an amine moiety, a lipoic acid, a mercaptohexadecanoic acid, a mercaptoundecanoic acid, and a dihydrolipoic acid;
wherein the pre-concentrated solution comprises silver nanoplates,
wherein each of the silver nanoplates has a plate shape,
wherein the pre-concentrated solution has a peak optical density at a first wavelength; and
increasing a concentration of the silver nanoplates in the pre-concentrated solution to generate a concentrated solution,
wherein the concentrated solution has a peak optical density at a second wavelength,
wherein the first wavelength is substantially the same as the second wavelength, wherein the peak optical density of the concentrated solution is greater than the peak optical density of the pre-concentrated solution, and
wherein at least a portion of the silver nanoplates in the pre-concentrated solution retain the plate shape in the concentrated solution, wherein the peak optical density of the concentrated solution is at least ten times higher than the peak optical density of the pre-concentrated solution and wherein the peak optical density of the concentrated solution is at least 100 cm?1.
US Pat. No. 10,689,664

NUCLEIC ACID MOLECULE FOR CONFERRING INSECTICIDAL PROPERTIES IN PLANTS

Syngenta Participations A...

1. A nucleic acid molecule comprising a nucleic acid sequence that is at least 98% identical to SEQ ID NO: 1 and encodes mCry3A and eCry3.1Ab insecticidal proteins, or the complement thereof.
US Pat. No. 10,688,127

METHODS OF USING GRAPHENE AND GRAPHENE-RELATED MATERIALS FOR MANIPULATION OF CELL MEMBRANE POTENTIAL

7. A method of using an activating system for performing a biological assay, the method comprising:eliciting changes in a functional state of at least one biological target, said eliciting changes comprising:
providing the activating system, the activating system comprising:
at least one biointerface adapted to generate free charge carriers in response to exposure to electromagnetic radiation, the at least one biointerface comprising one or more materials comprising at least one graphene sheet, graphene oxide, reduced graphene oxide, graphite, graphite oxide, or combinations thereof;
at least one source of electromagnetic radiation adapted to expose the at least one biointerface to the electromagnetic radiation; and
the at least one biological target comprising live cells that contact or are positioned in sufficient proximity to the at least one biointerface such that cell membrane potentials of the live cells are remotely and reversibly manipulated by the free charge carriers generated by exposure of the at least one biointerface to the electromagnetic radiation;
positioning the at least one biological target and the at least one biointerface; and
exposing the at least one biointerface to the electromagnetic radiation from the at least one source of electromagnetic radiation, generating the free charge carriers, and remotely and reversibly manipulating the cell membrane potentials of the live cells; and
monitoring said changes in the at least one biological target using one or more detection methods.
US Pat. No. 10,689,665

HYBRID RICE HR180001

RICETEC, INC., Alvin, TX...

1. Hybrid rice seed HR180001, wherein a representative sample of seed was deposited under ATCC Accession No. PTA-125519.
US Pat. No. 10,688,128

USE OF Z-BUTYLIDENEPHTHALIDE IN ACTIVATING AUTOIMMUNE SYSTEM

EVERFRONT BIOTECH INC., ...

1. A method for activating autoimmune system, comprising administering to a subject for inhibition of expression of immune checkpoint antigens of cancer cells an effective amount of Z-butylidenephthalide (Z-BP) and an effective amount of mononuclear cells.
US Pat. No. 10,689,666

INSECT INHIBITORY TOXIN FAMILY ACTIVE AGAINST HEMIPTERAN AND/OR LEPIDOPTERAN INSECTS

MONSANTO TECHNOLOGY LLC, ...

1. A recombinant nucleic acid molecule comprising a heterologous promoter operably linked to a polynucleotide segment encoding an insect inhibitory protein, whereinsaid insect inhibitory protein comprises an amino acid sequence having at least 80% amino acid sequence identity to SEQ ID NO:2.
US Pat. No. 10,688,129

METHOD OF PRODUCING A DESIGNER BLOOD PRODUCT, METHOD OF USING A DESIGNER BLOOD PRODUCT, AND DIET FOR SELECTIVELY ENHANCING BLOOD PROFILE

CENTRAL BIOMEDIA, INC., ...

1. A method of producing a serum for administration to an equine patient, said method comprising the steps of:(a) pre-treating at least one donor horse with a diet and immunization regimen for at least one month wherein said diet and immunization regimen is different from a prior diet and/immunization routine of the donor horse prior to the pre-treating step, said diet and immunization regimen comprising:
(i) feeding said donor horse a combined amount of EPA and DHA ranging from 60 mg/kg horse/day to 65 mg/kg horse/day with the EPA:DHA ratio ranging from 1:5-5:1, and alfalfa hay; and
(ii) immunizing said donor horse with the following vaccinations Rhodococcus equi, Streptococcus equi, Escherichia coli, 7-way Clostridial, equine herpes virus and equine influenza;
(b) drawing blood from said at least one donor horse;
(c) permitting said blood to clot, thereby producing clotted blood comprising a liquid material and a cellular material;
(d) separating said liquid material from said cellular material; and
(e) concentrating said liquid material into a concentrated serum product.
US Pat. No. 10,689,410

RECOVERY OF STEVIOL GLYCOSIDES

DSM IP ASSETS B.V., Heer...

1. A process for recovering one or more steviol glycosides from a steviol glycoside-containing fermentation broth, which process comprises(a) providing:
(a1) a fermentation broth comprising one or more steviol glycosides, one or more non-steviol glycoside components, and a solvent; or
(a2) said fermentation broth, separated into a liquid phase and a solid phase;
(b) providing an elution solvent;
(c) providing an adsorbent resin;
(d) contacting the adsorbent resin with:
the fermentation broth; or
the liquid phase;
 so that at least a portion of the one or more non-steviol glycoside components adsorbs onto the adsorbent resin, thereby forming an enriched steviol glycoside composition;
(e) eluting the one or more steviol glycosides from the adsorbent resin with elution solvent, to yield a recovered steviol glycoside-containing solution; and
(f) optionally desorbing the one or more non-steviol glycoside components from the adsorbent resin;
wherein:
the elution solvent comprises 50% weight or less ethanol, and 50% weight or greater water; and
the adsorbent resin is a polystyrene-divinylbenzene resin.
US Pat. No. 10,689,667

METHODS AND COMPOSITIONS FOR SELECTIVE REGULATION OF PROTEIN EXPRESSION

Monsanto Technology LLC, ...

1. A recombinant DNA construct comprising a protein-coding sequence operably linked to a polynucleotide sequence comprising a maize mts-siRNA element comprising at least one DNA sequence complementary to an mts-siRNA specifically expressed in male reproductive tissue, wherein the presence of said maize mts-siRNA element selectively suppresses expression of said protein-coding sequence in a male reproductive tissue cell, and wherein:a) said maize mts-siRNA element comprises at least one DNA sequence selected from the group consisting of SEQ ID NO: 1-56 and 105-149; or
b) said maize mts-siRNA element comprises at least 20 contiguous nucleotides of the nucleotide sequence selected from the group consisting of SEQ ID NO: 57-94 and 96-104.
US Pat. No. 10,688,130

METHODS AND COMPOSITIONS FOR TREATING AGING-ASSOCIATED CONDITIONS

THE BOARD OF TRUSTEES OF ...

1. A method of treating a subject for a hippocampal mediated aging-associated cognitive impairment comprising:administering to the subject an effective amount of a young blood plasma product to treat the subject for the hippocampal mediated aging-associated cognitive impairment, wherein the young blood plasma product has been prepared by a process comprising removing proteins having an average molecular weight below 25 kDa from plasma from a donor or donors 40 years old or younger, and younger than the subject.
US Pat. No. 10,689,668

STRAIN PRODUCING ALLOSE FROM FRUCTOSE AND METHOD FOR PRODUCING ALLOSE USING SAME

SAMYANG CORPORATION, Seo...

1. An enzyme for producing an allose from a fructose comprising a fusion protein in which a psicose epimerase and an allose isomerase are connected by a linker peptide,wherein the psicose epimerase comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 3, and the allose isomerase comprises the amino acid sequence of SEQ ID NO: 4.
US Pat. No. 10,688,131

PEPTIDES AND SCAFFOLDS FOR USE IN IMMUNOTHERAPY AGAINST HEAD AND NECK SQUAMOUS CELL CARCINOMA AND OTHER CANCERS

IMMATICS BIOTECHNOLOGIES ...

1. A method of treating cancer in a HLA-A*02+ patient having cancer overexpressing a DPP9 polypeptide comprising the amino acid sequence of SEQ ID NO: 30 and presenting at its surface a peptide consisting of the amino acid sequence of SEQ ID NO: 30 in the context of a complex with an MHC class I molecule, said method comprising administering to said patient an effective amount of activated antigen-specific CD8+ cytotoxic T cells to kill the cancer cells, wherein said activated antigen-specific CD8+ cytotoxic T cells are produced by contacting CD8+ cytotoxic T cells with an antigen presenting cell presenting at its surface a peptide consisting of the amino acid sequence of SEQ ID NO: 30 in the context of a complex with an MHC class I molecule in vitro, wherein the cancer is head and neck squamous cell carcinoma.
US Pat. No. 10,688,132

COORDINATING GENE EXPRESSION USING RNA DESTABILIZING ELEMENTS

Chimera Bioengineering, I...

1. A method of expressing a plurality of transgenes, comprising the steps of:obtaining a primary T-cell comprising a chimeric antigen receptor, a first heterologous nucleic acid comprising a polynucleotide encoding a first transgene, and a polynucleotide encoding a first RNA destabilizing element (RDE), wherein the first RDE is an AU 101 (Interferon gamma or IFNg) or an AU14 (IL6), wherein a first RDE binding protein binds to the first RDE and regulates expression of the first transgene, a second heterologous nucleic acid comprising a polynucleotide encoding a second transgene, and a polynucleotide encoding a second RDE, wherein the second RDE is an AU 101 (Interferon gamma or IFNg) or an AU14 (IL6), wherein a second RDE binding protein binds to the second RDE and regulates expression of the second transgene, wherein the first and second heterologous nucleic acids are transcribed to make a first transcript encoding the first transgene operably linked to the first RDE, and a second transcript encoding the second transgene operably linked to the second RDE;
binding the primary T-cell to a target ligand for the chimeric antigen receptor at a target site in a subject, wherein binding of the ligand by the chimeric antigen receptor activates the primary T-cell and the T-cell proliferates, wherein activation of the primary T-cell changes binding of the first RDE by the first RDE binding protein and binding of the second RDE by the second RDE binding protein; and
expressing the first and second transgenes, wherein the first and second transgenes have increased levels of expression after activation of the primary T-cell compared to the level of expression before activation of the primary T-cell.
US Pat. No. 10,689,670

RECOMBINANT YEAST CELL

DSM IP ASSETS B.V., Heer...

1. A recombinant yeast cell functionally expressing one or more heterologous nucleic acid sequences encoding for ribulose-1,5-phosphate carboxylase/oxygenase (EC4.1.1.39; Rubisco) and one or more phosphoribulokinase (EC2.7.1.19; PRK), wherein the phosphoribulokinase is under control of a promoter, which has a PRK expression ratioanaerobic/aerobic of 2 or more, and wherein the PRK promoter comprises, in a sequence thereof, one or more of: NNNATTGTTNNN (SEQ ID NO:120); TCGTTYAG (SEQ ID NO:121); AAAAATTGTTGA (SEQ ID NO:122); or TCGTTYAG (SEQ ID N0:121) and AAAAATTGTTGA (SEQ ID NO:122).
US Pat. No. 10,688,133

CELL SHEET COMPOSITION FOR INHIBITING PROGRESSION OF RENAL DISORDER, METHOD OF PRODUCING THE SAME, AND METHOD OF INHIBITING PROGRESSION OF RENAL DISORDER USING THE SAME

1. A method of inhibiting progression of a renal disorder, wherein the renal disorder is selected from group consisting of fibrosis of the renal cortex, collapse of the renal medullary structure, degradation of renal medullary functions, and thinning of the renal parenchyma, in a subject in need of treatment of the renal disorder, the method comprising:(i) preparing a single- or multi-layered cell sheet composition with a culture of cells that have a function of producing a hepatocyte growth factor (HGF), wherein the cells comprise a recombinant vector having a nucleic acid encoding an HGF protein, or mesenchymal stem cells that have a function of producing HGF;
(ii) peeling off or removing at least one part of a fibrous capsule of a kidney; and
(iii) applying the single- or multi-layered cell sheet composition to a surface of the kidney where the at least one part of the fibrous capsule has been peeled off or removed, wherein production of HGF inhibits progression of the renal disorder.
US Pat. No. 10,689,671

MICROORGANISM AND METHOD FOR THE PRODUCTION OF 1.2-PROPANEDIOL BASED ON NADPH DEPENDENT ACETOL REDUCTASE AND IMPROVED NADPH SUPPLY

METABOLIC EXPLORER, Sain...

1. A method for the production of 1,2-propanediol in a fermentative process comprising the steps:culturing an E. coli microorganism genetically modified for the production of 1,2-propanediol in an appropriate culture medium comprising a carbohydrate as a source of carbon, and
recovering 1,2-propanediol from said culture medium,wherein said E. Coli microorganism expressesa Clostridium beijerinckii adh gene coding for a NADPH dependent acetol reductase or
a gldA gene coding for a NADPH dependent glycerol dehydrogenase having at least 90% sequence identity to the sequence set forth in SEQ ID NO:28, wherein the dehydrogenase comprises a glycine, an alanine, or a valine at the amino acid residue corresponding to position 37 of SEQ ID NO: 28.
US Pat. No. 10,688,134

METHODS OF TREATING OR PREVENTING RESPIRATORY CONDITIONS

Mesoblast, Inc., New Yor...

1. A method of treating a respiratory condition in a human subject, the method comprising administering to the subject a population of cells enriched for STRO-1+ mesenchymal precursor cells or progeny thereof.
US Pat. No. 10,689,672

VANILLIN SYNTHASE

EVOLVA SA, Reinach (CH) ...

1. A method of producing vanillin, vanillyl alcohol, vanillin glucoside, and/or vanillyl alcohol glucoside, the method comprising the steps of:(a) providing a microbial organism that comprises a heterologous nucleic acid encoding a vanillin synthase, wherein the vanillin synthase is capable of catalyzing conversion of ferulic acid or a ferulic acid derivative to form vanillin, vanillyl alcohol, vanillin glucoside, and/or vanillyl alcohol glucoside;
(b) cultivating the microbial organism in the presence of ferulic acid and/or a ferulic acid derivative in culture medium supporting growth of the microbial organism; and
(c) isolating vanillin, vanillyl alcohol, vanillyl alcohol glucoside, and/or vanillin glucoside from the microbial organism and/or from the culture medium;
wherein the vanillin synthase capable of catalyzing the conversion of ferulic acid or a ferulic acid derivative to form vanillin comprises the amino acid sequence of SEQ ID NO: 1 or a functional homolog thereof,
wherein the functional homolog thereof comprises:
(i) an amino acid sequence with at least 99% identity to SEQ ID NO: 1;
(ii) an amino acid sequence with at least 99% identity to SEQ ID NO: 17;
(iii) an amino acid sequence with at least 99% identity to amino acids 62 to 356 of SEQ ID NO: 1;
(iv) an amino acid sequence with at least 98% identity to amino acids 138 to 356 of SEQ ID NO: 1;
(v) an amino acid sequence with at least 98% identity to SEQ ID NO: 21; or
(vi) an amino acid sequence with at least 93% identity to the sequence encoded by SEQ ID NO: 24.
US Pat. No. 10,691,468

TECHNIQUES OF RETRIEVING BIOS DATA FROM BMC

AMERICAN MEGATRENDS INTER...

8. A computer system, comprising:a baseboard management controller (BMC), including
a first memory; and
first at least one processor coupled to the first memory and configured to:
receive, through a management platform on the BMC, a first part of initialization data from an initialization component of a host of the BMC;
receive an indication of a location at an initialization storage device of the host;
obtain access to the initialization storage device; and
read a second part of the initialization data from the location of the initialization storage device.
US Pat. No. 10,688,135

COMPOSITION FOR TREATING ISCHEMIC DISEASES OR NEUROINFLAMMATORY DISEASES, COMPRISING SECRETOME OF NEURAL PRECURSOR CELLS AS ACTIVE INGREDIENT

S-BIOMEDICS, Seoul (KR)

1. A method for treating ischemic cerebrovascular disease, ischemic heart disease, myocardial infarction, Alzheimer's disease, Parkinson's disease, Lewy body disease, multiple sclerosis, amyotrophic lateral sclerosis, or spinal cord injury, the method comprising administering, to a subject, a composition comprising: (a) a therapeutically effective amount of a secretome derived from poly-sialylated neural cell adhesion molecule (PSA-NCAM)-positive neural precursor cells (NPCs); and (b) a pharmaceutically acceptable carrier,wherein the secretome is in a form of a cell conditioned medium obtained by culturing neural precursor cells in a cell culture medium and then removing the cells.
US Pat. No. 10,689,673

BIOCONVERSION PROCESS FOR PRODUCING NYLON-7, NYLON-7,7 AND POLYESTERS

INVISTA North America S.a...

1. A method of converting a compound, the method comprising contacting pimeloyl-CoA (PCoA) or pimeloyl acyl carrier protein (PACP) with a single enzyme that catalyzes the reduction of PCoA or PACP to pimelic acid semialdehyde (PAS) in a single reaction, wherein PAS is produced, and wherein the single enzyme that catalyzes the reduction of PCoA or PACP to PAS in a single reaction is a fatty-acyl-CoA reductase in EC 1.2.1.3, EC 1.2.1.10, EC 1.2.1.22, EC 1.2.1.50, or EC 1.2.1.76, a fatty-acyl-[acp]-reductase in EC 1.2.1.80, or an aldehyde dehydrogenase in EC 1.2.1.10, EC 1.2.1.76, or EC 1.2.1.50.
US Pat. No. 10,688,136

METHODS AND COMPOSITIONS TO MAINTAIN STEM CELL QUIESCENCE

The Board of Trustees of ...

1. A serum-free liquid cell culture medium that provides for quiescence of stem cells during in vitro culture, the medium comprising each of components:elcatonin; MGCD-265, JNJ-7706621, Forskolin, Somatostatin, SB203580, SU5402, TGFbeta and serum replacement; and
a hydrogel substrate.
US Pat. No. 10,689,417

IL-2R? BINDING COMPOUNDS

MEDIKINE, INC., Menlo Pa...


US Pat. No. 10,689,674

SYNTHETIC METHANOTROPHIC AND METHYLOTROPHIC MICROORGANISM AND METHOD THEREOF

INDUSTRIAL MICROBES, INC....

1. A synthetic microorganism of Escherichia coli comprising one or more genetic modifications encoding a soluble methane monooxygenase that allows said Escherichia coli to oxidize methane, wherein the one or more genetic modifications comprises the genes mmoB, mmoC, mmoX, mmoY, and mmoZ and the one or more genetic modifications additionally comprises one or more exogenous polynucleotides encoding exogenous expression of one or more protein-folding chaperones.
US Pat. No. 10,688,137

MICROBIOTA RESTORATION THERAPY (MRT), COMPOSITIONS AND METHODS OF MANUFACTURE

REBIOTIX, INC., Rosevill...

1. A method for displacing a pathogenic organism in the digestive tract, the method comprising:manufacturing a microbiota restoration composition, wherein manufacturing the microbiota restoration composition comprises:
collecting a human fecal sample, and
adding a mixture of polyethylene glycol and saline having a concentration of 30-90 grams of polyethylene glycol per liter of saline to the human fecal sample;
administering a first dose of the microbiota restoration composition to a patient with a gastrointestinal disorder;
ascertaining a need for further treatment, wherein the need for further treatment comprises a recurrence of symptoms within 8 weeks of administering the first dose of the microbiota restoration composition to the patient; and
administering a second dose of the microbiota restoration composition to the patient when the need for further treatment occurs.
US Pat. No. 10,689,418

SYNTHETIC PEPTIDES THAT MODULATE THE NMDA RECEPTOR

Universidad Nacional de C...

1. An artificially designed 17 amino acid-long peptide, wherein said peptide has the following hydrophilic amino acid sequence: GEDDLQDNQDLIRDKSN (SEQ ID NO: 2); said peptide having a molecular formula of C78H127N25O35; a molecular weight of 1975.03 g/Mol; an isoelectric point of 3.90 and an average hydropathicity (GRAVY) of ?1.912.
US Pat. No. 10,688,138

CONJUGATED LINOLEIC ACID-PRODUCING STRAINS OF PROBIOTIC BACTERIA AND USE THEREOF FOR THE PREPARATION OF A FOOD, DIETETIC OR PHARMACEUTICAL COMPOSITION

ALCE NORTH AMERICA, INC.,...

1. A lyophilized composition in solid form comprising a single bacterial strain, wherein the bacterial strain is Bifidobacterium longum deposited with the DSMZ on Jan. 12, 2010 under accession number DSM 23233 (Bifidobacterium longum DSM 23233).
US Pat. No. 10,689,676

ALGAL MUTANTS WITH INCREASED LIPID PRODUCTIVITY

Synthetic Genomics, Inc.,...

1. A mutant heterokont microorganism having attenuated expression of a gene encoding a polypeptide that includes a TAZ zinc finger domain and a Bromo domain, wherein the mutant heterokont microorganism produces at least 20% more lipid than a control heterokont microorganism and at least 45% of the amount of biomass accumulated by the control heterokont microorganism when the mutant heterokont microorganism and control heterokont microorganism are cultured under identical conditions under which the control is heterokont microorganism accumulating biomass, wherein the polypeptide has at least 80% identity to an amino acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, and SEQ ID NO:12, wherein the control microorganism is the same as the mutant heterokont microorganism with the proviso that expression the gene encoding a polypeptide that includes a TAZ zinc finger domain and a Bromo domain is not attenuated.
US Pat. No. 10,688,139

ORALLY ADMINISTRABLE COMPOSITION FOR THE PHOTOPROTECTION OF THE SKIN

1. A method of reducing effects of a skin disorder caused by solar radiation for an individual in need thereof, wherein the skin disorder is selected from the group consisting of erythema, inflammation, sun burn, photoageing, and combinations thereof, the method comprising:orally administering to the individual a composition consisting of (i) live Lactobacillus johnsonii CNCM I-1225, (ii) at least one carotenoid selected from the group consisting of ?-carotene, lycopene, and a combination of ?-carotene and lycopene, and (iii) an orally acceptable carrier, wherein the composition is administered for at least one day in a quantity that provides 107 to 1012 organisms of the live Lactobacillus johnsonii CNCM I-1225/day and a total amount of 5 to 30 mg of the at least one carotenoid/day.
US Pat. No. 10,689,677

METHOD FOR THE FERMENTATIVE PRODUCTION OF L-LYSINE BY MODIFIED CORYNEBACTERIUM GLUTAMICUM

Evonik Operations GmbH, ...

1. A method for the fermentative production of L-lysine, comprising:a) providing a bacterium of the species Corynebacterium glutamicum having an ability to excrete L-lysine containing in the bacterium's chromosome a polynucleotide encoding a polypeptide comprising an amino acid sequence of SEQ ID NO:2, wherein an amino acid phenylalanine at position 220 of the amino acid sequence of SEQ ID NO:2 is substituted by a different proteinogenic amino acid,
b) cultivating the bacterium in a suitable medium under suitable conditions, and
c) accumulating said L-lysine in the medium to form an L-lysine containing fermentation broth.
US Pat. No. 10,688,140

COMPOSITION TO IMPROVE GUT HEALTH AND ANIMAL PERFORMANCE AND METHODS OF MAKING THE SAME

Bioatlantis Limited, Tra...

1. A method of treating animals or humans comprising:identifying an animal or human in need of at least one of: (1) increased growth of beneficial microbes and reduced levels of harmful microbes selected from E. coli or Salmonella in animal or human intestines, (2) improved gut structure, (3) reduced gut inflammation, (4) improved nutrient digestibility, (5) improved mineral absorption and growth performance, or (6) reduced gut infection and inflammation; and
administering to the animals or humans in need of any one of (1) to (6) a composition formulated for oral delivery comprising at least one of:
at least 8% w/w ?-glucans, and
at least 8% w/w ?-fucans, in an amount effective to at least one of: (1) increase the growth of beneficial microbes and reduce the levels of harmful microbes selected from E. coli or Salmonella in animal or human intestines, (2) improve gut structure, (3) reduce gut inflammation, (4) improve nutrient digestibility, (5) improve mineral absorption and growth performance in animals or humans, or (6) reduce the gut infection and inflammation.
US Pat. No. 10,689,421

BACTERIOCIN-PRODUCING PAENIBACILLUS EHIMENSIS AND APPLICATION THEREOF

National Pingtung Univers...

1. A method of treating contamination of a food or cosmetic product by a pathogen, comprising applying an antimicrobial composition comprising a bacteriocin protein to the food or cosmetic product, wherein the bacteriocin protein is a DNA starvation/stationary phase protection protein produced by Paenibacillus ehimensis deposited with the China Center for Type Culture Collection under Accession No. M2018074, and wherein said bacteriocin protein has the amino acid sequence of SEQ ID NO: 1.
US Pat. No. 10,689,678

METHOD AND COMPOSITION COMPRISING HYDROLYZED STARCH

The Quaker Oats Company, ...

1. A composition comprising:at least a portion of pulse;
wherein the at least a portion of pulse comprises gelatinized, hydrolyzed starch;
wherein an average molecular weight of the gelatinized, hydrolyzed starch is 0.60 to 0.07 times an original average molecular weight of the starch;
wherein the original average molecular weight of the starch is an average molecular weight of the starch before the gelatinization and the hydrolysis that provides the gelatinized, hydrolyzed starch;
wherein a mass ratio of starch to protein in the at least a portion of pulse is equal to an original mass ratio of starch to protein in the at least a portion of pulse within a tolerance of +/?10%;
wherein the original mass ratio of the starch to protein is a mass ratio of starch to protein in the at least a portion of pulse before the gelatinization and the hydrolysis that provides the gelatinized, hydrolyzed starch;
wherein the mass ratio of starch to protein in the at least a portion of pulse is equal to the mass of starch divided by the mass of protein in the at least a portion of pulse;
wherein the original mass ratio of starch to protein in the at least a portion of pulse is equal to the mass of starch divided by the mass of protein in the at least a portion of pulse before the gelatinization and the hydrolysis that provides the gelatinized, hydrolyzed starch.
US Pat. No. 10,688,141

PROBIOTIC BEVERAGE CONTAINING LIVING MYCELIUM AND METHOD OF PRODUCTION

MYCOTEA, LLC, Vero Beach...

1. A method of preparing a beverage containing living mycelia, comprising the steps of:(i) introducing a volume of water into sterilized beverage preparation equipment;
(ii) introducing a sweetener into said water to create a sweetener solution;
(iii) introducing a flavor additive into said sweetener solution to create a sweetener-flavor-water solution;
(iv) sterilizing the sweetener-flavor-water solution;
(v) introducing living mycelia comprising Basidiomycota and Ascomycota to the sweetener-flavor-water solution to provide mycelia-sweetener-flavor-water solution;
(vi) incubating the mycelia-sweetener-flavor-water solution for 3 to 7 days at optimal conditions to promote optimal growth of mycelium species; and
(vii) cooling the mixture of step (vi) to a temperature from about 37° F. to 56° F. to stall the production of mycelium biomass in order to maintain optimum saturation levels, thereby providing a beverage containing living mycelia.
US Pat. No. 10,689,422

RECOMBINANT POLYPEPTIDE CONSTRUCT COMPRISING MULTIPLE ENTEROTOXIGENIC ESCHERICHIA COLI FIMBRIAL SUBUNITS

The United States of Amer...

1. A method of inducing an immune response in a mammal comprising the steps:a. Constructing a priming dose of a recombinant polypeptide construct, as a subunit vaccine or expressed in a suitable expression vector, in a buffered aqueous solution, wherein said constructing of said priming dose comprises stabilizing Escherichia coli major and minor fimbrial subunits by donor strand complementation, comprising connecting a whole or immunogenic fragment of an Escherichia coli fimbrial minor or major subunit, in a single recombinant polypeptide construct to one or more major fimbrial subunits or immunogenic fragments, thereof, of the same fimbrial type, via a polypeptide linker, and wherein each of the one or more major fimbrial subunits contain a donor ? strand and are also connected to each other via a polypeptide linker, wherein the C-terminal Escherichia coli fimbrial major subunit is connected, via a linker, to a C-terminal donor ? strand derived from a major Escherichia coli fimbrial subunit that is homologous or heterologous to the immediately N-terminal major subunit and wherein said construct can comprise a histidine tag at the C-terminus;
b. Administering or more of said priming dose of said recombinant polypeptide construct, as a subunit vaccine or expressed in a suitable expression vector, in a buffered aqueous solution;
c. Administering one or more boosting doses with first dose at least 1 week after said priming dose with a unit dose range of 1 ?g to 1 mg of immunogen in a buffered aqueous solution, wherein an immune response is elicited.
US Pat. No. 10,689,679

METHODS FOR STARCH HYDROLYSIS

Syngenta Participations A...

1. A method for starch liquefaction, the method comprising: liquefying an aqueous slurry of starch-containing plant material in the presence of at least a first and a second class of ?-amylase enzymes to obtain a liquefact, wherein the first class of ?-amylase enzymes exhibits a unimodal starch hydrolysis pattern and is either a 797GL3 or a D45 ?-amylase and the second class of ?-amylase enzymes exhibits a bimodal starch hydrolysis pattern.
US Pat. No. 10,688,142

METHODS OF TREATMENT USING A LIPID EXTRACT OF PASSIFLORA SEEDS CONCENTRATED IN ITS UNSAPONIFIABLE FRACTION

LABORATOIRES EXPANSCIENCE...

1. A method to stimulate, restore or regulate the metabolism of skin or mucosa cells or to treat disorders related to dermal tissue, or a combination of thereof, comprising topically administering to a person in a need thereof a lipid extract from Passiflora seeds selected from Passiflora incarnate seeds, Passiflora edulis seeds, and a combination thereof, wherein said lipid extract is oil of Passiflora seeds concentrated in its unsaponifiable fraction containing 3 to 100 weight % of unsaponifiables relative to the total weight of the extract, wherein the lipid extract acts:as anti-aging agent,
as healing agent,
to prevent deterioration of and/or to maintain homeostasis of the skin or mucosae,
as antioxidant agent,
as anti-inflammatory agent,
as slimming or anti-cellulite agent,
to prevent or treat skin stretch marks, or
as depigmenting agent.
US Pat. No. 10,689,423

CTLA4-BINDING PROTEIN PEPTIDE-LINKER MASKS

City of Hope, Duarte, CA...

1. A recombinant CTLA-4 binding protein comprising:(i) a CTLA-4 binding domain;
(ii) a CTLA-4 binding domain masking peptide; and
(iii) a cleavable peptide linker connecting said CTLA-4 binding domain masking peptide to said CTLA-4 binding domain,
wherein said CTLA-4 binding domain comprises a CTLA-4 binding lipocalin 2 (LCN2) comprising the amino acid sequence of SEQ ID NO: 34,
wherein said CTLA-4 binding domain masking peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14 and 52-59 and
wherein said cleavable peptide linker comprises a tumor-associated protease cleavage site.
US Pat. No. 10,689,680

PAIRING CODE DIRECTED ASSEMBLY

Agilent Technologies, Inc...

1. A method for making a synthetic nucleic acid, comprising:(a) identifying a conflicting nucleotide sequence in a target sequence;
(b) inserting a masking sequence into the conflicting sequence to produce a disrupted target sequence, wherein:
(i) the masking sequence comprises recognition sites for one or more Type IIS restriction endonucleases; and
(ii) digestion of said disrupted target sequence by said one or more Type IIS restriction endonucleases followed by re-ligation reconstitutes the target sequence;
(c) synthesizing a polynucleotide comprising the disrupted target sequence using polymerase chain assembly; and
(d) removing the masking sequence from said polynucleotide by digesting said polynucleotide with said one or more Type IIS restriction endonucleases followed by re-ligation of the digestion product, thereby producing a polynucleotide comprising said target sequence.
US Pat. No. 10,688,143

COMPOSITION CONTAINING EXTRACT OR FRACTION OF GENUS JUSTICIA PLANT

DONG WHA PHARM. CO., LTD....

1. A method for treating allergic disease, the method comprising a step of administering to a subject a composition comprising an extract of a plant of the Justicia genus or a fraction thereof,wherein the plant of the Justicia genus is Justicia procumbens L., and the extract is an organic solvent extract.
US Pat. No. 10,689,424

CELL-PERMEABLE (CP)-? SOCS3 RECOMBINANT PROTEIN AND USES THEREOF

CELLIVERY THERAPEUTICS, I...

1. A recombinant protein comprising a SH2 domain of SOCS3 protein and an advanced macromolecule transduction domain (aMTD),wherein the aMTD is fused to one end or both ends of the SH2 domain of SOCS3 protein, and the SH2 domain of SOCS3 protein has the amino acid sequence of SEQ ID NO: 816 and the aMTD has the amino acid sequence of SEQ ID NO: 122.
US Pat. No. 10,689,681

MICROORGANISMS FOR DITERPENE PRODUCTION

DSM IP ASSETS B.V., Heer...

1. A recombinant yeast selected from the group consisting of Saccharomyces, Pichia, Kluyveromyces, Candida, Hansenula, Humicola, Trichosporon, Brettanomyces, Pachysolen, Yarrowia, and Yamadazyma, comprising:(a) a heterologous nucleotide sequence encoding a polypeptide having ent-copalyl pyrophosphate synthase activity, wherein the nucleotide sequence comprises:
i. a nucleotide sequence encoding the polypeptide having ent-copalyl pyrophosphate synthase activity, said polypeptide comprising an amino acid sequence that has at least 90% sequence identity with the amino acid sequence of SEQ ID NOs: 60 or 62;
ii. a nucleotide sequence the complementary strand of which hybridizes to the sequence set forth in (i); or
iii. a nucleotide sequence which differs from the sequence of a nucleic acid molecule of (i) or (ii) due to the degeneracy of the genetic code;
(b) a heterologous nucleotide sequence encoding a polypeptide having ent-Kaurene synthase activity, wherein the nucleotide sequence comprises:
i. a nucleotide sequence encoding the polypeptide having ent-Kaurene synthase activity, said polypeptide comprising an amino acid sequence that has at least 90% sequence identity with the amino acid sequence of SEQ ID NOs: 64 or 66;
ii. a nucleotide sequence the complementary strand of which hybridizes to the sequence set forth in (i); or
iii. a nucleotide sequence which differs from the sequence of a nucleic acid molecule of (i) or (ii) due to the degeneracy of the genetic code;
(c) a heterologous nucleotide sequence encoding a polypeptide having ent-Kaurene oxidase activity, wherein the nucleotide sequence comprises:
i. a nucleotide sequence encoding the polypeptide having ent-Kaurene oxidase activity, said polypeptide comprising an amino acid sequence that has at least 90% sequence identity with the amino acid sequence of SEQ ID NOs: 24 or 86;
ii. a nucleotide sequence the complementary strand of which hybridizes to the sequence set forth in (i); or
iii. a nucleotide sequence which differs from the sequence of a nucleic acid molecule of (i) or (ii) due to the degeneracy of the genetic code; and
(d) a heterologous nucleotide sequence encoding a polypeptide having kaurenoic acid 13-hydroxylase activity, wherein the nucleotide sequence comprises:
i. a nucleotide sequence encoding the polypeptide having kaurenoic acid 13-hydroxylase activity, said polypeptide comprising an amino acid sequence that has at least 90% sequence identity with the amino acid sequence of SEQ ID NOs: 32, 34, or 70;
ii. a nucleotide sequence the complementary strand of which hybridizes to the sequence set forth in (i); or
iii. a nucleotide sequence which differs from the sequence of a nucleic acid molecule of (i) or (ii) due to the degeneracy of the genetic code;
whereby the yeast produces steviol, and
wherein said recombinant yeast has been modified in its genome to delete, disrupt, or replace at least one gene that encodes:
(i) an exo-1,3-? glucanase;
(ii) a glycogen synthase;
(iii) a transcriptional repressor of hypoxic genes (ROX1);
(iv) an NADPH oxidase;
(v) a monocarboxylate transporter (JEN1);
(vi) a YJL064w polypeptide; or
(vii) a YPL062w polypeptide.
US Pat. No. 10,688,144

COMPOSITION FOR PREVENTING OR TREATING OSTEOARTHRITIS CONTAINING AN EXTRACT OF ANGELICA GIGAS NAKAI

Kang Hyun Lee, Seoul (KR...

1. A method of preventing or treating osteoarthritis, comprising administering an extract of Angelica gigas Nakai to a subject in need of prevention or treatment of osteoarthritis, wherein the extract of Angelica gigas Nakai is an ethanol extract of Angelica gigas Nakai comprising 2200 mg or more of decursin, 1400 mg or more of decursinol angelate, 1000 mg or more of nodakenin, and 50 mg or more of beta-sitosterol, based on 100 g of the extract, wherein the extract is obtained by extracting Angelica gigas Nakai with a 90% (v/v) to 100% (v/v) ethanol aqueous solution at 40° C. to 80° C.
US Pat. No. 10,689,425

COLLAGEN-BINDING SYNTHETIC PEPTIDOGLYCANS, PREPARATION, AND METHODS OF USE

Purdue Research Foundatio...

1. A synthetic peptidoglycan (PL)xG whereinG is heparin;
x is 2 to 10;
L is a linker having a molecular weight of 20 to 500 Daltons which covalently links each “P” to “G”;
P is a collagen-binding synthetic peptide of 5 to 40 amino acids comprising an amino acid sequence selected from the group consisting of:
RRANAALKAGELYKSILYGC (SEQ ID NO: 1),
KELNLVYTGC (SEQ ID NO: 12),
GSITTIDVPWNVGC (SEQ ID NO: 14),
RLDGNEIKRGC (SEQ ID NO: 2),
AHEEISTTNEGVMGC (SEQ ID NO: 3),
NGVFKYRPRYFLYKHAYFYPPLKRFPVOGC (SEQ ID NO: 4),
CQDSETRTFY (SEQ ID NO: 5),
TKKTLRTGC (SEQ ID NO: 6),
GLRSKSKKFRRPDIQYPDATDEDITSHMGC (SEQ ID NO: 7) and
SQNPVQPGC (SEQ ID NO: 8); or an amino acid sequence having at least 80% sequence identity thereto.
US Pat. No. 10,689,426

ARTIFICIAL SYNAPSE INDUCER AND METHOD OF MAKING THE SAME

1. An artificial synapse inducer comprising:a complex comprising a polypeptide and a biotin conjugated to the polypeptide, wherein the polypeptide comprises the sequence of SEQ ID NO: 11; and
a substrate coated with a biotin-binding protein,
wherein the biotin and the biotin-binding protein are bound together such that the complex is attached to the substrate without a lipid bilayer.
US Pat. No. 10,689,683

SYSTEMS AND METHODS FOR DETERMINING THE CONCENTRATIONS OF MULTIPLE SPECIES USING MULTIPLE SENSORS

ABB Schweiz AG, Baden (C...

8. A system for determining concentrations of a plurality of constituents in a medium, comprising:a plurality of sensors in contact with the medium, each sensor of the plurality of sensors having a different composition that has a unique response to each of the plurality of constituents in the medium;
one or more heating elements in thermal communication with the plurality of sensors; and
a processing unit configured to control the one or more heating elements to maintain each sensor of the plurality of sensors at the measurement temperature, the processing unit further configured to receive from each sensor of the plurality of sensors a readout corresponding to a temperature-dependent measurement of the sensor in the medium and compare the plurality of sensor readouts to a set of calibration readouts for the plurality of sensors maintained at the measurement temperature to determine actual concentrations of the plurality of constituents in the medium from a point of overlap of concentration values corresponding to the set of calibration readouts and the plurality of sensor readouts, each at the measurement temperature.
US Pat. No. 10,688,146

CURCUMA MANGGA VAL ET. ZIPP. EXTRACT AS A TREATMENT TO OVERCOME PROSTATE PROBLEMS

PT Dexa Medica, Tangeran...

1. A method for treating benign prostatic hyperplasia (BPH), comprising administering to a patient suffering from BPH an effective amount of an extract of Curcuma mangga Val. et Zipp.,wherein the extract contains less than 0.05% (w/w) curcurminoids and is obtained by the process comprising the steps of:(a) Chopping dried Curcuma mangga Val. et Zipp. rhizome to a length of 3-7 mm;(b) Extracting the chopped material from step (a) with maceration and/or percolation method using an extraction solvent comprising a C1-C4 alcohol,wherein the solid-to-solvent ratio is (1:6)-(1:10) w/v, the duration of maceration and/or percolation is between 30-240 minutes, and the solids are filtered to obtain filtrate;(c) Concentrating the filtrate from step (b) by evaporation until extract concentrate is obtained;(d) Adding a filler to the extract concentrate from step (c);(e) Drying the mixture of extract concentrate and filler from step (d) to obtain a dry extract; and(f) Milling the dry extract from step (e).
US Pat. No. 10,689,427

COMBINED USE OF GDF TRAPS AND ERYTHROPOIETIN RECEPTOR ACTIVATORS TO INCREASE RED BLOOD CELL LEVELS

ACCELERON PHARMA INC., C...

1. A method for treating a hypoproliferative anemia in a subject in need thereof; comprising administering to the subject a polypeptide comprising an amino acid sequence that is at least 90% identical to the sequence of amino acids 29-109 of SEQ ID NO: 1, wherein the polypeptide comprises an acidic amino acid at the position corresponding to position 79 of SEQ ID NO: 1, wherein the polypeptide binds to GDF11 and/or myostatin; and wherein the hypoproliferative anemia is an anemia associated with a hypometabolic state.
US Pat. No. 10,689,684

MODIFICATIONS TO POLYNUCLEOTIDES FOR SEQUENCING

Microsoft Technology Lice...

1. A method comprising:receiving a plurality of polynucleotide sequences, wherein each of the plurality of polynucleotide sequences includes a calibration region, the calibration region read by a sequencing machine during a calibration process;
performing an analysis of sequences of the plurality of polynucleotide sequences;
determining, based at least partly on the analysis, a number of individual polynucleotide sequences of the plurality of polynucleotide sequences having a same nucleotide located in a same position of the calibration region of each of the plurality of polynucleotide sequences;
determining that the number is greater than a threshold number;
modifying a nucleotide sequence of the calibration region of at least one of the plurality of polynucleotide sequences to produce a modified polynucleotide sequence, wherein, after the modifying, the number is less than the threshold number; and
providing the modified polynucleotide sequence to a polynucleotide synthesizer.
US Pat. No. 10,688,147

COMPOSITIONS AND METHODS FOR INVASIVE AND NON-INVASIVE PROCEDURAL SKINCARE

Alastin Skincare, Inc., ...

1. A topical composition for alleviating bruising caused by a cosmetic procedure, comprising:a tripeptide-1 present at 1-10 ppm;
a hexpeptide-12 present at 1-10 ppm and at least one hexapeptide with amino acid sequence different from the hexapeptide-12; and
phosphatidylserine,wherein the topical composition alleviates bruising caused by the cosmetic procedure.
US Pat. No. 10,689,428

POLYPEPTIDES, NUCLEIC ACIDS AND USES THEREOF

Agency For Science, Techn...

1. A method for the treatment of an ELABELA associated condition, the method comprising administering a therapeutically effective amount of an ELABELA polypeptide selected from the group consisting of polypeptides of SEQ ID NOs: 2 to 18 to a subject having an ELABELA associated condition,wherein the ELABELA associated condition is selected from the group consisting of:
hypertension-associated cardiac hypertrophy, pressure-overload heart failure, and pulmonary arterial hypertension,thereby treating the ELABELA associated condition in the subject.
US Pat. No. 10,689,685

PRIMERS AND PROBES FOR DETECTING HUMAN PAPILLOMAVIRUS AND HUMAN BETA GLOBIN SEQUENCES IN TEST SAMPLES

ABBOTT MOLECULAR INC., D...

1. A method for detecting one or more of HPV types 16, 18, 31, 35, 39, 45, 51, 52, 58, 59, and 66 in a test sample, the method comprising the steps of:(a) contacting the test sample with:
(i) three different forward primers and two different reverse primers, wherein each forward primer consists of the nucleic acid sequence of SEQ ID NO:1, SEQ ID NO:2 and SEQ ID NO:3, respectively, or full-length complements thereof, and each of the reverse primers consists of the nucleic acid sequence of SEQ ID NO:4 and SEQ ID NO:5, respectively, or full-length complements thereof, under amplification conditions to generate a first target sequence;
(ii) at least one probe consisting of a nucleic acid sequence selected from SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, and full-length complements thereof, wherein each probe is labeled with a detectable label that comprises a fluorescent moiety attached at the 5? end of the probe; and
(b) detecting hybridization between the first target sequence and the at least one probe as an indication of the presence of one or more of HPV types 16, 18, 31, 35, 39, 45, 51, 52, 58, 59, and 66 in the test sample.
US Pat. No. 10,688,148

FORMULATIONS CONTAINING A SOMATOSTATIN RECEPTOR AGONIST

CAMURUS AB, Lund (SE)

1. A pre-formulation comprising:a) 20-90 wt% of a diacyl glycerol;
b) 20-80 wt% of a phospholipid selected from the group consisting of a phosphatidyl choline (PC), a phosphatidyl ethanolamine (PE), and a phosphatidyl inositol (PI);
c) 1-30 wt% of a biocompatible, organic solvent selected from the group consisting of ethanol, propanol, isopropanol, benzyl alcohol, a polar co-solvent, and mixtures thereof;
d) 0.001 to 0.05 wt% ethylenediaminetetraacetic acid (EDTA); and
e) 0.1-12 wt% of a somatostatin receptor agonist selected from octreotide or a salt thereof;
wherein the pre-formulation has a water content in the range of 0 to 1.0 wt%,
wherein the pre-formulation further comprises an alkylamine selected from the group consisting of ethanolamine (ETA), diethanolamine (DiETA), meglumine, tris-hydroxymethylamine (TRIS), ethylenediamine, and serinol,
wherein the molar ratio of EDTA:alkylamine is 1:?3.0 for ETA, DiETA, meglumine, TRIS, and serinol, and 1:?2.0 for ethylenediamine.
US Pat. No. 10,689,429

DOUBLE-ACYLATED GLP-1 COMPOUNDS

1. A derivative of a GLP-1 (7-37) analogue,wherein said analogue comprises a first Lys residue at a position corresponding to position 36 of GLP-1(7-37) (SEQ ID NO: 1), a second Lys residue at a position corresponding to position 37 of GLP-1(7-37) (SEQ ID NO: 1), and a maximum of seven amino acid changes as compared to GLP-1(7-37) (SEQ ID NO: 1);
which derivative comprises two protractors attached to said first and second Lys residue, respectively, each via a linker; wherein
the protractor is selected from:
HOOC—C6H4—O—(CH2)y—CO—*, and  Chem. 1:
HOOC—(CH2)x—CO—*,  Chem. 2:
wherein y is an integer in the range of 8-11, and x is 12; and
the linker comprises at least one of:
*—NH—CH(COOH)—(CH2)2—CO—*,  Chem. 3:
*—NH—CH((CH2)2—COOH)—CO—*, and/or  Chem. 4:
*—NH—(CH2)2—[O—(CH2)2]k—O—[CH2]n—CO—*,  Chem. 5:
wherein k is an integer in the range of 1-5, and n is an integer in the range of 1-5, and wherein the amino acid in position 31 of GLP-1(7-37) (SEQ ID NO: 1) is Trp;
or a pharmaceutically acceptable salt, amide, or ester thereof.
US Pat. No. 10,689,686

PRESERVATION OF CELL-FREE NUCLEIC ACIDS

Streck, Inc., Omaha, NE ...

1. A method comprising:preparing a blood collection tube including at least, or about, 200 grams per liter of a composition formulated for stabilizing cell-free nucleic acids within a blood sample, the composition including:
a. from about 0.5% to about 20% by weight of a single nuclease inhibitor;
b. from about 50 to about 500 grams per liter of one or more formaldehyde releaser preservative agents; and
c. one or more solvents;
wherein the presence of the one or more formaldehyde releaser preservative agents results in release of at least some formaldehyde and up to, or about, 1% formaldehyde into the composition; and
sending the blood collection tube and composition located therein to a remote location for collection of a blood sample that contains cell-free nucleic acids that are stabilized by the composition.
US Pat. No. 10,688,149

METHODS OF DIAGNOSIS, SELECTION, AND TREATMENT OF DISEASES AND CONDITIONS CAUSED BY OR ASSOCIATED WITH METHANOGENS

Cedars-Sinai Medical Cent...

1. A method for treating constipation-predominant irritable bowel syndrome (C-IBS) in a subject, comprising:determining whether the subject identified as having C—IBS has a quantity of a methanogen that is higher than a reference value of the methanogen based on quantitative polymerase chain reaction (qPCR) or a breath test performed on a biological sample obtained from the subject; and
administering lovastatin to the subject when it is determined that the subject has the quantity of the methanogen that is higher than the reference value.
US Pat. No. 10,689,687

DETECTION OF TARGET NUCLEIC ACIDS IN A CELLULAR SAMPLE

THE BOARD OF TRUSTEES OF ...

1. A method of assaying a cellular sample that comprises one or more cells in suspension for the presence of a target nucleic acid, the method comprising:contacting the cellular sample with, in order: (i) a fixation reagent; (ii) a permeabilization reagent; (iii) an aqueous fixative comprising one or more fixation reagents selected from the group consisting of: a cross-linking fixative, a precipitating fixative, an oxidizing fixative, and a mercurial fixative; and (iv) a nucleic acid detection agent comprising a signal producing system that comprises a branched nucleic acid signal amplification component, to produce a suspended hydrated/fixed detection agent-contacted cellular sample; and
measuring a signal produced by the signal producing system to evaluate the suspended hydrated/fixed detection agent-contacted cellular sample for the presence of the target nucleic acid.
US Pat. No. 10,689,431

COMPOSITIONS AND METHODS FOR TREATING CANCER WITH DUOCARS

LENTIGEN TECHNOLOGY, INC....

1. A method of treating a subject having a hematological cancer the method comprising administering to the subject a pharmaceutical composition comprising an antitumor effective amount of a population of human lymphocyte cells, wherein each cell of the population of human lymphocyte cells comprises at least one multi-cistronic vector, each of the at least one multi-cistronic vector comprises a promoter operably linked to a multi-cistronic nucleic acid sequence encoding two or more functional CARs comprising an extracellular antigen binding domain, a transmembrane domain, and one or more non-identical intracellular signaling motifs, wherein each of the encoded two or more functional CARs comprises a non-identical amino acid sequence that is independently selected from the group consisting of the amino acid sequences of SEQ ID NO. 54, 56, 60, and 62.
US Pat. No. 10,688,151

PEPTIDES HAVING SPECIFICITY FOR THE LUNGS

Boehringer Ingelheim Inte...

1. A capsid protein of a viral vector comprising the amino acid sequence of SEQ ID NO: 1.
US Pat. No. 10,689,432

B7X AND ITS DERIVATIVES FOR TREATING AND PREVENTING CARDIOVASCULAR DISEASE

Albert Einstein College o...


US Pat. No. 10,689,689

GENERIC METHOD FOR THE STABILIZATION OF SPECIFIC RNA

Roche Molecular Systems, ...

1. A method of preventing or reducing degradation of a segment of a single-stranded RNA template that is amplified in an amplification reaction, the method comprising the steps of:a) providing the single-stranded RNA template;
b) hybridizing the segment of the single-stranded RNA template with one or more oligonucleotides whose sequences are completely or partially complementary to the segment of the single-stranded RNA template that is amplified; and
c) reverse transcribing and amplifying the segment of the single-stranded RNA template under reaction conditions whereby the one or more oligonudeotides do not interfere with reverse transcription and amplification and whereby each one oligonucleotide from the one or more oligonucleotides is characterized by both being between 11 nucleotides and 50 nucleotides in length and having a melting temperature that is at least 5° C. lower than an extension temperature used during amplification, and wherein the sequence of each one oligonudeotide from the one or more oligonudeotides does not overlap with the sequence of another oligonudeotide from the one or more oligonudeotides; and
the one or more oligonucleotides are present at a concentration that is at least fifty-fold lower than concentrations of primers and probes used during reverse transcription and amplification;
wherein the one or more oligonudeotides comprise a group of oligonudeotides whose sequences consist of SEQ ID NOs: 1-10.
US Pat. No. 10,688,152

COMPOSITIONS AND METHODS FOR TREATING A VIRAL INFECTION

Rush University Medical C...

1. A method of treating a viral infection, the method comprising:administering to a subject in need of such treatment a composition comprising a therapeutically effective amount of at least one Wnt ligand protein selected from the group consisting of Wnt1, Wnt2, Wnt2B, Wnt3, Wnt3A, Wnt4, Wnt5A, Wnt5B, Wnt6, Wnt7A, Wnt7B, Wnt8A, Wnt8B, Wnt9A, Wnt9B, Wnt10A, Wnt10B, Wnt11 and Wnt16; and
inhibiting viral transcription.
US Pat. No. 10,689,433

TRANSGENIC CHICKEN COMPRISING AN INACTIVATED IMMUNOGLOBULIN GENE

CRYSTAL BIOSCIENCE INC., ...

1. A transgenic chicken comprising a primordial germ cell having a genome in which the endogenous heavy chain immunoglobulin locus has been modified by homologous recombination to contain a transgene,wherein the sequences that flank the transgene in the modified heavy chain immunoglobulin locus are the same as or amplified from the chicken primordial germ cell prior to modification.
US Pat. No. 10,689,690

LIBRARY CONSTRUCTION USING Y-ADAPTERS AND VANISHING RESTRICTION SITES

Centrillion Technology Ho...

1. A method for constructing a library from a nucleic acid, the method comprising:a) placing at least one double-stranded nucleic acid on a surface to which are attached a plurality of adapters, wherein each adapter comprises a double-stranded end;
b) applying a solution to the surface, the solution comprising:
i. a first restriction enzyme digesting the double-stranded nucleic acid into a plurality of double-stranded nucleic acid fragments;
ii. a ligase ligating a first end of one member of the plurality of double-stranded nucleic acid fragments to the double-stranded end of a first adapter of the plurality of adapters, ligating a second end of the one member of the plurality of double-stranded nucleic acid fragments to the double-stranded end of a second adapter of the plurality of adapters, and ligating a third adapter and fourth adapter of the plurality of adapters to form self-ligated double-stranded adapters, wherein both strands of the one member of the plurality of double-stranded nucleic acid fragments are ligated to the first adapter at the first end and to the second adapter at the second end, respectively; and
iii. a second restriction enzyme digesting the self-ligated double-stranded adapters; and
c) forming a first library, the first library comprising a plurality of ligated double-stranded nucleic acid fragments comprising the one member of the plurality of nucleic acid fragments ligated with the first adapter and the second adapter.
US Pat. No. 10,688,153

PEPTIDES AND METHOD FOR TREATMENT OF CARDIAC ARREST

The Board of Trustees of ...

1. A modified peptide comprising a PDZ binding domain consisting of SEQ ID NO:2 or a PDK1 interacting fragment consisting of SEQ ID NO:3 and(a) between one and 50 additional non-native amino acid residues,
(b) introduction of one or more nonhydrolyzable bonds, or
(c) a combination of (a) and (b).
US Pat. No. 10,689,434

ANTIBODY AGAINST HEPATITIS B SURFACE ANTIGEN AND USE THEREOF

XIAMEN UNIVERSITY, Xiame...

1. An antibody or an antigen binding fragment thereof, which can specifically bind to HBsAg, comprising:(a) three complementarity determining regions (CDRs) of heavy chain variable region (VH) selected from the group consisting of:
(i) VH CDR1, consisting of the following sequence: SEQ ID NO: 3, or a sequence that differs from SEQ ID NO:3 by 1 or 2 substitutions selected from the group consisting of:
(01) R or Y at H31; and
(02) W at H32;
(ii) VH CDR2, consisting of the following sequence: SEQ ID NO: 4, or a sequence that differs from SEQ ID NO:4 by 1, 2 or 3 substitutions selected from the group consisting of:
(12) T at H56;
(13) V or N at H57; and
(14) L at H58;
(iii) VH CDR3, consisting of the following sequence: SEQ ID NO: 5
and
(b) three CDRs of light chain variable region (VL) selected from the group consisting of:
(iv) VL CDR1, consisting of the following sequence: SEQ ID NO: 6, or a sequence that differs from SEQ ID NO:6 by 1 or 2 substitutions selected from the group consisting of:
(29) P or T at L27; and
(32) S or N at L30;
(v) VL CDR2, consisting of the following sequence: SEQ ID NO: 7, and
(vi) VL CDR3, consisting of the following sequence: SEQ ID NO: 8;
wherein, the amino acid positions mentioned above are numbered according to Kabat numbering system;
and, the antibody or an antigen binding fragment thereof is humanized, and has a humanization degree of at least 85%.
US Pat. No. 10,688,154

METHODS OF NEUROPROTECTION INVOLVING MACROPHAGE COLONY STIMULATING FACTOR RECEPTOR AGONISTS

THE BOARD OF TRUSTEES OF ...

1. A method of treating a human subject following acute central nervous system injury, the method comprising systemically administering a pharmaceutical composition comprising interleukin 34 (IL-34), or biologically active fragment thereof, to said human only following said acute central nervous system injury.
US Pat. No. 10,689,435

THERAPY AND PROPHYLAXIS OF INFECTIOUS DISEASE CAUSED BY ZIKA VIRUS

KAMADA LTD., Ness Ziona ...

1. A method of treating a mammal in need of treatment for a Zika virus infection, the method comprising administering to the infected mammal a composition comprising human polyclonal antibodies or fragments thereof against the Zika virus wherein the human polyclonal antibodies are purified from a human serum or plasma.
US Pat. No. 10,689,692

METHODS FOR PLACING, ACCEPTING, AND FILLING ORDERS FOR PRODUCTS AND SERVICES

APPLIED BIOSYSTEMS, LLC, ...

1. A system for providing to a consumer, an assay configured to detect a presence or an expression of genetic material, the system comprising:a computer system configured to:
cause a display of a first web-based user interface configured to receive a first input of a first order for a stock assay,
cause a display of a second web-based user interface configured to receive a second input of a request for design of a custom assay comprising a probe comprising a probe sequence and a primer comprising a primer sequence and a third input for a second order for the custom assay,
generate a submission file comprising the first order, the request, or the second order, or any combination thereof, and
design the custom assay based on the submission file and in accordance with criteria selected from one or more of:
avoiding inclusion of a single nucleotide polymorphism or a repeat sequence in the probe sequence and in the primer sequence,
avoiding inclusion of a region of discrepancy between at least two genomic databases in the probe sequence and in the primer sequence, and
including the probe sequence, the primer sequence, or both on an exon-exon boundary of a multi-exon gene;
a system for delivering to the consumer the custom assay manufactured according to the design, the stock assay, or both.