US Pat. No. 10,653,097

MAIZE INBRED PH480P

PIONEER HI-BRED INTERNATI...

1. A seed, plant, plant part, or plant cell of inbred maize variety PH480P, representative seed of the variety having been deposited under ATCC accession number PTA-126376.
US Pat. No. 10,653,609

METHOD OF CLEANING HAIR USING A LOW PH HAIR CARE COMPOSITION

The Procter and Gamble Co...

1. A method of cleansing hair and scalp using an aqueous composition comprising;a. applying an aqueous composition to the hair and scalp, wherein the aqueous composition comprises:
1) from about 1% to about 9% of sodium lauryl ether sulfate;
2) from about 0.5 wt % to about 3 wt % of polyacrylate crosspolymer-6;
3) from about 0.01% to about 5% salicylic acid;
4) from about 80% to about 90% water;
5) citric acid;
6) polysorbate polysorbate-20;
7) perfume;
4) and wherein the pH of the aqueous composition is from about 2 to about 4, and the viscosity of the aqueous composition is from about 6,000 cP to about 9000 cP;
and wherein the method of cleansing hair and scalp comprises the steps:
b. leaving the aqueous composition on hair from about 4 to about 15 minutes, and
c. rinsing the aqueous composition with water;
wherein the aqueous composition is free of conditioning agents selected from the group consisting of silicone oils, cationic silicones, silicone gums, silicone resins, hydrocarbon oils, polyethylene glycol, cationic deposition polymers, quaternary ammonium compounds, polyolefins, and fatty esters.
US Pat. No. 10,654,889

PEPTIDE HAVING ANTICANCER ACTIVITY, AND PHARMACEUTICAL COMPOSITION, HEALTH FUNCTIONAL FOOD COMPOSITION AND FUNCTIONAL COSMETIC COMPOSITION FOR PREVENTING AND TREATING CANCER COMPRISING THE SAME AS ACTIVE INGREDIENT

INDUSTRY-UNIVERSITY COOPE...

wherein the peptide set forth in SEQ ID NO: 2 is bound to the C-terminal Arg of the peptide set forth in SEQ ID NO: 1.
US Pat. No. 10,655,145

REPLICATION-DEFECTIVE ARENAVIRUS VECTORS

1. An infectious arenavirus particle comprising a genome wherein one or more of the three arenavirus open reading frames coding for the glycoprotein (GP), matrix protein Z and RNA-dependent RNA polymerase L are removed or functionally inactivated, wherein the arenavirus particle is infectious, but unable to produce further infectious progeny particles in non-complementing cells, wherein the arenavirus is Pichinde virus or Junin virus, and wherein the genome is engineered to have the ability to amplify and express its genetic information in arenavirus infected cells and comprises a foreign ribonucleic acid sequence coding for:(a) a viral antigen selected from a hepatitis B antigen, a respiratory syncytial virus antigen, a human immunodeficiency virus antigen, an influenza antigen, a hepatitis C virus antigen, a varicella zoster virus antigen, a herpes simplex virus antigen, or a cytomegalovirus antigen;
(b) a bacterial antigen selected from a Haemophilus spp. antigen, a Pneumoccoccus spp. antigen, or a Mycobacterium tuberculosis antigen;
(c) a parasite antigen selected from the group consisting of a plasmodia antigen, an amebia antigen, and a philaria antigen; or
(d) a tumor antigen.
US Pat. No. 10,653,098

MAIZE INBRED PH47WV

PIONEER HI-BRED INTERNATI...

1. A seed, plant, plant part, or plant cell of inbred maize variety PH47WV, representative seed of the variety having been deposited under ATCC accession number PTA-126659.
US Pat. No. 10,653,610

ESSENTIALLY ANHYDROUS HAIR-TREATMENT COMPOSITIONS COMPRISING A BIS-UREA DERIVATIVE AND SILICA AEROGEL

5. A method for styling hair comprising:applying a essentially anhydrous hair-treatment composition of claim 1 to wet or damp hair;
drying the hair without rinsing the essentially anhydrous hair-treatment composition from the hair.
US Pat. No. 10,655,146

TURKEY HERPESVIRUS VECTORED RECOMBINANT CONTAINING AVIAN INFLUENZA GENES

BIOMUNE COMPANY, Lenexa,...

1. A recombinant turkey herpesvirus comprising a hemagglutinin gene of an avian influenza virus and a cytomegalovirus immediate early promoter, wherein said hemagglutinin gene is under control of said cytomegalovirus immediate early promoter and wherein said hemagglutinin gene and said cytomegalovirus immediate early promoter are present between UL45 and UL46 of the turkey herpesvirus genome.
US Pat. No. 10,653,099

MAIZE INBRED PH4D9G

PIONEER HI-BRED INTERNATI...

1. A seed, plant, plant part, or plant cell of inbred maize variety PH4D9G, representative seed of the variety having been deposited under ATCC accession number PTA-126656.
US Pat. No. 10,653,611

HAIR CARE COMPOSITION COMPRISING AMINO SILICONE, FATTY ALCOHOL AND PARAFFIN OIL

1. A cosmetic composition comprising:bis-cetearyl amodimethicone present in an amount of from 0.5% to 3% by weight, relative to a total weight of the composition;
1% to 5% by weight, relative to a total weight of the composition of a cationic surfactant selected from the group consisting of a cetyltrimethylammonium salt, a behenyltrimethylammonium salt, and a dipalmitoylethylhydroxyethylammonium salt;
4% to 6% by weight, relative to a total weight of the composition of one or more fatty alcohols selected from the group consisting of stearyl alcohol, cetyl alcohol, cetylstearyl alcohol, and a combination thereof; and
1 to 10% by weight, relative to a total weight of the composition of a hydrocarbon-based oil selected from the group consisting of a linear or branched C6-C32 alkane; and a saturated or unsaturated, linear or branched hydrocarbon comprising at least 16 carbon atoms; wherein
a pH of the composition is from 2.5 to 5.0,
the composition does not comprise any of an oxidation base, a coupler, an oxidizing agent and a direct dye, and
the composition does not comprise a cationic polymer which is not an amino silicone.
US Pat. No. 10,655,147

METHOD FOR THE OPTOINJECTION OF EXOGENOUS MATERIAL INTO A BIOLOGICAL CELL

Fondazione Istituto Itali...

1. A method for optoinjection of exogenous material into a recipient biological cell, wherein the cell comprises a cell membrane which encloses it, the method comprising:(a) placing a biological cell on a planar surface of a substrate, the cell having a basal surface resting on the planar surface of the substrate and an apical surface opposite the basal surface and in contact with a fluid solution which contains exogenous material;
(b) transmitting a sub-ns pulsed laser beam through a variable convergence/divergence collimator, the collimator comprising a lens with focal length tunable by means of a variable amplitude control electrical signal;
(c) directing the laser beam, having passed through the collimator, through an objective lens configured to focus the laser beam along an optical axis to a focal spot, the optical axis defining an axial direction substantially perpendicular to the planar surface of the substrate, such that the focal spot is positioned along the axial direction,
(d) setting the electric control signal to a first amplitude value which defines a first focal length of the lens, corresponding to a first axial position z of the focal spot along the optical axis, wherein the first amplitude value of the control signal is selected such that the first axial position zi is above the apical surface of the cell at a first axial distance from the planar surface of the substrate; and
(e) moving the focal spot towards the cell along the axial direction by continuously varying the electric control signal from the first amplitude value to a second amplitude value, the second amplitude value defining a second focal length corresponding to a second axial position zf of the focal spot, wherein the second amplitude value of the control signal is selected such that the second axial position is positioned inside the cell, at a second axial distance from the planar surface of the substrate, less than the first axial distance, such that the focal spot traverses the membrane of the cell during the descent of the focal spot towards the cell producing a pore in the membrane, which causes the fluid solution containing exogenous material to enter the cell.
US Pat. No. 10,653,100

ALFALFA VARIETY R410M324

Forage Genetics Internati...

1. A seed of alfalfa variety R410M324, wherein representative seed of said alfalfa variety have been deposited under NCMA Accession No. 202002006.
US Pat. No. 10,653,612

COMPOSITION FOR FORMING A FILM ON KERATIN FIBRES

Noxell Corporation, Hunt...

1. A composition for providing a film on keratin fibres, the composition comprising:(a) an aminosilicone polymer, wherein the aminosilicone polymer comprises amino sidechains, and wherein the aminosilicone polymer has a weight average molecular weight of from about 10,000 Dalton to about 60,000 Dalton;
(b) a silicone resin, wherein the silicone resin is a MQ resin;
(c) a thickening system comprising a polysaccharide;
(d) water;
(e) one or more pigments or one or more coloured materials; and
(f) a deposition enhancer;
wherein when drying the composition spread with an average wet thickness of about 37 micron the fluidity factor is measured to form a drying curve of fluidity factor over time, wherein the fluidity factor is within the range of about 10 Hz to about 0.001 Hz within the first about 15 minutes of drying and the fluidity factor reduces by at least a factor of about 100 within the first about 15 minutes of drying;
wherein the drying curve of fluidity factor over time is measured according to the fluidity factor measurement method and at about 23° C. and ambient conditions and a pH of the composition is from about 3.5 to about 5.
US Pat. No. 10,654,892

METHOD FOR ACTIVATING HELPER T CELL

International Institute o...

1. A method for producing an activated helper T cell, comprising:contacting a WT1 peptide with an antigen-presenting cell comprising one or two MHC class II molecules selected from the group consisting of an HLA-DRB1*0403 molecule, an HLA-DRB1*0406 molecule, an HLA-DRB1*0803 molecule, an HLA-DRB3*0202 molecule, an HLA-DRB4*0101 molecule, an HLA-DPB1*0201 molecule, and an HLA-DPB1*0301 molecule,
wherein the WT1 peptide consists of the amino acid sequence of SEQ ID NO: 2 and is capable of binding to the one or two MHC class II molecules.
US Pat. No. 10,655,916

METHOD FOR NON-DESTRUCTIVE TESTING FOR A REFRACTORY PART

1. A method for inspecting the internal structure of a refractory part made of a fused material and that consists, for more than 90% of its weight, of one or more oxides selected from the group consisting of ZrO2, Al2O3, SiO2, Cr2O3, Y2O3, and CeO2, said refractory part having a thickness smaller than 300 millimeters, said method including the following steps:a) transmitting, by means of an emitting antenna, at least one electromagnetic wave, called the “pulse”, into the refractory part to be inspected;
b) receiving, by means of a receiving antenna, said pulse after it has been reflected by a reflecting zone of the refractory part; and
c) analyzing the time shift between the two preceding steps in order to deduce therefrom the position, in the refractory part, of the reflecting zone, said pulse having a duration shorter than or equal to 0.5 nanoseconds.
US Pat. No. 10,653,613

COMPOSITIONS COMPRISING LYSOZYME HYDROLYSATE FOR USE IN KERATIN-CONTAINING TISSUE

DSM IP ASSETS B.V., Heer...

1. A method of enhancing growth, appearance, and/or volume of keratin-containing tissue comprising orally administering a skin-, hair- or nails-enhancing amount of lysozyme hydrolysate as a tryptophan-containing peptide to a person or animal in need of, or desirous of, enhancing skin, hair or nails such that the person or animal receives 10-100 mg tryptophan (Trp) per day.
US Pat. No. 10,654,893

SELF-ASSEMBLING PEPTIDE COMPOSITIONS

3-D Matrix, Ltd., Tokyo ...

1. An IEIK13 composition comprising:an IEIK13 peptide comprising an amino acid sequence as set forth in SEQ ID NO:3 at a concentration of at least 0.25% weight to volume;
which composition has a pH within the range of 2.5 to 4.0 and an ionic strength within the range of 0 to 0.03 M.
US Pat. No. 10,655,149

PRETREATMENT OF LIGNOCELLULOSIC BIOMASS WITH SULFUR DIOXIDE AND/OR SULFUROUS ACID

Iogen Corporation, Ottaw...

1. A process for hydrolyzing lignocellulosic biomass comprising:a) feeding lignocellulosic biomass and acid into a pretreatment reactor, said acid comprising at least one of sulfur dioxide and sulfurous acid;
b) heating said lignocellulosic biomass in the pretreatment reactor for a time and at a temperature sufficient to provide a slurry comprising pretreated lignocellulosic biomass, said slurry adjacent a headspace comprising sulfur dioxide;
c) removing said slurry from the pretreatment reactor;
d) preventing at least a portion of the sulfur dioxide in the headspace from exiting the pretreatment reactor as the slurry is removed;
e) hydrolyzing cellulose in the removed slurry in the presence of cellulase to produce glucose; and
f) contacting additional lignocellulosic biomass with the sulfur dioxide prevented from exiting the pretreatment reactor in step d) under conditions selected to pretreat the additional lignocellulosic biomass.
US Pat. No. 10,653,614

COFFEE CHERRY COSMETIC COMPOSITION AND METHODS

VDF Futureceuticals, Inc....

1. A cosmetic product comprising:a shampoo, a lotion, a cream, a balm, or an ointment comprising an extract of a primarily red or almost ripe whole dried low-mycotoxin coffee cherry or fragment thereof;
wherein the primarily red or almost ripe whole dried low-mycotoxin coffee cherry or fragment thereof has mycotoxin levels that are below 20 ppb for total aflatoxins, below 5 ppm for total fumonisins, and below 5 ppb for ochratoxins; and
wherein the fragment of the primarily red or almost ripe whole dried low-mycotoxin coffee cherry is selected from the group consisting of pulp, mucilage, and hull.
US Pat. No. 10,654,894

METHODS FOR DELIVERING CARGO INTO A CELL BY USING SIGNAL MOLECULES AS CELL PENETRATION AGENTS

KEENESAW STATE UNIVERSITY...

1. A method for delivering a cargo into a cell, the method comprisingforming a complex by contacting a cell penetrating peptide (CPP) or cell penetrating agent (CPA) covalently linked to an adapter, with a cargo molecule covalently linked to an adapter binding molecule, under conditions suitable for forming a reversible, non-covalent bond between the adapter and adapter binding molecule, wherein the adapter is an EF-hand calcium signaling protein and the adapter binding molecule is an EF-hand calcium signaling protein binding molecule, and
contacting the cell with the complex under conditions sufficient to result in delivery of the cargo inside the cell, wherein the non-covalent bond between the adapter and adapter binding molecule is reversed by intracellular calcium binding to the EF-hand calcium signaling protein.
US Pat. No. 10,655,150

METHODS OF MAKING CAPSINOIDS BY BIOSYNTHETIC PROCESSES

Conagen Inc., Bedford, M...

1. A method of producing a capsinoid, the method comprising:(a) expressing a recombinant capsiate synthase (CS) in a cellular system;
(b) adding 8-methyl-6-nonenoyl-CoA and vanillyl alcohol to the cellular system; and
(c) incubating the cellular system to produce the capsinoid.
US Pat. No. 10,653,615

USE OF A PHOTOSYNTHETIC CELL EXTRACT COMPRISING FUNCTIONAL THYLAKOIDS IN COSMETIC COMPOSITIONS

1. A method for increasing hydration or elasticity of a dry skin comprising applying to the dry skin an effective amount of a cosmetic composition comprising: a functional thylakoids-containing photosynthetic cell extract (PCE), and a topically-acceptable carrier, wherein the PCE is present in an amount from about 0.01% to about 0.1% based upon the total weight of the composition, wherein the dry skin is free from disease.
US Pat. No. 10,654,895

POLYPEPTIDE, DNA MOLECULE ENCODING THE POLYPEPTIDE, VECTOR, PREPARATION METHOD AND USE

WUHAN MORE BIOTECHNOLOGY ...

1. A method for the improvement of condition in a subject comprising administering a polypeptide to the subject,wherein the polypeptide has any one of the amino acid sequences of (I) and (II):
(I) the amino acid sequence of SEQ ID NO: 1;
(II) amino acid sequences obtained from the amino acid sequence as set forth in SEQ ID NO: 1 with amidation, phosphorylation, methylation, acetylation, ubiquitination, or carbonylation of one or more amino acids, and
wherein the improvement of condition is selected from the group consisting of:
the inhibition of bacteria;
the prevention and/or treatment of a bacterial infection disease and/or eczema;
the promotion of tissue repair and/or wound healing; and
the treatment of a burn injury, cold injury, crush injury, war injury, animal bite, nuclear radiation injury or combined injury.
US Pat. No. 10,655,151

PROCESS FOR FERMENTING SUGARS CONTAINING OLIGOMERIC SACCHARIDES

Cargill, Incorporated, W...

1. A process for fermenting a fermentation substrate in the presence of a microorganism, comprising(A) forming a starting fermentation broth containing a starch hydrolysate containing 80-98 weight % (based on carbohydrates) of glucose and 1-20 weight % (based on carbohydrates) of glucose oligomers that are not fermentable by the microorganism, wherein the starting fermentation broth contains at least 30 g/L of glucose;
(B) fermenting the starting fermentation broth in the presence of the microorganism to conditions sufficient to ferment the glucose and reduce the glucose concentration in the fermentation broth to less than 30 g/L;
(C) then adding to the fermentation broth an effective quantity of a least one enzyme that depolymerizes at least one glucose oligomer in the fermentation broth to form glucose;
(D) and then subjecting the fermentation broth to conditions sufficient to simultaneously depolymerize the glucose oligomers and ferment the glucose.
US Pat. No. 10,653,616

COMPOSITION FOR PREVENTING HAIR LOSS OR PROMOTING HAIR GROWTH, CONTAINING GINSENG-DERIVED EXOSOME-LIKE VESICLES

AMOREPACIFIC CORPORATION,...

1. A method for preventing hair loss or promoting hair growth, comprising administering an effective amount of an isolated exosome-like vesicle derived from extracellular fluid of ginseng for preventing hair loss or promoting hair growth to a subject in need thereof, wherein the method prevents hair loss or promotes hair growth.
US Pat. No. 10,655,152

METHOD FOR PRODUCING AN AMIDE

SOLENIS TECHNOLOGIES, L.P...

1. A method for producing an amide compound from a nitrile compound, the method comprising:contacting the nitrile compound with a microorganism producing a nitrile hydratase (NHase) and an amidase, wherein the microorganism has been previously pre-treated by drying before the contacting with the nitrile compound, wherein a ratio of a NHase activity to an amidase activity of the microorganism is increased, when compared to a reference microorganism, which is not pre-treated by drying before being contacted with the nitrile compound,
wherein the microorganism is selected from the group consisting of Rhodococcus rhodochrous, Rhodococcus pyridinovorans, Rhodococcus erythropolis, Rhodococcus equi, Rhodococcus ruber, and Rhodococcus opacus,
the amide compound is at least one selected from the group consisting of acrylamide, methacrylamide, acetamide, and nicotinamide,
the nitrile compound is at least one selected from the group consisting of acrylonitrile, methacrylonitrile, acetonitrile, and 3-cyanopyridine, and
wherein the drying has been conducted by spray drying, freeze-drying, heat drying, air drying, vacuum drying, fluidized-bed drying, spray granulation, or a combination thereof.
US Pat. No. 10,653,617

COMPOSITIONS OF ADDITIVES TO GINGER-CURCUMIN TO FACILITATE GROWTH OF FIBROBLASTS AND COLLAGEN

1. A method of improving the appearance of skin, the method comprising topically applying a composition to the skin, the composition comprising:ginger, curcumin, dimethyl sulfone (MSM), Vitamin C, hyaluronic acid, and sodium lauryl sulfate (SLS); and
a carrier.
US Pat. No. 10,655,153

CHEMOENZYMATIC SYNTHESIS OF PEPTIDE BETA-LACTONES AND BETA-HYDROXY ACIDS

Washington University, S...

1. A method of producing a peptide beta-lactone, the method comprising contacting a beta-hydroxy-alpha-amino acid, a benzoic acid derivative, an aryl carrier protein, and ATP with a non-ribosomal protein synthetase, wherein:the beta-hydroxy-alpha-amino acid is selected from the group consisting of beta-OH-p-NO2-homoPhe and beta-OH-homoPhe;
the aryl carrier protein comprises the amino acid sequence of SEQ ID NO:1;
the non-ribosomal protein synthetase comprises the amino acid sequence of any one of SEQ ID NOS:2, 25, and 26; and
the benzoic acid derivative is 2,3-dihydroxoybenzoic acid.
US Pat. No. 10,653,618

TOPICAL ANTIVIRAL COMPOSITIONS, DELIVERY SYSTEMS, AND METHODS OF USING THE SAME

Novan, Inc., Morrisville...

1. A method of treating and/or preventing a viral infection in a subject in need thereof comprising:administering a topical composition to the skin of a subject,
wherein the topical composition comprises a nitric oxide (NO)-releasing active pharmaceutical ingredient in an amount of about 0.5% to about 25% by weight of the topical composition and the NO-releasing active pharmaceutical ingredient is a NO-releasing compound comprising an NO donor selected from the group consisting of a diazeniumdiolate, nitrosothiol, nitrosamine, hydroxyl nitrosamine, hydroxyl amine and hydroxyurea; and
wherein the topical composition has a Cmax of greater than 160 pmol of NO/mg, as measured by in vitro release testing, thereby treating and/or preventing the viral infection in the subject.
US Pat. No. 10,654,898

RECOMBINANT HUMAN/BOVINE PARAINFLUENZA VIRUS 3 (B/HPIV3) EXPRESSING A CHIMERIC RSV/BPIV3 F PROTEIN AND USES THEREOF

The United States of Amer...

1. A recombinant paramyxovirus, comprising:a viral genome comprising genes encoding parainfluenza virus N, P, M, F, HN, and L proteins, and further comprising a heterologous gene encoding a type I membrane protein comprising a recombinant respiratory syncytial virus (RSV) F ectodomain linked to a transmembrane domain (TM) and cytoplasmic tail (CT) of a parainfluenza virus F protein, wherein the RSV F ectodomain linked to the TM and CT of the parainfluenza virus F protein is encoded by a nucleotide sequence set forth as SEQ ID NO: 11, 22, or 23; and
wherein the recombinant paramyxovirus is a recombinant human/bovine parainfluenza virus 3 (B/HPIV3), a recombinant human parainfluenza virus 3 (HPIV3), or a recombinant bovine parainfluenza virus 3 (BPIV3).
US Pat. No. 10,655,154

USE OF A CELLULOSE HYDROLYSATE FOR BIOGAS PRODUCTION

1. A cellulose hydrolysis method comprising: a step (Y) including contacting a fermentation medium having paper sludge which is used as a carbon source with cellulase secreted from cellulomonas fimi bacteria while living on the fermentation medium until the mean glucose monomer number of cellulose molecules in the fermentation medium is decreased to a range between 5 and 500;a step (X) for production of cellulomonas fimi bacteria implemented prior to the step (Y), the step (X) including the sequential steps in the order of:
a) cultivating the cellulomonas fimi bacteria from deep frozen stock into one or more nutrient agar plates or one or more luria broth plates, and incubating the cellulomonas fimi bacteria at a temperature within a range between 30° C. and 40° C. for a duration between 1 day and 3 days,
b) inoculating a fermentation starter culture in liquid form with three or more colonies taken from the nutrient agar plates or the luria broth plates,
c) incubating the fermentation starter culture inoculated with three or more colonies of step b) at a temperature within the range between about 30° C. and about 40° C. for a duration between about 1 days and about 4 days,
d) incubating a production culture for a period within a range between 36 hours and 72 hours, wherein the incubation is started by preparing a production culture which includes the fermentation starter culture inoculated with three or more of step b) colonies in an amount within a range between 1 wt. % and 10 wt. % with respect to the total weight of the production culture;
e) harvesting biomass upon the end of the step (d) as a fluid product, applying a centrifuge corresponding to an acceleration on the production culture of step d), wherein the production culture includes the fermentation starter culture inoculated with three or more colonies of step b) in an amount within a range between 1 wt. % and 10 wt. % with respect to the total weight of the production culture of step d), within a range between 29000 m/s2 and 80000 g m/s2;
wherein, the step (Y) is a hydrolysis step in which the hydrolysis is carried out after contacting a fermentation medium, the hydrolysis step taking place in an aqueous mixture prepared by mixing the paper sludge with a solid matter within the range of biomass between 25 wt. % and 40 wt. %, with the following further ingredients added onto the paper sludge, amounts of the further ingredients being given per ton of the paper sludge is in the order as below:
5 kg to 10 kg of corn steep liquor, or 12.5 kg to 25 kg of beet molasses, or 2.5 kg to 5 kg of yeast extract, or 5 kg to 10 kg of beer yeast waste, or a mixture thereof;
50 g to 250 g of MgSO4;
100 g to 200 g of the solid product of the biomass wherein the biomass is dried, or 25 liters to 50 liters of the fluid product comprising the harvested biomass;
wherein the aqueous mixture is aerated at a temperature between 30° C. and 40° C. for a period between 24 hours and 72 hours, whilst maintaining a water content of the aqueous mixture.
US Pat. No. 10,653,619

DRUG DEPOTS FOR TREATMENT OF PAIN AND INFLAMMATION

Medtronic, Inc., Minneap...

1. A method of treating, reducing, or preventing pain or inflammation, the method comprising:administering three drug pellets in an epidural cavity to treat, reduce, or prevent the pain or inflammation,
wherein each drug pellet of the three drug pellets is formed by extrusion and comprises:
clonidine or a pharmaceutically acceptable salt, and
a polymer comprising polylactide (PLA), D-lactide, D,L-lactide, L-lactide, or a combination thereof, the polymer comprising at least 80 wt %,
wherein the three drug pellets are configured to release between 0.0005 ?g/day and 100 ?g/day of the clonidine after the administering.
US Pat. No. 10,654,899

TRUNCATED GLYCOPROTEIN G OF HERPES SIMPLEX VIRUS 2

1. A protein comprising a truncated version of the herpes simplex virus 2 (HSV-2) protein membrane-bound glycoprotein G (mgG-2), said protein comprising:(i) an extracellular region of mgG-2 (EX-mgG-2), or a truncated version thereof, wherein said extracellular region EX-mgG-2 comprises at least 290 amino acids and has at least 95% sequence identity (% SI) to SEQ ID NO: 3;
(ii) a truncated transmembrane region of mgG-2 (t-TMR-mgG-2), wherein said truncated transmembrane region t-TMR-mgG-2 comprises 4 or 5 amino acids and has at least 80% sequence identity to SEQ ID NO: 12; and
(iii) an intracellular region of mgG-2 (IC-mgG-2), or a truncated version thereof, wherein said intracellular region IC-mgG-2 comprises at least 26 amino acids and has at least 90% sequence identity to SEQ ID NO: 8.
US Pat. No. 10,655,155

BIOPROCESS FOR COPRODUCTION OF ETHANOL AND MYCOPROTEINS

UNIVERSITY OF STRATHCLYDE...

1. An integrated method or system for producing and isolating mycoprotein produced by Fusarium venenatum and ethanol from hydrolysed starch feedstock, the method comprising the steps of:a) providing an aqueous fermentable broth comprising a hydrolysed starch feedstock;
b) a first fermentation step comprising fermenting at least a portion of the aqueous fermentable broth with Fusarium venenatum in order to obtain mycoprotein produced by Fusarium venenatum respectively and partially fermented broth;
c) separating the mycoprotein produced by Fusarium venenatum from the partially fermented broth;
d) a second fermentation step comprising fermenting at least a portion of the partially fermented broth, optionally with a portion of unfermented aqueous fermentable broth, with a micro-organism(s) in order to obtain ethanol and a spent fermentation residue; and
e) isolating the ethanol from the spent fermentation residue.
US Pat. No. 10,653,620

METHOD FOR TREATING DRY EYE SYNDROME

CROMA-PHARMA GESELLCHAFT ...

1. A method of treating dry eye syndrome, a dry eye sign, or a dry eye symptom, comprising administering a sterile aqueous ophthalmic solution to an eye for the treatment of dry eye syndrome, a dry eye sign, or a dry eye symptom, wherein the sterile aqueous ophthalmic solution comprises:a carrier solution; and
about 0.05 to about 0.5% (w/w) of N—(N-acetylcysteinyl-)chitosan or a pharmaceutically acceptable salt thereof,
wherein the N—(N-acetylcysteinyl-)chitosan or pharmaceutically acceptable salt thereof has a content of free thiol groups in an amount of from 80 ?mol/g polymer to 280 ?mol/g polymer.
US Pat. No. 10,654,900

METHOD FOR TREATING PROSTATITIS UTILIZING THE PORE-FORMING PROTEIN PROAEROLYSIN PRX302

Sophiris Bio, Corp., La ...

1. A method of treating prostatitis in a subject having prostatitis, said method comprising intraprostatically administering to said subject a therapeutically effective amount of PRX302,wherein the PRX302 comprises an amino acid sequence having greater than 98% sequence identity to the amino acid sequence shown in SEQ ID NO:4 and which maintains the ability to selectively target and kill normal prostate cells, wherein the PRX302 comprises a polyhistidine tag;
wherein said administering of the PRX302 results in a reduction in prostate volume.
US Pat. No. 10,655,156

OVEREXPRESSION OF N-GLYCOSYLATION PATHWAY REGULATORS TO MODULATE GLYCOSYLATION OF RECOMBINANT PROTEINS

Amgen Inc., Thousand Oak...

1. A method of decreasing the high mannose glycoform content of a recombinant protein during a mammalian cell culture process, compared to a culture in which mammalian cells are not subject to a transfection to overexpress proteins involved in N-glycosylation, the method comprising:transfecting a mammalian host cell to overexpress a protein that is involved in an N-glycosylation pathway, wherein the protein involved in the N-glycosylation pathway is selected from the group consisting of N-acetyl-glucosaminyltransferase-1 (encoded by Mgat1); N-acetyl-glucosaminyltransferase-2 (encoded by Mgat2); a UDP-Galactose transporter encoded by Slc35a2; and combinations thereof;
growing the transfected mammalian host cell, thereby producing transfected mammalian host cells; and
either
(a) subjecting the transfected mammalian host cells to a temperature shift; or
(b) inducing the transfected mammalian host cells into cell growth arrest by L-asparagine starvation followed by perfusion with a serum-free perfusion media having an L-asparagine concentration of 5 mM or less,
whereby said high mannose glycoform content of the recombinant protein is decreased.
US Pat. No. 10,654,901

MICROORGANISMS WITH INCREASED PHOTOSYNTHETIC CAPACITY

Lumen Bioscience, Inc., ...

1. A genetically-modified Cyanobacterium comprising an exogenous nucleotide sequence comprising SEQ ID NO: 23 that expresses an N-terminal fragment of RpaB polypeptide comprising the amino acid sequence of SEQ ID NO: 2, and wherein the N-terminal fragment does not comprise a DNA binding domain or a functional DNA binding domain, under the control of a promoter that results in down-regulated RpaB pathway activity in the genetically-modified Cyanobacterium as compared to a Cyanobacterium of the same species without the exogenous nucleotide sequence.
US Pat. No. 10,654,902

METHODS AND COMPOSITIONS FOR THE DISPLAY OF POLYPEPTIDES ON THE PILI OF GRAM-POSITIVE BACTERIA

Emory University, Atlant...

1. A recombinant nucleic acid encoding a pilus tip fusion protein comprising an antigen fused to a carboxy-terminus of a fragment of Cpa (SEQ ID NO: 101) comprising a cell wall sorting signal (CWSS) motif, wherein the CWSS is VPPTG (SEQ ID NO: 10) and wherein the pilus tip fusion protein comprises an amino-terminal sec-dependent signal sequence.
US Pat. No. 10,655,158

BACTERIAL COUNTING METHOD

Jiangsu University, Zhen...

1. A bacteria counting method, comprising the following steps:(a) preparing a polyaniline/bacterial composite film on a surface of a glassy carbon electrode via an electro-polymerization method, comprising:
1) preparing a standard bacterial suspension, comprising:
preparing a bacterial culture solution; carrying out autoclaved sterilization of the bacterial culture solution; inoculating a proper amount of strains for culturing; and centrifuging and washing the bacteria solution obtained after culturing to obtain the standard bacterial suspension;
2) fixing of bacteria on the surface of the glassy carbon electrode, comprising:
pretreating the glassy carbon electrode and measuring a cyclic voltammetry curve of the glassy carbon electrode, until a potential difference of the oxidation-reduction peak is reduced to be within 80 mV; drying the glassy carbon electrode; dripping the standard bacterial suspension to the surface of the glassy carbon electrode; and drying, thereby fixing bacteria to the surface of the glassy carbon electrode; and
3) polymerization of phenylamine on the electrode surface, comprising:
putting the glassy carbon electrode fixed with the bacteria into a sulfuric acid solution containing phenylamine; scanning via cyclic voltammetry; and making phenylamine polymerize on the surface of the glassy carbon electrode to obtain the polyaniline/bacterial composite film;
(b) drawing a standard curve of a modified electrode of the polyaniline/bacterial composite film, comprising:
1) carrying out gradient dilution of the standard bacterial suspension obtained in step (a) sequentially to acquire bacterial suspensions with different concentrations;
2) preparing a polyaniline/bacterial composite film on the surface of the glassy carbon electrode for each concentration of the bacterial suspensions with different concentrations according to step (a) and measuring a cyclic voltammetry curve for each concentration of bacterial suspension; and
3) drawing a standard curve of the modified electrode of the polyaniline/bacterial composite film by taking the logarithm of bacterial concentration as horizontal coordinates and taking peak current corresponding to the peak of the cyclic voltammetry curve obtained in step (b)(2) as vertical coordinates; and
(c) measuring a bacterial concentration of a bacteria solution sample according to the standard curve obtained in the step (b).
US Pat. No. 10,654,903

PEPTIDES AND COMBINATION OF PEPTIDES FOR USE IN IMMUNOTHERAPY AGAINST SMALL CELL LUNG CANCER AND OTHER CANCERS

IMMATICS BIOTECHNOLOGIES ...

1. A method of eliciting an immune response in a patient who has cancer, comprising administering to said patient a population of activated T cells that selectively recognize cells that aberrantly present a peptide consisting of the amino acid sequence of SEQ ID NO: 42, wherein said cancer is selected from the group consisting of lung cancer, melanoma, liver cancer, breast cancer, uterine cancer, Merkel cell carcinoma, pancreatic cancer, gallbladder cancer, bile duct cancer, colon or rectum cancer, urinary bladder cancer, kidney cancer, leukemia, ovarian cancer, esophageal cancer, brain cancer, gastric cancer, and prostate cancer.
US Pat. No. 10,653,624

DELIVERY METHOD OF TARGET MATERIAL INTO EXTRACELLULAR VESICLES USING EXTRACORPOREAL SHOCKWAVE

EXOLLENCE BIOTECHNOLOGY C...

1. A method of delivering a target material into an isolated extracellular vesicle, the method comprising:exposing the target material and the isolated extracellular vesicle to an extracorporeal shockwave for i) increasing a number of the isolated extracellular vesicle, ii) increasing properties of at least one selected from the group consisting of zeta potential of the isolated extracellular vesicle and an ability of incorporation of the isolated extracellular vesicle into cells, and iii) delivering the target material into the isolated extracellular vesicle.
US Pat. No. 10,654,904

PEPTIDES AND COMBINATION OF PEPTIDES FOR USE IN IMMUNOTHERAPY AGAINST SMALL CELL LUNG CANCER AND OTHER CANCERS

IMMATICS BIOTECHNOLOGIES ...

1. A method of eliciting an immune response in a patient who has cancer, comprising administering to said patient a population of activated T cells that selectively recognize cells that aberrantly present a peptide consisting of the amino acid sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10,wherein the activated T cells are cytotoxic T cells produced by contacting T cells with an antigen presenting cell that presents the peptide in a complex with an MHC class I molecule on the surface of the antigen presenting cell, for a period of time sufficient to activate said T cell,
wherein said cancer is selected from the group consisting of lung cancer, melanoma, liver cancer, breast cancer, uterine cancer, Merkel cell carcinoma, pancreatic cancer, gallbladder cancer, bile duct cancer, colon or rectum cancer, urinary bladder cancer, kidney cancer, leukemia, ovarian cancer, esophageal cancer, brain cancer, gastric cancer, and prostate cancer.
US Pat. No. 10,653,625

PRODUCTION OF DOSAGE FORMS COMPRISING A SOLID DISPERSION OF A MICROCRYSTALLINE AGENT

1. A method of producing a dosage form comprising a solid dispersion of a microcrystalline active substance, the method comprising the steps of:a) melting a thermoplastic polymer with a glass transition temperature Tg of at least 20° C. and dissolving the active substance homogeneously in the melt, wherein solubility of the active substance in water is less than 5 g/100 mL at 22° C., thereby obtaining a mass;
b) prior to complete solidification of the mass obtained, initiating controlled crystallization of the active substance in the mass obtained by at least one of:
adding water,
adding seed crystals of the active substance,
adding a derivatization reagent, or
holding the mass obtained at a temperature of at least 35° C., which temperature is below the temperature at which the active substance is completely soluble in the mass, for a sufficient length of time for initiation of crystallization of the active ingredient to occur; and
c) cooling the mass;thereby obtaining, without grinding of the active substance, crystals of active substance having an average particle size of from 500 nm to 100 ?m, wherein the crystals of active substance are embedded in a matrix of the thermoplastic polymer and stabilized against agglomeration.
US Pat. No. 10,654,905

METHOD OF TREATING GRAFT VERSUS HOST DISEASE WITH AN INTERLEUKIN-2 MUTEIN

The Board of Trustees of ...

1. A method of treating a subject having graft versus host disease (GVHD), the method comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising an IL-2 mutein and a pharmaceutically acceptable carrier, wherein said IL-2 mutein comprises amino acid substitutions L18R, Q22E, Q126T, and S130R numbered in accordance with wild-type human IL-2 (hIL-2), and wherein said IL-2 mutein has an increased binding affinity for IL-2R13 and a decreased binding affinity for IL-2R?c receptor as compared to wild-type hIL-2.
US Pat. No. 10,655,161

DIAGNOSTIC AND PROGNOSTIC ASSAYS BASED ON CIRCULATING TYROSINE KINASE ACTIVITY

Quest Diagnostics Investm...

1. A method for measuring BCR-ABL1 kinase activity in a human subject having a BCR-ABL1-positive leukemia comprising:(a) contacting an acellular body fluid sample from a human subject having a BCR-ABL1-positive leukemia with a poly(Glu-Tyr) tyrosine kinase (TK) substrate;
(b) detecting phosphorylation of the poly(Glu-Tyr) TK substrate by tyrosine kinases in the acellular body fluid sample to determine a circulating tyrosine kinase (cTK) activity level in the acellular sample; and
(c) comparing the cTK activity level to a reference cTK activity level in a comparable sample from a healthy individual, wherein the difference in cTK activity is indicative of the level of BCR-ABL1 kinase activity in the subject, wherein BCR-ABL1-positive leukemia is selected from the group consisting of BCR-ABL1-positive chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), and acute lymphoblastic leukemia (ALL) and the acellular body fluid sample is serum or plasma.
US Pat. No. 10,654,906

HIGH-STABILITY T-CELL RECEPTOR AND PREPARATION METHOD AND APPLICATION THEREOF

Guangdong Xiangxue Life S...

1. A mutated T cell receptor (TCR) that is a single-chain TCR, comprising a mutated TCR ? chain variable domain, a mutated TCR ? chain variable domain, and a flexible peptide linker linking the variable domains,wherein the mutated ? chain variable domain amino acid sequence is selected from the group consisting of SEQ ID NOs: 35, 99, and 101;
wherein the mutated ? chain variable domain amino acid sequence is selected from the group consisting of SEQ ID NOs: 36, 100, and 102;
wherein the mutated TCR has a stability at least 80% higher than that of the corresponding wild-type TCR with wild-type hydrophobic core, wherein the term “stability” refers to protein stability, and wherein compared with the original wild-type TCR, the mutated TCR has one or more characteristics selected from the group consisting of higher resistance to unfolding, higher resistance to inappropriate or undesirable folding, stronger renaturability, stronger expression ability, higher protein renaturation yield, and increased thermal stability.
US Pat. No. 10,655,162

IDENTIFICATION OF BIOMOLECULAR INTERACTIONS

The Broad Institute, Inc....

1. A biomolecule detection system comprising(a) a single-stranded nucleic acid comprising two 3? ends, wherein one 3? end comprises a first anchor domain and the other 3? end comprises a second anchor domain; and
(b) a barcoded nucleic acid comprising a primer domain, a barcode domain and a nucleotide domain that is complementary to the first anchor domain of the single-stranded nucleic acid of (a).
US Pat. No. 10,654,907

METHODS AND COMPOSITIONS FOR PRODUCING A CELL EXPRESSING A T CELL RECEPTOR

University Health Network...

1. A method for obtaining a recombinant cell expressing a TCR specific for a peptide of interest comprising:a. transducing a cell population comprising cells expressing an endogenous prey TCR polypeptide chain with a bait nucleic acid encoding an exogenous bait TCR polypeptide chain, wherein the bait TCR polypeptide chain in combination with a counterchain TCR polypeptide can constitute a parent TCR that specifically binds said peptide of interest, wherein the counterchain TCR polypeptide is not the endogenous prey TCR polypeptide chain;
b. culturing the transduced cell population under conditions that permit the bait TCR polypeptide chain to be expressed;
c. i) obtaining a recombinant cell expressing a TCR comprising the bait TCR polypeptide chain and the prey TCR polypeptide chain that selectively binds said peptide of interest from the transduced cell population obtained in step (b), the obtaining comprising measuring the avidity and/or affinity of the TCR comprising the bait TCR polypeptide chain and the prey TCR polypeptide chain, and selecting the recombinant cell wherein the TCR has increased avidity and/or affinity for the peptide of interest compared to a preselected standard;
ii) isolating a prey nucleic acid encoding the prey TCR polypeptide chain from the cell obtained in step (c)(i); and
iii) introducing the isolated prey nucleic acid and the bait nucleic acid into a cell able to express a TCR or differentiate into a cell able to express a TCR under conditions that permit the TCR polypeptide chains to be expressed.
US Pat. No. 10,655,163

METHODS, KITS, AND SYSTEMS FOR MULTIPLEXED DETECTION OF TARGET MOLECULES AND USES THEREOF

THE GENERAL HOSPITAL CORP...

1. A method for detecting a plurality of target molecules in a sample comprising:a. contacting a sample with a composition comprising a plurality of target probes, wherein each target probe in the plurality comprises:
i. a target-binding molecule that specifically binds to a distinct target molecule in the sample;
ii. an identification nucleotide sequence that identifies the target-binding molecule; and
iii. a cleavable linker between the target-binding molecule and the identification nucleotide sequence;
b. separating unbound target probes from a plurality of complexes in the sample, each complex having a target molecule and a single target probe bound thereto, wherein the complex does not have a second target probe binding to a different region of the target molecule;
c. releasing the identification nucleotide sequences from the plurality of complexes;
d. coupling the released identification nucleotide sequences from the releasing step (c) to a detection composition comprising a plurality of reporter probes, wherein each reporter probe in the plurality comprises a detectable label that identifies the reporter probe, wherein the label creates a unique distinguishable signal for each reporter probe; and
e. detecting signals from the released identification nucleotide sequences based on a non-gel electrophoresis method, wherein the signals are distinguishable for the identification nucleotide sequences, thereby identifying the corresponding target-binding molecules and detecting a plurality of different target molecules in the sample.
US Pat. No. 10,653,628

HIGH SURFACE-AREA LYOPHILIZED COMPOSITIONS COMPRISING ARSENIC FOR ORAL ADMINISTRATION IN PATIENTS

Orsenix Holdings BV, Wil...

1. A solution for use in the lyophilization of a pharmaceutical compound comprising:an amount of water;
an amount of solubilized arsenic trioxide;
an amount of solubilized alkalizing agent;
an amount of solubilized surfactant; and,
an amount of an acid;
wherein the amount of solubilized arsenic trioxide is present in the solution at a concentration level of about 6 mg/mL to about 50 mg/mL.
US Pat. No. 10,654,908

ISOLATED T CELL RECEPTORS AND METHODS OF USE THEREFOR

University of Virginia Pa...

1. An isolated T cell receptor (TCR), or portion thereof, that specifically binds to a phosphopeptide-HLA-A2 complex, wherein the phosphopeptide has the amino acid sequence set forth in SEQ ID NO: 12, and the isolated TCR, or portion thereof, comprises:an alpha chain variable domain comprising a CDR1 region sequence comprising amino acids 48-53 of SEQ ID NO: 14, a CDR2 region sequence comprising amino acids 71-77 of SEQ ID NO: 14, and a CDR3 region sequence comprising amino acids 112-121 of SEQ ID NO: 14; and
a beta chain variable domain comprising a CDR1 region sequence comprising amino acids 56-60 of SEQ ID NO: 16, a CDR2 region sequence comprising amino acids 78-83 of SEQ ID NO: 16, and a CDR3 region sequence comprising amino acids 121-129 of SEQ ID NO: 16.
US Pat. No. 10,653,629

SINGLE LAYER ORAL DOSE OF NEURO-ATTENUATING KETAMINE

Amorsa Therapeutics, Inc....

1. A single-layer orally administered tablet composition comprising neuro-attenuating ketamine (NAKET) and a polymer.
US Pat. No. 10,654,909

SOLUBLE ALPHA KLOTHO AND SERUM ALBUMIN FUSION PROTEIN

Novartis AG, Basel (CH)

1. A composition comprising a fusion polypeptide comprising, in N-terminal to C-terminal order: (a) an alpha sKlotho, in which 20 amino acids have been deleted from the C-terminus, having the sequence of SEQ ID NO: 77, and having mutations at V563A and K795E; (b) a linker; and (c) serum albumin.
US Pat. No. 10,653,630

COMPOSITION AND METHOD FOR REDUCING ZOONOTIC INFECTIOUS DISEASES

US Biologic, Inc., Memph...

1. A reservoir targeted oral vaccine composition for oral delivery of an antigenic agent, comprising: i) a bait substrate having a surface; ii) an effective amount of at least one antigenic agent layered over said substrate, wherein said at least one antigenic agent is stabilized within a stabilizer under conditions facilitating anhydrobiosis, said stabilizer selected from at least one of the group consisting of a hydrocolloid polymer and a plasticizing sugar, complexed in solution with a phosphate-buffered saline liquid carrier; and iii) a calcium salt cross-linking agent to facilitate encapsulation of said antigenic agent within said stabilizer on said surface of said substrate; wherein said antigenic agent is a bacterial vehicle, said bacterial vehicle defined by a recombinant whole-cell OspA-vectored Escherichia coli bacteria engineered to express at least one antigen.
US Pat. No. 10,654,910

FACTOR VIII PROTEINS HAVING ANCESTRAL SEQUENCES, EXPRESSION VECTORS, AND USES RELATED THERETO

Emory University, Atlant...

1. A recombinant or chimeric FVIII protein, comprising, in an N- to C-terminal direction, an A1 domain, an A2 domain, a linker, an ap domain, an A3 domain, a C1 domain, and a C2 domain, wherein the protein has a B-domain deletion with the A2 and ap domains joined by the linker, and wherein the protein has FVIII activity, and:the A1 domain has an amino acid sequence at least 96% identical to SEQ ID NO: 22;
the A2 domain has an amino acid sequence at least 96% identical to SEQ ID NO: 23;
the ap domain has an amino acid sequence at least 96% identical to SEQ ID NO: 25;
the A3 domain has an amino acid sequence at least 96% identical to SEQ ID NO: 26;
the C1 domain has an amino acid sequence at least 96% identical to SEQ ID NO: 27; and
the C2 domain has an amino acid sequence at least 96% identical to SEQ ID NO: 28.
US Pat. No. 10,655,166

ELECTRICALLY ACTIVE COMBINATORIAL CHEMICAL (EACC) CHIP FOR BIOCHEMICAL ANALYTE DETECTION

Intel Corporation, Santa...

1. An apparatus, comprising a substrate including an array of regions defining a plurality of cells, each of the plurality of cells including a reaction cavity containing multiple functional binding groups, wherein the array of regions comprises a first gradient of a first functional binding group and a second gradient of a second functional binding group, wherein an inter-molecular distance between the first functional binding group and the second functional binding group corresponds to a distance between binding locations on a biochemical analyte, wherein the plurality of cells comprise a chip for analyte detection having a feature size between 0.5 microns and 500 microns and analyte detection comprises creation of a binding site with one or more of the multiple functional binding groups, wherein the substrate comprises trichlorophenylsilane.
US Pat. No. 10,654,911

VECTOR CO-EXPRESSING TRUNCATED VON WILLEBRAND FACTOR AND FACTOR VIII

Beijing Neoletix Biologic...

1. A vector comprising:(a) a first polynucleotide sequence encoding a B-domain-deleted factor VIII protein (FVIII), operably linked to a first promoter, and
(b) a second polynucleotide sequence encoding a fusion protein comprising a truncated von Willebrand factor (vWF) and an immunoglobulin Fc fused to the C-terminal of the truncated vWF, operably linked to a second promoter,
wherein the truncated vWF comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4, or having 95% amino acid sequence identity thereof.
US Pat. No. 10,655,167

LIGASE-ASSISTED NUCLEIC ACID CIRCULARIZATION AND AMPLIFICATION

General Electric Company,...

1. A method for nucleic acid amplification, the method comprising:(a) ligating a linear chromosomal DNA to generate a single-stranded DNA circle; and
(b) amplifying the single-stranded DNA circle via rolling circle amplification using a random primer mixture to form an amplified DNA product,
wherein the random primer mixture comprises 2-amino-deoxyadenosine and 2-thio-deoxythymidine nucleotide analogs, and
wherein all the steps of the method are performed in a single reaction vessel without any intervening isolation or purification steps.
US Pat. No. 10,653,632

BINDER POWDERS

Monash University, (GB)

1. A binder powder comprising:spray-dried coated binder particles comprising core binder particles that are water soluble or wettable and a surface coating of L-leucine, isoleucine or trileucine covering a surface of each core binder particle, the L-leucine, isoleucine or trileucine provided in an effective amount of up to 20% by weight of the core binder particles to form a non-cohesive layer having an average layer thickness of about 1 ?m or less on each of the core binder particles; and
wherein at least 80% by mass of the spray-dried coated binder particles have a volume equivalent spherical diameter of about 20 ?m or less.
US Pat. No. 10,654,912

HUMAN SERUM ALBUMIN MUTANT

JCR PHARMACEUTICALS CO., ...

1. A human serum albumin mutant-linked 22K growth hormone consisting of the amino acid sequence set forth as SEQ ID NO:11.
US Pat. No. 10,655,168

MODIFIED BIOTIN-BINDING PROTEINS FOR IMMOBILIZATION

Pacific Biosciences of Ca...

1. A composition comprising a modified biotin-binding protein that comprises one or more covalently attached sulfonate moieties.
US Pat. No. 10,653,633

PHARMACEUTICAL COMPOSITIONS OF PIMOBENDAN

1. A composition comprising pimobendan in particulate form coated with a carrier matrix to form coated particles, wherein the carrier matrix comprises one or more pharmaceutically acceptable carriers selected from the group consisting of:a. a polyglycolized glyceride comprising a lauroyl macrogolglyceride or a stearoyl macrogolglyceride; and
b. a polyglycolized glyceride comprising a lauroyl macrogolglyceride or a stearoyl macrogolglyceride, the polyglycolized glyceride being in combination with a polyethylene glycol having an average molecular weight ranging from 4,000 to 6,000 g/mol.
US Pat. No. 10,655,169

NUCLEIC ACID MELTING ANALYSIS WITH SATURATION DYES

University of Utah Resear...

1. A PCR reaction mixture, comprising:a pair of oligonucleotide primers configured for amplifying at least a portion of a target nucleic acid to generate an amplicon;
a thermostable polymerase;
an unlabeled probe comprising a nucleic acid having a nucleic acid sequence completely complementary to at least a portion of a first allele of the target nucleic acid, the unlabeled probe being blocked at its 3?-end to prevent extension of the unlabeled probe during amplification, the unlabeled probe being operable to hybridize to the first allele so as to form a first duplex and to hybridize with at least one mismatch to a second allele of the target nucleic acid so as to form a second duplex, with at least one mismatch to a third allele of the target nucleic acid so as to form a third duplex, and with at least one mismatch to a fourth allele of the target nucleic acid so as to form a fourth duplex, such that the unlabeled probe is adapted to bind differentially to the first allele, the second allele, the third allele, and the fourth allele; and
a dsDNA binding dye having a percent saturation of at least 90%, the dsDNA binding dye operable to bind to any of the first duplex, second duplex, third duplex, or fourth duplex that are present in the solution, the dsDNA binding dye being provided at a concentration suitable for distinguishing between the first duplex, second duplex, third duplex, and fourth duplex by melting curve analysis of a signal produced by the dsDNA binding dye during melting of first duplex, second duplex, third duplex, or fourth duplex without the dsDNA binding dye redistributing enough during melting to obscure lower temperature melting transitions, wherein at the concentration provided, the dsDNA binding dye does not significantly inhibit amplification of the target nucleic acid,
wherein the unlabeled probe and the dsDNA binding dye are free in solution, the unlabeled probe and dsDNA binding dye being operable for detecting a double-stranded nucleic acid using the dsDNA binding dye without immobilizing the unlabeled probe or the amplicon, the double-stranded nucleic acid comprising a strand of the amplicon hybridized to the unlabeled probe.
US Pat. No. 10,653,634

POLYMERIC NANOPARTICULATE FORMULATION TO ENHANCE THE ORAL BIOAVAILABILITY OF DAPOXETINE

King Abdulaziz University...

1. A plurality of nanoparticles, each of said nanoparticles comprising dapoxetine, zein and alpha-lipoic acid (ALA), wherein the dapoxetine is present in a weight percentage of 3 to 35; the zein is present in a weight percentage of 50 to 70, and the ALA is present in a weight percentage of 3 to 10.
US Pat. No. 10,654,914

POLYOMAVIRUS NEUTRALIZING ANTIBODIES

Novartis AG, Basel (CH)

1. A pharmaceutical composition comprising an antibody or antigen binding fragment thereof, wherein said antibody or antigen binding fragment thereof binds to BK virus VP 1 and comprises: a heavy chain variable region that comprises (a) a HCDR1 (CDR-Complementarity Determining Region) of SEQ ID NO: 6, (b) a HCDR2 of SEQ ID NO: 7, (c) a HCDR3 of SEQ ID NO: 8 and a light chain variable region that comprises: (d) a LCDR1 of SEQ ID NO:16, (e) a LCDR2 of SEQ ID NO: 17, and (f) a LCDR3 of SEQ ID NO: 18.
US Pat. No. 10,655,170

COUPLING ADAPTORS TO A TARGET NUCLEIC ACID

Takara Bio USA, Inc., Mo...

1. A method of coupling adaptors to a target nucleic acid, the method comprising:coupling a first adaptor to a first end of the target nucleic acid to form a coupled first adaptor;
hybridizing a portion of a second adaptor to a portion of the coupled first adaptor to produce a hybridized structure having a hybridized second adaptor in which the hybridized second adaptor comprises a single-stranded 3?-end; and
coupling the single-stranded 3?-end of the hybridized second adaptor of the hybridized structure to a second end of the target nucleic acid to form an adaptor-flanked product, the adaptor-flanked product comprising at least a part of the first adaptor coupled to the first end of the target nucleic acid and at least a part of the second adaptor coupled to the second end of the target nucleic acid.
US Pat. No. 10,653,123

METHODS AND COMPOSITIONS FOR PERTURBING GENE EXPRESSION IN HEMATOPOIETIC STEM CELL LINEAGES IN VIVO

Dana-Farber Cancer Instit...

1. A method of generating transduced resting cells of the hematopoietic stem cell lineage that are differentiated in vivo and inducibly express an RNA encoded by an exogenous DNA integrated into the genome of the cells by at least one viral vector, comprising:a) obtaining cells of the hematopoietic stem cell lineage;
b) transducing the cells with at least one viral vector, wherein each viral vector integrates an exogenous DNA into the genome of the cell and the integrated exogenous DNA inducibly expresses an RNA encoded by the exogenous DNA; bb
c) transplanting the transduced cells to an immunocompromised incubator animal, wherein the transplanted transduced cells reconstitute the immunocompromised incubator animal immune system;
d) selecting populations of resting reconstituted immune cells of interest from the incubator animal; and
e) transplanting the resting reconstituted immune cells of interest from the incubator animal transduced resting cells of the hematopoietic stem cell lineage that are differentiated in vivo into an experimental animal, wherein the experimental animal expresses an inducer of the inducible RNA expression before transplantation, and monitoring the transplanted cells in response to exogenous perturbation,
thereby generating transduced resting cells of the hematopoietic stem cell lineage that are differentiated in vivo and inducibly express an RNA encoded by an exogenous DNA integrated into the genome of the cells by at least one viral vector.
US Pat. No. 10,653,635

NANOFIBER SCAFFOLDS FOR BIOLOGICAL STRUCTURES

NANOFIBER SOLUTIONS, LLC,...

8. A method comprising:applying to a wound a synthetic construct comprising at least one layer of electrospun polymer fibers, wherein at least about 75% of the fibers have a fiber angle within about 10° of parallel.
US Pat. No. 10,654,915

ANTIBODIES USEFUL IN PASSIVE INFLUENZA IMMUNIZATION

TRELLIS BIOSCIENCE, LLC, ...

1. A monoclonal antibody, or an antigen-binding fragment thereof, which antibody is selected from the group consisting of MAB383, MAB486, MAB579, MAB699, MAB700, MAB708, MAB710, MAB711 and MAB723 and binds to Influenza A HA0 protein and wherein,MAB579 is an antibody comprising (i) a heavy chain variable region that comprises CDR1 of the sequence AYTIH (SEQ ID NO:58), and CDR2 of the sequence WINAGNGHTKYSQRFKGR (SEQ ID NO:59), and CDR3 of the sequence GPETYYYDKTNWLNSHPDEYFQH (SEQ ID NO:60); and (ii) a light chain variable region that comprises CDR1 of the sequence RASQTINNYLA (SEQ ID NO:76) and CDR2 of the sequence KASSLES (SEQ ID NO:77) and CDR3 of the sequence QEYNNDSPLT (SEQ ID NO:78);
MAB699 is an antibody comprising (i) a heavy chain variable region that comprises CDR1 of the sequence SYTLH (SEQ ID NO:61), and CDR2 of the sequence WINAGNGKTKYPPKFRGR (SEQ ID NO:62), and CDR3 of the sequence GPESYYYDRSDWLNSHPDEYFQY (SEQ ID NO:63); and (ii) a light chain variable region that comprises CDR1 of the sequence RASQSISSWLA (SEQ ID NO:79) and CDR2 of the sequence KASQLES (SEQ ID NO:80) and CDR3 of the sequence QLYNVYSPLT (SEQ ID NO:81);
MAB700 is an antibody comprising (i) a heavy chain variable region that comprises CDR1 of the sequence SFTMH (SEQ ID NO:64), and CDR2 of the sequence WINAGNGKTKYSQKFQGR (SEQ ID NO:65), and CDR3 of the sequence GPETYYYDSSNWLNSHPDEYLQY (SEQ ID NO:66); and (ii) a light chain variable region that comprises CDR1 of the sequence RASQSISSWLA (SEQ ID NO:79) and CDR2 of the sequence KASTLES (SEQ ID NO:82) and CDR3 of the sequence QEYNNNSPLT (SEQ ID NO:83);
MAB708 is an antibody comprising (i) a heavy chain variable region that comprises CDR1 of the sequence SFTMH (SEQ ID NO:64), and CDR2 of the sequence WINAGNGKTKYSQKFQGR (SEQ ID NO:65), and CDR3 of the sequence GPETYYYDSSNWLNSHPDEYFQH (SEQ ID NO:67); and (ii) a light chain variable region that comprises CDR1 of the sequence RASQSISSWLA (SEQ ID NO:79) and CDR2 of the sequence KASSLES (SEQ ID NO:77) and CDR3 of the sequence QEYNNNSPLT (SEQ ID NO:83);
MAB710 is an antibody comprising (i) a heavy chain variable region that comprises CDR1 of the sequence SYSVH (SEQ ID NO:68), and CDR2 of the sequence WINAGNGKTKYPQKFKGR (SEQ ID NO:69), and CDR3 of the sequence GPDSYYYDRNDWLNSHPDEYFQH (SEQ ID NO:70); and (ii) a light chain variable region that comprises CDR1 of the sequence RASQSIDSWLA (SEQ ID NO:84) and CDR2 of the sequence KASNLES (SEQ ID NO:85) and CDR3 of the sequence QLYNVHLI (SEQ ID NO:86);
MAB711 is an antibody comprising (i) a heavy chain variable region that comprises CDR1 of the sequence TYTIH (SEQ ID NO:71), and CDR2 of the sequence WINAANGHTKYSRKLRSR (SEQ ID NO:72), and CDR3 of the sequence GPETYYFDKTNWLNSHPDEYFQH (SEQ ID NO:73) and (ii) a light chain variable region that comprises CDR1 of the sequence RASQSISTWLA (SEQ ID NO:87) and CDR2 of the sequence KASNLES (SEQ ID NO:85) and CDR3 of the sequence QEYNNDSPLI (SEQ ID NO:88);
MAB723 is an antibody comprising a heavy chain variable region that comprises (i) CDR1 of the sequence SYTLH (SEQ ID NO:61), and CDR2 of the sequence WINAGNGKVKYPRKLQGR (SEQ ID NO:74), and CDR3 of the sequence GPESYFFDTSNHLNSHPDEYFQF (SEQ ID NO:75); and (ii) a light chain variable region that comprises CDR1 of the sequence RASQSISSYLA (SEQ ID NO:89) and CDR2 of the sequence KASNLES (SEQ ID NO:85) and CDR3 of the sequence QEYNNNSPLT (SEQ ID NO:83);
MAB383 is an antibody comprising a heavy chain that comprises the sequence QVQLVQSGAEVKRPGASVKVSCRASGYTFTSFGFSWVRQAPGQGLEWMGWISAYNGD TKSPQKLQGRVTMTTDTSTNTAYMELRSLISDDTAVYYCARAPPLYYSSWSSDYWGQG TLLTVSS (SEQ ID NO:4) and a light chain that comprises the sequence DIQMTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQKHGQAPRPLIYGASRRATDV PDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRTFGQGTKLEIK (SEQ ID NO:5); and
MAB486 is an antibody comprising a heavy chain that comprises the QVQLVESGGGMVQPGGSRRLSCAASGFSFSTYGMHWVRQAPGKGLEWVAVISYDGEK QYYLDSVKGRFTISRDNSKDTLYLQMNSLTAEDTAVYYCVKESARRLLRYFEWLLSSPF DNWGQGALVTVSS (SEQ ID NO:6) and a light chain that comprises the sequence DIVMTQSPDSLAVSLGERATINCKSSQTVLYTSNKKNYLAWYQQKPGQPPKLLIYWAST RESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYTSPYTFGQGTKLEIK (SEQ ID NO:7).
US Pat. No. 10,655,171

MODULAR FLOW CELLS AND METHODS OF SEQUENCING

QIAGEN SCIENCES, LLC, Ge...

1. A method of incorporating labeled nucleotides into nucleic acid, comprising:a) providing
i) a modular flow cell comprising a plurality of modules, wherein said modules are moveable and removable inserts, each module comprising biomolecules bound to a surface of a lane or fluidic channel, said plurality of modules sharing an input and output port, wherein each module comprises a fluidic channel and the fluidic channel of one module is blocked so that no solutions enter said blocked fluidic channel, and
ii) a solution comprising polymerase and a plurality of nucleotide analogues wherein at least one nucleotide analogue is labeled with a unique label;
b) introducing said solution into at least one module of said plurality of modules under conditions wherein a first nucleotide analogue is incorporated by said polymerase; and
c) detecting the label of the incorporated nucleotide analogue.
US Pat. No. 10,653,636

MEDICAL ACTIVE SUBSTANCE PATCH WITH REDUCED OPTICAL CONSPICUOUSNESS ON THE SKIN

LTS Lohmann Therapie-Syst...

1. A medical active substance patch that is optically inconspicuous when worn on the skin, independent of whether the patch is attached to a light-skinned person or a stark-skinned person, comprising a monolayer or multilayer matrix and a backing layer connected with said matrix, said backing layer having one side averted from the skin, wherein at least one layer of the matrix contains a pharmaceutically active substance, and wherein at least one layer of the matrix contains an ingredient selected from the group consisting of at least one coloured ingredient, and at least one colourless ingredient being colourless in an initial state and tending to discolour or to discolour(s) during storage or to discolour during the application period, and wherein said at least one coloured ingredient and said at least one colourless ingredient are selected from the group consisting of a pharmaceutically active substance and an auxiliary agent;wherein said active substance patch comprises at least one pigment admixed into a coating on the backing layer to impart a lightness colour value L1 that renders the patch optically inconspicuous on a first person's skin,
in the state of having been applied to the first person's skin said patch, at a place of the skin covered with the patch, the lightness colour value L1 is not less than 50% and not more than 200% of a lightness colour value L2, with L2 being the lightness value of the region of the skin of the same person which surrounds the applied patch,
that the same applies in respect of the skin of a second or any other person, provided that L2 is in the range from 5° to 100° and the pigments admixed into the coating on the backing layer range in an amount from 0.25 to 0.5 wt % and deviate from the color tone of the skin underlying the patch and the lightness colour values L1 and L2 are determined via a tristimulus colorimeter,
wherein said patch is transparent or translucent.
US Pat. No. 10,655,172

ARTICLES HAVING LOCALIZED MOLECULES DISPOSED THEREON AND METHODS OF PRODUCING SAME

Pacific Biosciences of Ca...

1. A system comprising:an array of nanoscale wells disposed through an opaque layer, each well having a bottom surface formed from a transparent layer underlying the opaque layer; wherein a plurality of the wells in the array comprise an enzyme bound to the bottom surface and located in an observation region; and wherein portions of the array other than the bottom surface of the wells are substantially free of the enzyme;
an illumination source that provides illumination to the observation regions through the transparent layer; and
an optical detector that receives electromagnetic radiation emitted through the transparent layer from the observation regions.
US Pat. No. 10,654,917

ANTIBODY MOLECULES AND PEPTIDE DELIVERY SYSTEMS FOR USE IN ALZHEIMER'S DISEASE AND RELATED DISORDERS

TECHNOPHAGE, INVESTIGACAO...

1. A delivery fusion protein comprisinga hydrophobic fragment of the amino acid sequence SEQ ID NO: 22 or 24, and
a cargo molecule in association with said hydrophobic fragment;
wherein said cargo molecule is at least one selected from the group consisting of an antibody molecule and a heterologous polypeptide; and
wherein said delivery fusion protein facilitates specific delivery of said cargo molecule across the blood brain barrier of said subject.
US Pat. No. 10,655,173

SPATIAL AND CELLULAR MAPPING OF BIOMOLECULES IN SITU BY HIGH-THROUGHPUT SEQUENCING

THE BROAD INSTITUTE, INC....

1. A method for single cell mapping comprising(a) labeling template nucleic acid sequences in fixed cells with unique molecular identifiers (UID's), wherein the labeling comprises adding at least one ?-UID to each template nucleic acid, thereby generating uniquely labeled template nucleic acids;
(b) amplifying the labeled template nucleic acids using in situ amplification the amplification reaction also further concatenating individual amplified labeled template nucleic acids together such that each concatenation event results in incorporation of at least one unique ?-UID, wherein the frequency of concatenation events between amplified labeled template nucleic acids is a function of a proximity of each individual labeled template nucleic acid to another labeled template nucleic acid; and
(c) generating a spatially resolved physical mapping of each cell of the fixed cells by isolation and sequencing of the uniquely labeled concatenation events from (b).
US Pat. No. 10,654,918

INFLAMMATORY DISEASE DIAGNOSIS AND METHODS OF TREATMENT USING DOWN-REGULATORS OF LIPOPOLYSACCHARIDE-RESPONSIVE BEIGE-LIKE ANCHOR

University of South Flori...

1. A method of treating a disease based on lipopolysaccharide-responsive beige-like anchor (LRBA) up-regulation, comprising:determining the cause of the disease based on LRBA up-regulation, wherein the cause is up-regulation of LRBA;
treating the disease based on LRBA up-regulation, wherein the treatment is:
down-regulating LRBA in the immune-based disease having LRBA up-regulation, further comprising:
administering a composition further comprising a dominant-negative LRBA composition, an anti-LRBA siRNA, an anti-LRBA shRNA, miRNA miR-150, miRNA miR-181, or a combination thereof;
wherein the dominant-negative LRBA composition is an LRBA-VHSLIR1 peptide of SEQ ID NO: 14 or an LRBA-VHS peptide of SEQ ID NO: 12;
wherein the disease based on LRBA up-regulation is asthma.
US Pat. No. 10,654,919

INHIBITION OF AUTISM SPECTRUM DISORDER USING DECOY ANTIGENS TO MATERNAL BRAIN-REACTIVE ANTIBODIES

The Feinstein Institutes ...

1. A method of inhibiting or reducing development of an autism spectrum disorder in a fetus or an infant comprising administering to a mother pregnant with the fetus or prior to the fetus being born as an infant while the mother is pregnant, an amount of an agent comprising a peptide comprising the sequence of an extracellular portion of a contactin-associated protein 2 (Caspr2) effective to inhibit or reduce development of an autism spectrum disorder in a fetus or an infant.
US Pat. No. 10,655,175

WINDOWED SEQUENCING

Life Technologies Corpora...

1. A system comprising:a sensor array including a plurality of sensors; and
an array controller, communicatively coupled to the sensor array, wherein the array controller includes a processor, the processor configured to:
determine an operational characteristic of each sensor of a plurality of sensors located at a portion of the sensor array before a chemical reaction occurs proximal to each sensor of the plurality of sensors located at the portion of the sensor array,
select a first group of sensors from the plurality of sensors located at the portion of the sensor array based on determining that each sensor in the first group of sensors has a similar operational characteristic,
enable readout of the sensors in the first group,
bypass readout of other sensors of the sensor array that are not included in the first group of sensors, wherein the other sensors have a different operational characteristic from the first group of sensors, and
receive output signals at the processor from the first group of sensors, the output signals indicating chemical reactions occurring proximate to the first group of sensors of the sensor array.
US Pat. No. 10,655,687

PAPER FRICTION MATERIAL AND METHOD OF MANUFACTURING THE SAME

Hyundai Motor Company, S...

1. A method of manufacturing a paper friction material for a vehicle, comprising:preparing a friction base including pulp;
preparing a coating solution comprising latex and a functional material, wherein the functional material includes at least one of graphite and molybdenum sulfide (MoS2), which are mixed;
coating the friction base with the coating solution using a spray, thus forming, on a surface of the friction base, a coating layer configured such that an OH reactive group of the pulp of the friction base and an aromatic ring of the latex of the coating solution are hydrogen-bonded; and
drying the friction base having the coating layer formed thereon, wherein the preparing the friction base comprises:
mixing from about: (a) 35 wt % to about 45 wt % of a matrix including pulp, from about 5 wt % to about 15 wt % of a reinforcement, wherein the reinforcement comprises an aramid fiber; (b) from about 15 wt % to about 25 wt % of a friction modifier, wherein the friction fiber comprises coke, and (c) a remainder of a filler to give a mixture, which is then subjected to dehydration pressing to form a sheet, thus manufacturing a friction base; and drying the friction base.
US Pat. No. 10,653,640

CANNABINOID-CONTAINING COMPLEX MIXTURES FOR THE TREATMENT OF NEURODEGENERATIVE DISEASES

GBS GLOBAL BIOPHARMA, INC...

1. A method of treating Parkinson's disease, the method comprising:administering to a patient with Parkinson's disease an effective amount of a pharmaceutical composition comprising:
as an active ingredient, a mixture comprising
the minor cannabinoids cannabichromene, cannabigerol, and cannabidivarin, and
the selected terpenes limonene, linalool, nerolidol, pinene, and phytol; and
a pharmaceutically acceptable carrier or diluent.
US Pat. No. 10,654,920

ANTI-LAMININ4 ANTIBODIES SPECIFIC FOR LG4-5

PROTHENA BIOSCIENCES LIMI...

1. A method for detecting the presence of a cancer in a biological sample, the method comprising:(a) contacting the biological sample with a monoclonal antibody that specifically binds to an epitope within the LG4-5 modules of the G domain of laminin ?4, wherein the antibody comprises three heavy chain CDRs and three light chain CDRs of
(i) an antibody characterized by a mature heavy chain variable region of SEQ ID NO:16 and mature light chain variable region of SEQ ID NO:17;
(ii) an antibody characterized by a mature heavy chain variable region of SEQ ID NO:26 and mature light chain variable region of SEQ ID NO:27;
(iii) an antibody characterized by a mature heavy chain variable region of SEQ ID NO:36 and mature light chain variable region of SEQ ID NO:38; or
(iv) an antibody characterized by a mature heavy chain variable region of SEQ ID NO:37 and mature light chain variable region of SEQ ID NO:38;
(b) detecting binding of the antibody to the biological sample;
(c) contacting a control sample with the antibody;
(d) detecting binding of the antibody to the control sample; and
(e) comparing binding of the antibody to the biological sample with binding of the antibody to the control sample, whereby increased binding of the antibody to the biological sample compared to the control sample indicates the presence of cancer in the biological sample.
US Pat. No. 10,655,176

METHODS AND APPARATUS THAT INCREASE SEQUENCING-BY-BINDING EFFICIENCY

OMNIOME, INC., San Diego...

24. A method of determining a series of signal states for a series of nucleotide cognate mixtures, comprising:(a) sequentially contacting a primed template nucleic acid with a series of mixtures, wherein each of the mixtures within said series of mixtures comprise a polymerase and nucleotide cognates for at least two different base types, and each of the mixtures within said series of mixtures differ by the presence or absence of at least one type of nucleotide cognate; and
(b) detecting the presence or absence of a stabilized ternary complex formed at the next template position for each of the mixtures within said series of mixtures, thereby determining a series of signal states for said series of mixtures, wherein the stabilized ternary complex is prevented from covalently incorporating nucleotides from the mixtures into the primed template nucleic.
US Pat. No. 10,653,641

USE OF CANNABINOIDS IN THE TREATMENT OF MENTAL DISORDERS

GW Pharma Limited, Cambr...

1. A method of treating treatment resistant schizophrenia in a subject by augmenting the effect of a typical or an atypical antipsychotic, the method comprising administering to the subject cannabidiol (CBD) in combination with a typical or an atypical antipsychotic, wherein the amount of CBD administered augments the effect of the typical or atypical antipsychotic.
US Pat. No. 10,654,921

ANTI-ANNEXIN A2 MONOCLONAL ANTIBODIES

AGENCY FOR SCIENCE, TECHN...

1. An antigen-binding protein, or an antigen-binding fragment thereof, comprising:(a)(i) a heavy chain variable domain comprising a VHCDR1 having the amino acid sequence GYSITSGYSWH (SEQ ID NO: 9); a VHCDR2 having the amino acid sequence YIHYSGSTKYNPSLKS (SEQ ID NO: 10) and a VHCDR3 having the amino acid sequence GSNYGFDY (SEQ ID NO: 11); and (ii) a light chain variable domain comprising a VLCDR1 having the amino acid sequence KSSQSLLYSNDQKNYLA (SEQ ID NO: 12), a VLCDR2 having the amino acid sequence WASIRES (SEQ ID NO: 13), and a VLCDR3 having the amino acid sequence QQYYIYPLT (SEQ ID NO: 14), or
(b) (i) a heavy chain variable domain comprising a VHCDR1 having the amino acid sequence VYSITSGYSWH (SEQ ID NO: 21); a VHCDR2 having the amino acid sequence YIHYSGSTKYNPSLKS (SEQ ID NO: 10), and a VHCDR3 having the amino acid sequence GTDNAVDY (SEQ ID NO: 22); and (ii) a light chain variable domain comprising a VLCDR1 having the amino acid sequence KSSQSLLYSSNQKNYLA (SEQ ID NO: 23), a VLCDR2 having the amino acid sequence WASSRES (SEQ ID NO: 24), and a VLCDR3 having the amino acid sequence QQYYIYPLT (SEQ ID NO: 14);
wherein the antigen-binding protein, or antigen-binding fragment thereof, binds to annexin A2 (ANXA2).
US Pat. No. 10,655,177

HYBRIDIZATION COMPOSITIONS AND METHODS

AGILENT TECHNOLOGIES, INC...

1. A hybridization composition comprising at least one nucleic acid sequence, at least one solvent in an amount effective to denature double-stranded nucleotide sequences, and a hybridization solution, wherein the solvent is chosen from tetrahydrothiophene 1-oxide, valerolactam, 1,3-dimethyl-3,4,5,6-tetrahydro-2(1H)-pyrimidinone, N,N-dimethyl-acetamide and isobutyramide.
US Pat. No. 10,653,130

COMPOSITIONS AND METHODS FOR IMPROVING SEED QUALITY

The Drexel Chemical Compa...

1. A seed crop treatment for enhancing one or more seed assemblage qualities compared to a control, consisting essentially of an effective amount of an acceptable salt of cyanate and a defoliant, wherein the defoliant comprises sodium chlorate, andwherein the effective amount of the acceptable salt of cyanate ranges from about 2.5 g to about 0.01 g per gallon of the treatment.
US Pat. No. 10,653,642

COMPOSITIONS AND METHODS FOR THE TREATMENT OF TAUOPATHIES

University of South Flori...

1. A method of treating a tauopathy in a subject, the method comprising administering to the subject a therapeutic amount of hexachlorophene, or a pharmaceutically acceptable salt thereof, wherein the level of phosphorylated tau protein is reduced at least 20%, the level of total tau protein is reduced at least 20%, the level of tau aggregation is reduced at least 20%, or a combination thereof.
US Pat. No. 10,653,898

NON-IRRITATING, NON-BLURRING OPHTHALMIC SUNSCREEN

A. EBBIE SOROUDI, M.D., M...

1. A method of protecting a subject's eyes from sunlight, comprising:applying an ophthalmic sunscreen solution directly onto the ocular surface of the subject's eyes, wherein the ophthalmic sunscreen solution consists of an active sunscreen component and an inactive liquid vehicle base
wherein the active sunscreen component consists of:
0.25 percent to 15 percent by weight of an inorganic active ingredient, selected from the group consisting of titanium dioxide, zinc oxide, iron oxide, zirconium oxide, cerium oxide and mixtures thereof; and
0.25 percent to 15 percent by weight of an organic active ingredient, selected from the group consisting of dioxybenzone, octisalate, homosalate, avobenzone, octocrylene, para-aminobenzoic acid, cinoxate, methyl anthranilate, 2-ethylhexyl 4-(dimethylamino)benzoate, ensulizole, sulisobenzone, trolamine salicylate and ecamsule; and
wherein the inactive liquid vehicle base is an ophthalmic artificial tear formulation.
US Pat. No. 10,654,922

ANGIOPOIETIN 2, VEGF DUAL ANTAGONISTS

AskGene Pharma Inc., Cam...

1. A chimeric molecule which comprises an Ang2 binding peptide and an antibody which binds to VEGF, comprising:a. a light chain comprising the amino acid sequence of SEQ ID NO: 3; and
b. a peptide-heavy chain fusion molecule comprising the amino acid sequence of SEQ ID NO:15 or SEQ ID NO:16.
US Pat. No. 10,655,178

METHODS FOR DIAGNOSING AUTISM SPECTRUM DISORDERS

Laboratory Corporation of...

1. A method for detecting a mutation associated with the presence or an increased risk of developing an autism spectrum disorder in a subject, the method comprising:obtaining a nucleic acid from a tissue or body fluid sample from a subject; and
conducting an assay to identify whether there is at least one of a TSC1 or a TSC2 variant sequence in the subject's nucleic acid;
(i) wherein for TSC1 the variant sequences comprise at least one of: c.346T>G, Leu116Val; c.935A>C, Tyr312Ser; c.1006C>T, Arg336Trp; c.1178C>T, Thr393Ile; c.1523A>C, Tyr508Ser; c.1559A>C, His520Pro; c.1580A>G, Gln527Arg; c.1608A>C, Leu536Phe; c.1610A>C, His537Pro; c.1683T>G, Ser561Arg; c.1781T>G, Val594Gly; c.1799A>C, Gln600Pro; c.1829T>G, Val610Gly; c.1843A>C, Thr615Pro; c.1844C>A, Thr615Lys; c.1917T>G, Gly639Gly; c.1943T>G, Val648Gly; c.1958T>G, Ile653Arg; c.1960C>A, Gln654Lys; c.1960C>G, Gln654Glu; c.1963C>A, Gln655Lys; c.1997+2T>G (splice site); c.2194C>T, His732Tyr; c.2865C>T, Thr955Thr; c.3042C>T, His1014His; c.3059C>T, Thr1020Ile; c.3102T>G, Gly1034Gly; or c.3105T>G, Gly1035Gly; and
(ii) wherein for TSC2 the variant sequences comprise at least one of: c.275A>T, Glu92Val; c.433G>A, Ala145Thr; c.649-5A>C, (intronic); c.736A>C, Thr246Pro; c.796A>C, Thr266Pro; c.848+15T>G, (intronic); c.1292C>T, Ala431Val; c.1875A>C, Ser625Ser; c.3126G>T, Pro1042Pro; c.3299T>G, Val1100Gly; c.3778A>C, Thr1260Pro; c.3827C>T, Ser1276Phe; c.3914C>T, Pro1305Leu; c.3986G>A, Arg1329His; c.4006-8C>T, (intronic); c.4051G>A, Glu1351Lys; c.4269G>A, Leu1423Leu; c.4285G>T, Ala1429Ser; c.4990-7C>T, (intronic); c.5028G>A, Leu1676Leu; c.5069-8C>T, (intronic); c.5359G>A, Gly1787Ser; or c.5429G>A, (3? UTR).
US Pat. No. 10,653,131

PIGMENTED DECONTAMINATING GEL AND METHOD FOR DECONTAMINATING SURFACES USING SAID GEL

1. A decontamination gel consisting of a colloidal solution comprising:0.1% to 30% by mass, based on the mass of the gel, of at least one inorganic viscosifying agent;
0.1 to 10 mol/L of gel, of at least one active decontamination agent;
0.01% to 0.1% by mass, based on the mass of the gel, of an iron oxide pigment;
optionally, 0.1% to 2% by mass based on the mass of the gel, of at least one surfactant;
optionally, 0.05% to 5% by mass, based on the mass of the gel, of at least one super-absorbent polymer;
and the balance of solvent.
US Pat. No. 10,653,643

LIVER PROTECTANT COMPOSITIONS AND THERAPEUTIC APPLICATIONS

SAMI LABS LIMITED, Banga...

1. A method for the therapeutic management of non-alcoholic fatty liver disease and associated conditions non-alcoholic fatty liver, non-alcoholic steatohepatitis and fibrosis in mammals, said method comprising steps of administering effective amounts of a composition comprising a combination of 95% Curcuminoids containing 75%-81% curcumin, 15-19% demethoxycurcumin and 2.2-6.5% bisdemethoxycurcumin and 20% Garcinol to mammals in need of such therapy, to bring about effect of reducing symptoms of non-alcoholic fatty liver disease and associated conditions non-alcoholic fatty liver, non-alcoholic steatohepatitis and fibrosis.
US Pat. No. 10,653,899

CORE STABILIZED MICROCAPSULES, METHOD OF THEIR PREPARATION AND USES THEREOF

SOL-GEL TECHNOLOGIES LTD....

11. A method for treating a skin disease, disorder or condition in a subject in need thereof, said method comprising topically administering to said subject a composition according to claim 9, wherein said at least one active agent is benzoyl peroxide or a retinoid, wherein said benzoyl peroxide or retinoid is in a solid form; and wherein said skin disease, disorder or condition is selected from the group consisting of acne, psoriasis, seborrhea, contact dermatitis, rosacea, and a combination thereof.
US Pat. No. 10,654,923

METHODS FOR TREATING MEDICAL CONDITIONS BY ANTI-TYPE 2 THERAPY

Mayo Foundation for Medic...

1. A method for treating a medical condition in a human, wherein said method comprises administering an anti-type 2 therapy to a human identified as having an Interleukin 4 to Interleukin 2 ratio in a whole blood cell based cytokine assay greater than 0.4, wherein the severity of said medical condition within said human is reduced.
US Pat. No. 10,655,179

CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR GENE MUTATIONS

Quest Diagnostics Investm...

1. A kit comprising:(i) a forward primer that comprises the sequence of SEQ ID NO: 89; and
(ii) a reverse primer that comprises the sequence of SEQ ID NO: 90,
wherein the forward primer or reverse primer is detectably labeled.
US Pat. No. 10,653,132

FORMULATIONS COMPRISING VOLATILE INSECTICIDES WITH IMPROVED LONG-TERM STABILITY AND ACTIVITY

Bayer CropScience Aktieng...

1. A composition, comprisingat least one insecticide which has a vapour pressure of at least 0.001 mPa at 20° C.,
at least one cyclodextrin,
at least one polymer dispersion,
at least one non-volatile solvent, and
water,
wherein the ratio of the amounts by weight of the at least one polymer dispersion to the at least one cyclodextrin being between 0.4:1 and 10:1, in each case based on the solids content, and the at least one non-volatile solvent is selected from the group consisting of aromatic hydrocarbons, aliphatic solvents, N-alkylpyrrolidones, dimethylamides of fatty acids, vegetable or animal fats, triglycerides, and chlorinated hydrocarbons.
US Pat. No. 10,653,644

INTRANASAL ADMINISTRATION OF KETAMINE TO TREAT DEPRESSION

Icahn School of Medicine ...

1. A method of treating suicidality as a symptom of major depressive disorder which comprises administering to a patient afflicted with suicidality as a symptom of major depressive disorder a first intra-nasal composition consisting of ketamine and one or more pharmaceutically acceptable excipients and, further administering a second composition containing a pharmaceutical antidepressant agent.
US Pat. No. 10,654,924

IL-17A BINDING PROTEINS

CRESCENDO BIOLOGICS LIMIT...

1. A binding molecule comprising a single domain antibody that is capable of binding human IL-17A, said single domain antibody comprising a human heavy chain variable immunoglobulin domain (VH) that comprises a CDR1 comprising an amino acid sequence selected from SEQ ID NOs: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 49, 57, 65, 69, 77, 93, 97, 101, 113, 117, 121, 125, 129, 141, 145, 149, 157, 165, 173, 177, 181, 193, 197, 205, 213, 217, 221, 225, 233, 237, 245, 442, 446, 450, 454, 458, and 462; a CDR2 comprising an amino acid sequence selected from SEQ ID NOs: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 50, 58, 66, 70, 78, 94, 98, 102, 114, 118, 122, 126, 130, 142, 146, 150, 158, 166, 174, 178, 182, 194, 198, 206, 214, 218, 222, 226, 234, 238, 246, 443, 447, 451, 455, 459, and 463; and a CDR3 comprising an amino acid sequence selected from 3, 7, 11, 15, 19, 23, 27, 31, 35, 39, 43, 51, 59, 67, 71, 79, 95, 99, 103, 115, 119, 123, 127, 131, 143, 147, 151, 159, 167, 175, 179, 183, 195, 199, 207, 215, 219, 223, 227, 235, 239, 247, 444, 448, 452, 456, 460, and 464.
US Pat. No. 10,655,180

METHODS FOR SIMULTANEOUS AMPLIFICATION OF TARGET LOCI

Natera, Inc., San Carlos...

1. A method for measuring an amount of DNA in a biological sample, comprising:(a) extracting cell-free DNA of mixed origin from a biological sample of a subject, wherein the cell-free DNA comprises DNA from the subject and DNA from a genetically distinct individual, wherein neither the subject nor the genetically distinct individual is a fetus, and wherein the DNA of mixed origin comprises DNA from a transplant;
(b) performing targeted PCR amplification of the cell-free DNA at more than 100 SNP loci in a single reaction volume using more than 100 PCR primer pairs, wherein the amplified SNP loci comprise SNP loci on at least chromosome 1, 2, or 3;
(c) determining the genotypes of the amplified SNP loci and measuring an amount of one or more alleles at the SNP loci, wherein the genotypes of the amplified SNP loci are determined by high-throughput sequencing; and
(d) measuring an amount of the DNA from the genetically distinct individual present in the biological sample using the amount of one or more alleles at the SNP loci,
wherein the method is performed without prior knowledge of genotypes of the genetically distinct individual.
US Pat. No. 10,653,133

ANTIMICROBIAL SOLID AND METHODS OF MAKING AND USING SAME

Next Science IP Holdings ...

1. An antimicrobial solid comprising a hydrophilic crosslinked polymer network that is an amorphous, spongy solid which comprises some pores having diameters of at least 10 ?m and some pores having diameters of less than about 0.85 ?m and one or more ionic surfactants entrained in said spongy solid network.
US Pat. No. 10,653,645

METHOD FOR ENHANCING FOLDING AND TRANSPORT OF MISFOLDED GLUCOCEREBROSIDASE

The Hospital for Sick Chi...

1. A method of enhancing transport of misfolded GCase to a lysosome in a patient in need thereof comprising administering to the patient ambroxol, ambroxol hydrochloride, or bromhexine, or a pharmaceutically acceptable salt thereof at a dose of 250-500 mg administered once, twice, three or four times a day, wherein said ambroxol, ambroxol hydrochloride or bromhexine or a pharmaceutically acceptable salt thereof enhances transport of the misfolded GCase to the lysosome, wherein the patient is also administered a recombinant glucocerebrosidase.
US Pat. No. 10,654,925

ANTI-MARINOBUFAGENIN ANTIBODIES AND USES THEREOF

CTS Biopharma LLC, Sunny...

1. An anti-marinobufagenin antibody or a marinobufagenin binding antibody fragment thereof selected from the group consisting ofan antibody H1L1 comprising a heavy chain variable region comprising SEQ ID NO: 9 and a light chain variable region comprising SEQ ID NO: 12;
an antibody H1L2 comprising a heavy chain variable region comprising SEQ ID NO: 9 and a light chain variable region comprising SEQ ID NO: 13;
an antibody H2L1 comprising a heavy chain variable region comprising SEQ ID NO: 10 and a light chain variable region comprising SEQ ID NO: 12;
an antibody H2L2 comprising a heavy chain variable region comprising SEQ ID NO: 10 and a light chain variable region comprising SEQ ID NO: 13;
an antibody H3L1 comprising a heavy chain variable region comprising SEQ ID NO: 11 and a light chain variable region comprising SEQ ID NO: 12; and
an antibody H3L2 comprising a heavy chain variable region comprising SEQ ID NO: 11 and a light chain variable region comprising SEQ ID NO: 13.
US Pat. No. 10,655,181

SYSTEM AND METHOD FOR CLEANING NOISY GENETIC DATA FROM TARGET INDIVIDUALS USING GENETIC DATA FROM GENETICALLY RELATED INDIVIDUALS

Natera, Inc., San Carlos...

1. A method for determining genetic data for DNA from cancer cells, the method comprising:isolating cell-free DNA from a biological sample and amplifying a plurality of target loci from the isolated cell-free DNA to obtain amplification products;
using high throughput DNA sequencing to detect genetic material from the amplification products and produce genetic data for the plurality of target loci on the chromosome or chromosome segment of interest;
creating a set of one or more hypotheses specifying genetic data for DNA from cancer cells; determining the probability of each of the hypotheses given the produced genetic data; and using the probabilities associated with each hypothesis to determine the most likely genetic data for DNA from cancer cells.
US Pat. No. 10,657,743

METHOD FOR LOCKING AND UNLOCKING A RECEPTACLE FOR A MOBILE TELECOMMUNICATIONS TERMINAL DEVICE

1. A method for locking and unlocking a receptacle for a mobile telecommunications terminal device, wherein the receptacle is disposed in a holding device, a token is assigned to the holding device, and wherein the token is secured against being removed within an insertion opening of the holding device and the token is released when the telecommunications terminal device is locked within the receptacle, the method comprising:wherein, when the token is inserted into the holding device for unlocking the receptacle, carrying out an authorization check for checking an assignment of the token inserted into the holding device and, if the assignment of the token to the holding device has been established successfully, unlocking the lock;
generating a signal when locking the telecommunications terminal device in the receptacle or upon successfully carrying out the authorization check; and
transmitting the signal to a blocking element that is disposed to block the movement of a first control element, the signal activating the blocking element to cause the blocking element to end the block of the movement of the control element.
US Pat. No. 10,653,646

EPINEPHRINE COMPOSITIONS AND CONTAINERS

Nevakar Inc., Bridgewate...

1. An antioxidant-free and storage stable ready-to-inject epinephrine composition, comprising:an aqueous pharmaceutically acceptable carrier containing epinephrine;
wherein the epinephrine is present in the ready-to-inject epinephrine composition at a concentration of equal or less than 0.07 mg/ml;
wherein substantially all of the epinephrine is an R-isomer;
wherein the ready-to-inject epinephrine composition has a pH of between 3.0-4.7;
wherein the ready-to-inject epinephrine composition further comprises a metal ion chelator present in the composition at a concentration of between about 1 and 50 ug/ml, wherein the metal ion chelator is selected from the group consisting of EDTA (edetic acid), EGTA, and diethylenetriaminepentaacetic acid; and
wherein the ready-to-inject epinephrine composition has, after storage of at least one month, total impurities of equal or less than 0.7% and equal or less than 2% S-isomer content.
US Pat. No. 10,654,926

P2X4 ANTIBODIES AND USES THEREOF

MedImmune Limited, Cambr...

1. An antibody or antigen binding fragment thereof that specifically binds a human P2X4 polypeptide and modulates channel activity, wherein the antibody or fragment thereof comprises a VH comprising:a. a heavy chain variable region CDR1 comprising the amino acid sequence: SFAMS (SEQ ID NO: 813);
b. a heavy chain variable region CDR2 comprising the amino acid sequence: AISGSGGSTYYADSVKG (SEQ ID NO: 814);
c. a heavy chain variable region CDR3 comprising the amino acid sequence: QFDYWSTYSGPTAFDL (SEQ ID NO: 815);
in combination with a VL comprising:
a. a light chain variable region CDR1 comprising the amino acid sequence SGDALPRQYAY (SEQ ID NO: 822)
b. a light chain variable region CDR2 comprising the amino acid sequence KDSERPS (SEQ ID NO: 823)
c. a light chain variable region CDR3 comprising the amino acid sequence QSADSSGTYVV (SEQ ID NO: 824).
US Pat. No. 10,655,182

METHODS FOR DIAGNOSING RISK OF RENAL ALLOGRAFT FIBROSIS AND REJECTION

Icahn School of Medicine ...

1. A method for identifying a renal allograft recipient at risk for developing fibrosis of the allograft the method comprising:(a) determining the expression levels of four miRNAs in a blood sample from the recipient,
wherein the miRNAs are hsa-mir-128, hsa-mir-29b-3p, hsa-mir-302b-3p, and hsa-mir-192-5p; and
(b) identifying the recipient as being at risk for developing fibrosis of the allograft when the expression levels of said miRNAs hsa-miR-128 and hsa-miR-302b-3p are increased relative to a control level for each miRNA, and the expression levels of hsa-miR-29b-3p and hsa-miR-192-5p miRNAs are decreased relative to the control level for each miRNA.
US Pat. No. 10,653,135

METHODS FOR TREATING SEEDS WITH AN AQUEOUS COMPOSITION AND SEEDS TREATED THEREWITH

Covestro LLC, Pittsburgh...

1. A method for treating a seed, comprising applying to the seed an aqueous seed treatment composition comprising:an aqueous polyester-polyurethane dispersion mixture; and
one or more insecticides, fungicides, nematicides and/or other pesticides, wherein
(1) the aqueous polyurethane dispersion mixture forms a film exhibiting:
(a) a microhardness of 4 to 34 N/mm2
(b) a Tg of -79° C. to -4° C.,
(c) a percent elongation of 44 to 300, and
(d) a tensile strength of 2500 lb./in2 to 5600 lb./in2, and
(2) the seed comprises one selected from the group consisting of corn seed, sorghum seed, oat seed, rye seed, barley seed, soybean seed, vegetable seed, wheat seed, sugarbeet seed, rice, sunflower seed, lettuce seed, and spinach seed,
wherein the aqueous polyester-polyurethane dispersion mixture comprises at least two aqueous polyurethane dispersions,
wherein the at least two polyurethanes are the reaction products of reactants comprising:
(i) a polyisocyanate;
(ii) a polyester polyol having a number average molecular weight of 400 to 8,000 g/mol;
(iii) a compound comprising at least one isocyanate-reactive group and an anionic group or potentially anionic group;
(iv) a mono functional polyalkylene ether;
(v) a polyol having a molecular weight of less than <400 g/mol; and
(vi) a polyamine or amino alcohol having a molecular weight of from 32 to 400 g/mol,wherein the at least two aqueous polyurethane dispersion comprises (A) an anionic aliphatic polyester-polyurethane that is a reaction product of components (i), (ii), (iii), (v), and (vi), and (B) an anionic aliphatic polyester-polyurethane, different from (A), that is a reaction product of components (i), (ii), (iii), (v), and (vi); and further comprises (C) an anionic/non-ionic polyester polyurethane that is different from (A) and (B) and is a_reaction product of components (i), (ii), (iii), (iv), and (vi), and wherein the weight ratio of (A), (B) and (C) in the composition is such that (A+B)/(C) is greater than 1.
US Pat. No. 10,653,647

METHODS AND COMPOSITIONS FOR ADMINISTRATION OF TRPV1 AGONISTS

GRT US Holding, Inc., Mo...

1. A pharmaceutical composition comprising a TRPV1 agonist in a concentration of 7% to 20% (w/v) and one or more penetration enhancers, and optionally one or more additional therapeutically active agents, wherein the composition delivers at least about 3 nmoles of agonist to skin as measured in a mouse skin absorption assay, and wherein the pharmaceutical composition is a liquid formulation having a viscosity less than about 5000 cps suitable for administration to a subject.
US Pat. No. 10,654,927

SIGNALLING SYSTEM

UCL BUSINESS LTD, London...

1. A chimeric antigen receptor (CAR) system comprising;(i) a receptor component comprising an extracellular antigen binding domain, a spacer, a transmembrane domain, and a first intracellular binding domain; and
(ii) an intracellular signalling component comprising a signalling domain and a second binding domain which specifically binds to the first intracellular binding domain of the receptor component;
wherein (i) and (ii) are separate molecules;
wherein the receptor component and signaling component are co-expressed;
wherein binding of the first and second binding domains of the CAR system is disruptable by the presence of an agent,
wherein, in the absence of the agent, the receptor component and the intracellular signalling component heterodimerize, and binding of the antigen binding domain to antigen results in signalling through the signalling domain, whereas in the presence of the agent, the receptor component and the signalling component do not heterodimerize, and binding of the antigen binding domain to antigen does not result in signalling through the signalling domain; and
wherein the first intracellular binding domain comprises Tet Repressor Protein (TetR) or a variant thereof and the second binding domain comprises Transcription inducing peptide (TiP) or a variant thereof; or wherein the first intracellular binding domain comprises TiP or a variant thereof and the second binding domain comprises TetR or a variant thereof; and the agent is tetracycline, doxycycline or minocycline or an analogue thereof.
US Pat. No. 10,655,183

CARCINOMA DIAGNOSIS AND TREATMENT BASED ON ODC1 GENOTYPE

ARIZONA BOARD OF REGENTS ...

1. A method for preventing recurrence of or treating colorectal carcinoma in a patient in need thereof, the method comprising administering to the patient effective amounts of a pharmaceutical therapy comprising:(i) a first agent that inhibits ornithine decarboxylase (ODC) within the patient, wherein the first agent is ?-difluoromethylornithine (DFMO); and
(ii) a second agent that modulates the polyamine pathway to reduce overall polyamine content within the patient when combined with the first agent, wherein the second agent is sulindac,wherein the patient's genotype at rs2302616 of both alleles of the ODC1 gene is T/T.
US Pat. No. 10,653,136

AQUEOUS COMPOSITIONS FOR TREATING SEEDS, SEEDS TREATED THEREWITH, AND METHODS FOR TREATING SEEDS

Covestro LLC, Pittsburgh...

1. An aqueous seed treatment composition comprising:an aqueous polyurethane dispersion mixture; and
one or more insecticides, fungicides, nematicides, and/or other pesticides,
wherein the aqueous polyurethane dispersion mixture forms a film exhibiting:
(a) a Tg of ?48° C. to ?4° C.,
(b) a percent elongation of 44 to 300,
(c) a tensile strength of 2500 lb./in2 to 4100 lb./in2, and
(d) optionally, a microhardness of up to 45.4 N/mm2,
wherein the seed is selected from the group consisting of corn seed, sorghum seed, oat seed, rye seed, barley seed, soybean seed, vegetable seed, wheat seed, sugarbeet seed, rice seed, sunflower seed, lettuce seed, and spinach seed,
wherein the aqueous polyurethane dispersion mixture comprises at least two aqueous polyurethane dispersions;
wherein the at least two polyurethanes are the reaction products of reactants comprising:
(i) a polyisocyanate;
(ii) a polyester polyol having a number average molecular weight of 400 to 8,000 g/mol;
(iii) a compound comprising at least one isocyanate-reactive group and an anionic group or potentially anionic group;
(iv) a mono functional polyalkylene ether;
(v) a polyol having a molecular weight of less than <400 g/mol; and
(vi) a polyamine or amino alcohol having a molecular weight of from 32 to 400 g/mol, and
wherein the at least two aqueous polyurethane dispersion comprises (A) an anionic aliphatic polyester-polyurethane that is a reaction product of components (i), (ii), (iii), (v), and (vi); and (B) an anionic aliphatic polyester-polyurethane, different from (A), that is a reaction product of components (i), (ii), (iii), (v), and (vi);
and further comprises (C) an anionic/non-ionic polyester polyurethane that is different from (A) and (B) and is a reaction product of components (i), (ii), (iii), (iv), and (vi), wherein the weight ratio of (A), (B) and (C) in the composition is such that (A+B)/(C) is greater than 1.
US Pat. No. 10,654,928

COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY

MEMORIAL SLOAN-KETTERING ...

1. An immunoresponsive cell comprising:a) a chimeric antigen receptor (CAR) that binds to a first antigen with a dissociation constant (Kd) of about 5×10?8 M or more, wherein binding of the CAR to the first antigen is capable of delivering an activation signal to the immunoresponsive cell, and
b) a chimeric co-stimulating receptor (CCR) that binds to a second antigen, wherein binding of the CCR to the second antigen is capable of delivering a costimulatory signal to the immunoresponsive cell but does not alone deliver an activation signal to the immunoresponsive cell,
wherein the immunoresponsive cell is capable of (i) exhibiting negligible cytolytic activity against cells that are single positive for the first antigen, and (ii) inducing cytolytic activity against cells that are positive for both the first antigen and second antigens.
US Pat. No. 10,655,184

METHODS AND COMPOSITIONS INVOLVING MIR-135B FOR DISTINGUISHING PANCREATIC CANCER FROM BENIGN PANCREATIC DISEASE

INTERPACE DIAGNOSTICS, LL...

1. A method of producing amplified, labeled miRNA molecules from a pancreatic sample from a subject, the method comprising:contacting the pancreatic sample from the subject with primers specific for a group of microRNAs consisting of up to 11 different labeled miRNAs that include at least miR-135b and at least 4 of the following miRNAs: miR148a, miR-130b, miR-196a, miR-24, miR-375, and miR-96,
wherein miR-217 is not one of the up to 11 different miRNAs; and
reacting the sample with the primers under conditions to amplify the labeled microRNA molecules using polymerase chain reaction to produce the amplified, labeled miRNA molecules.
US Pat. No. 10,653,137

ARTHROPOD PEST CONTROL COMPOSITION AND METHOD

1. A liquid composition that is applicable in liquid form to a surface to kill an arthropod, the liquid composition consisting of:a fatty alcohol consisting of geddyl alcohol;
a second fatty alcohol consisting of capric alcohol, undecyl alcohol, or both;
a surface active agent; and
a carrier;
wherein the composition interrupts production of adipokinetic hormones (AKH) in the arthropod.
US Pat. No. 10,654,929

ANTIBODIES TO PD-1 AND USES THEREOF

Jounce Therapeutics, Inc....

1. An isolated monoclonal antibody that binds to human Programmed Death 1 (PD-1), wherein the antibody comprises (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 21; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 22; (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 23; (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 25; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 26; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 27.
US Pat. No. 10,655,185

METHODS FOR DIAGNOSIS AND PROGNOSIS OF EPITHELIAL TUMORS

H. Lee Moffitt Cancer Cen...

1. A method for providing a prognosis of a subject with prostate cancer and treating a subject with a poor prognosis, comprising assaying a biopsy sample comprising basal cells and optimally comprising luminal cells from the subject for the level of FGD1-related F-actin binding protein (Frabin/FGD4) protein, FGD4 gene expression, or a combination thereof, and comparing the level to control values, wherein an elevated level of Frabin or FGD4 in the luminal cells and a concomitant absence of Frabin or FGD4 in basal cells is an indication of a poor prognosis; and further treating said subject with an elevated level of Frabin or FGD4 by administering to the subject a chemotherapeutic.
US Pat. No. 10,653,138

COMPOSITION FOR ATTRACTING BED BUGS

Rothamsted Research Limit...

1. An attractant composition for bed bugs of the genus Cimex consisting of(a) (E)-2-octenal,
(b) nonanal, and,
(c) optionally, a carrier and/or a preservative,
wherein the amount of (E)-2-octenal is greater than 0.384 times a concentration of nonanal.
US Pat. No. 10,654,930

COMPOSITION AND METHOD FOR TREATING AMYOTROPHIC LATERAL SCLEROSIS

1. A method for increasing or enhancing phagocytic activity of microglia in a subject in need thereof, comprising administering to said subject a therapeutically effective amount of an immunoglobulin Fc fragment comprising the amino acid sequence as set forth in any one of SEQ ID NO: 1 and SEQ ID NO: 2, wherein said Fc fragment comprises the amino acid sequence as set forth in SEQ ID NO: 9, thereby increasing or enhancing phagocytic activity of microglia in said subject.
US Pat. No. 10,654,931

ANTIBODY

OSAKA UNIVERSITY, Suita-...

1. A chimeric antigen receptor, comprising an anti-integrin ?7 scFv comprising:a heavy chain variable region including:
heavy-chain CDR1 having the amino acid sequence set forth in SEQ ID NO: 1,
heavy-chain CDR2 having the amino acid sequence set forth in SEQ ID NO: 2, and
heavy-chain CDR3 having the amino acid sequence set forth in SEQ ID NO: 3; and
a light chain variable region including:
light-chain CDR1 having the amino acid sequence set forth in SEQ ID NO: 6,
light-chain CDR2 having the amino acid sequence set forth in SEQ ID NO: 7, and
light-chain CDR3 having the amino acid sequence set forth in SEQ ID NO: 8.
US Pat. No. 10,655,187

GENETIC MARKER FOR EARLY BREAST CANCER PROGNOSIS PREDICTION AND DIAGNOSIS, AND USE THEREOF

GENCURIX INC., Seoul (KR...

1. A method for treating a breast cancer in a breast cancer patient, the method comprising the steps of:collecting a sample from the breast cancer patient;
isolating mRNA from the sample from the breast cancer patient;
measuring a first mRNA expression level for the mRNA of an i-gene BTN3A2 (butyrophilin, subfamily 3, member A2) and a second mRNA expression level for the mRNA of RRM2 (Ribonucleotide Reductase M2);
normalizing the first and second mRNA expression levels to determine a normalized value;
detecting in the breast cancer patient sample a decrease in normalized value of BTN3A2 compared to a reference breast tumor or an increased normalized value of RRM2 compared to a reference breast tumor;
diagnosing the breast cancer patient who has a decrease in normalized value of BTN3A2 compared to a reference breast tumor sample or has an increased normalized value of RRM2 compared to a reference breast tumor sample as requiring treatment; and
treating the diagnosed breast cancer patient by administering at least one of an anti-cancer agent, a surgery, and a radiation therapy,
wherein the method comprises a step of using a plurality of primer pairs, wherein the plurality of the primer pairs comprises a primer pair for the i-gene BTN3A2 (butyrophilin, subfamily 3, member A2), and a primer pair for the p-gene RRM2, wherein the primer pairs are selected to amplify the i-gene and the p-gene through PCR amplification.
US Pat. No. 10,653,140

INDUCTION OF A PHYSIOLOGICAL DISPERSION RESPONSE IN BACTERIAL CELLS IN A BIOFILM

The Research Foundation f...

1. A dentifrice composition comprising:cis-2-decenoic acid, wherein the concentration of cis-2-decenoic acid in the composition is 0.001 ?M to 30 ?M, said dentifrice composition being selected from the group consisting of breath spray, tooth powder, whitening strips, prophylaxis strips, breath strips, lozenges, and breath mints.
US Pat. No. 10,653,652

USE OF (1S,3S)-3-AMINO-4-(DIFLUOROMETHYLIDENE) CYCLOPENTANE-1-CARBOXYLIC ACID AND (S)-3-AMINO-4-(DIFLUOROMETHYLENYL)CYCLOPENT-1-ENE-1-CARBOXYLIC ACID IN THE TREATMENT OF TINNITUS, ACUTE SENSORINEURAL HEARING LOSS, MENIERE'S DISEASE, TOURETTE'S SYNDROME, A

Ovid Therapeutics Inc., ...

1. A method of treating tinnitus which is not secondary to Tourette syndrome, epilepsy and addiction comprising administering to a subject with tinnitus (S)-3-amino-4-(difluoromethylenyl)cyclopent-1-ene-1-carboxylic acid or a pharmaceutically acceptable salt thereof in an amount of from 0.01 mg to 75 mg.
US Pat. No. 10,654,932

ANTI-FACTOR D ANTIBODY VARIANT CONJUGATES AND USES THEREOF

Genentech, Inc., South S...

1. A conjugate comprising one or more anti-Factor D antibody covalently linked to one or more polyols, wherein at least one anti-Factor D antibody in the conjugate is an anti-Factor D antibody having a light chain having the amino acid sequence of SEQ ID NO: 28 and a heavy chain having the amino acid-sequence of SEQ ID NO: 32; and the polyol is a multi-armed polyol.
US Pat. No. 10,655,188

METHOD FOR DETERMINING THE IDENTITY AND ANTIMICROBIAL SUSCEPTIBILITY OF A MICROORGANISM

Q-Linea AB, Uppsala (CH)...

1. A method for detecting and characterizing a microorganism in a clinical sample, said method comprising:a) introducing a clinical sample taken from a patient to a first culture vessel containing culture medium;
b (i)) optionally preculturing said clinical sample in said first culture vessel;
b (ii)) optionally removing a portion of the clinical sample/medium mixture or, if precultured, the clinical sample culture from said first culture vessel, and introducing said portion to a second culture vessel containing culture medium, and optionally preculturing said portion in said second culture vessel;
c) removing a test aliquot from said first and/or second culture vessel;
d) after step c), culturing or continuing to culture said clinical sample and/or portion thereof in said first and/or second culture vessel;
e) separating DNA from said test aliquot;
f) performing nucleic acid tests on said DNA to identify the microorganism and to detect the presence or absence of one or more genetic antimicrobial resistance markers in said microorganism, wherein said nucleic acid tests are performed using:
i) one or more nucleic acid probes and/or primers for microbial identification, a said probe or primer being capable of hybridizing specifically to, or a said primer being capable of selectively amplifying, a nucleotide sequence which is identificatory of a given microorganism; and
ii) one or more nucleic acid probes and/or primers for antimicrobial resistance marker detection, a said probe or primer being capable of hybridizing specifically to, or a said primer being capable of selectively amplifying, a nucleotide sequence representing a genetic antimicrobial resistance marker;and detecting whether or not said probes and/or primers have hybridized to said DNA and/or said primers have been extended; andg) performing an antimicrobial susceptibility test using said cultured clinical sample and/or said cultured portion from step (d), without any further sub-culture, wherein microbial growth in said antimicrobial susceptibility test is monitored by assessing growth or markers for growth, wherein the assessment of growth or markers of growth includes obtaining an image of said cultured clinical sample and/or portion, and determining an area of microbial biomass in the image, and wherein the type and concentration of antimicrobial agents used in said antimicrobial susceptibility test is determined by the identity of the microorganism and antimicrobial resistance markers detected in step (f), and optionally continuing to culture said clinical sample and/or portion in said first and/or second culture vessel.
US Pat. No. 10,653,141

COMPOSITIONS AND METHODS FOR ATTRACTING MOSQUITOES AND REPELLING SAND FLIES


US Pat. No. 10,653,653

SALTS OF 5-AMINOLEVULINIC ACID AND DERIVATIVES

1. A salt having formula (I):H2NCH2COCH2CH2COOR.Cl3C—COOH  (I)
wherein R is selected from the group consisting of hydrogen, methyl, ethyl, propyl, butyl, pentyl, hexyl, sec-propyl, sec-butyl, tert-butyl, sec-pentyl, sec-hexyl, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, benzyl, 2-methylbenzyl, 4-methylbenzyl, 4-chloro-benzyl, 2-nitro-benzyl, 4-nitro-benzyl, 2-isopropylbenzyl, 4-isopropylbenzyl, and 4-fluoro-benzyl.
US Pat. No. 10,654,933

METHOD FOR PURIFYING ANTIBODY HAVING LOW ISOELECTRIC POINT

Chugai Seiyaku Kabushiki ...

1. A method for purifying a composition containing an antibody with a pI of 3.0 to 8.0, which comprises the steps of:(a) treating the composition containing the antibody with a pI of 3.0 to 8.0 with an acidic condition;
(b) neutralizing the acidic composition obtained in step (a);
(c) holding the neutralized composition obtained in step (b) at least one hour; and
(d) removing aggregates from the neutralized composition after step (c), wherein step (a) is a virus-inactivating treatment step performed after Protein A column chromatography purification of the antibody with a pI of 3.0 to 8.0.
US Pat. No. 10,655,189

DETECTION OF DRUG RESISTANT MYCOBAC TUBERCULOSIS

RUTGERS, THE STATE UNIVER...

1. A method of detecting Rifampicin resistant M. tuberculosis in a sample comprising:a. amplifying a nucleic acid containing the rifampicin resistance determining region (RRDR) of the rpoB gene in a sample to provide an amplified nucleic acid;
b. probing the amplified nucleic acid with at least three molecular beacon probes for an RRDR mutant target;
c. conducting melting temperature (Tm) analysis to determine a Tm value for each probe; and
d. comparing the Tm value for each probe with a Tm value for a wild-type RRDR region, wherein a Tm value for at least one of the probes having a Tm difference (dTm) of at least 2.1° C. compared to the wild-type RRDR region indicates the presence of rifampicin resistant M. tuberculosis in the sample.
US Pat. No. 10,653,910

FIRE FIGHTING FOAMING COMPOSITIONS

Angus Holdings Safety Gro...

1. A fire fighting foaming composition comprising a first surfactant selected from alkyl group-containing amphoteric surfactants wherein the amphoteric surfactants are selected from betaines, sulphobetaines and hydroxysultaines and wherein the alkyl group contains at least 8 carbon atoms, and alkyl group-containing zwitterionic surfactants, wherein the alkyl group contains at least 8 carbon atoms, and mixtures thereof, and a second surfactant selected from alkyl sulphates, alkyl phosphates, dialkylsulphosuccinates, alkyl carboxylates and mixtures thereof, wherein the alkyl group contains at least 8 carbon atoms, and wherein the weight ratio of the first surfactant to the second surfactant is in the range of from 3:1 to 1:1.5, and wherein the said fire fighting foaming composition is essentially free of fluorine, and does not contain any polysaccharides, wherein said fire fighting foaming composition further comprises a water-miscible solvent that is 2-(2-butoxyethoxy) ethanol.
US Pat. No. 10,654,934

USE OF CHIMERIC ANTIGEN RECEPTOR MODIFIED CELLS TO TREAT CANCER

Innovative Cellular Thera...

1. A chimeric antigen receptor (CAR), wherein the CAR comprises an extracellular domain, a transmembrane domain, and an intracellular domain, and wherein the extracellular domain comprises amino acid sequence SEQ ID NO: 5.
US Pat. No. 10,655,190

COMPOSITIONS AND METHODS FOR DETECTION OF ZIKA VIRUS

Roche Molecular Systems, ...

1. A method of detecting Zika virus in a sample, the method comprising:performing an amplifying step comprising contacting the sample with a set of primers to produce an amplification product if a nucleic acid sequence of Zika virus is present in the sample;
performing a hybridizing step comprising contacting the amplification product with a probe; and
performing a detecting step comprising detecting the presence or absence of the amplification product, wherein the presence of the amplification product is indicative of the presence of Zika virus in the sample and wherein the absence of the amplification product is indicative of the absence of Zika virus in the sample;
wherein the set of primers consists of a first primer consisting of an oligonucleotide sequence of SEQ ID NO:1, and a second primer consisting of an oligonucleotide sequence of SEQ ID NO:5; and
wherein the probe consists of an oligonucleotide sequence of SEQ ID NO:9.
US Pat. No. 10,653,655

COMPOSITION FOR PREVENTING OR IMPROVING PERIPHERAL NEUROPATHY

AJINOMOTO CO., INC., Tok...

1. A method for the improvement of peripheral neuropathy, comprising administering to a subject in need thereof an effective amount of a composition comprising at least one amino acid comprising serine, and at least one lipid comprising eicosapentaenoic acid.
US Pat. No. 10,653,911

SYSTEM FOR LIQUID NARCOTIC MEDICATION VALIDATION AND DEACTIVATION

1. A system for validating and deactivating liquid medications to be wasted, comprising:a liquid medication validation and deactivation container having a first end and a second end;
a rupturable membrane attached to an inside of the liquid medication validation and deactivation container;
a liquid medication deactivation compartment located within the liquid medication validation and deactivation container such that the liquid medication deactivation compartment is located between the first end of the liquid validation and deactivation container and a first side of the membrane;
a liquid medication validation compartment located within the liquid medication validation and deactivation container such that the liquid medication validation compartment is located between the second end of the liquid validation and deactivation container and a second side of the membrane;
at least one liquid medication indicator located within the liquid medication validation compartment, wherein the at least one liquid medication indicator is used to determine a chemical compound of a liquid medication that is introduced into the liquid medication validation compartment; and
a one-way valve operatively connected to the second end of the liquid medication validation and deactivation container.
US Pat. No. 10,654,935

METHODS OF TREATING SLE WITH ANTI-OX40L ANTIBODIES

Kymab Limited, (GB)

1. A method of treating systemic lupus erythematosus (SLE) in a human subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-OX40L antibody or antibody fragment that antagonizes specific binding of OX40 to OX40L, wherein the antibody or antibody fragment comprises:(a) a HCDR1 amino acid sequence of SEQ ID NO: 36 or 42;
(b) a HCDR2 amino acid sequence of SEQ ID NO: 38 or 44;
(c) a HCDR3 amino acid sequence of SEQ ID NO: 40 or 46;
(d) a LCDR1 amino acid sequence of SEQ ID NO: 50 or 56;
(e) a LCDR2 amino acid sequence of SEQ ID NO: 52 or 58; and
(f) a LCDR3 amino acid sequence of SEQ ID NO: 54 or 60.
US Pat. No. 10,653,656

TOPICAL PHARMACEUTICAL COMPOSITIONS FOR TREATING SKIN CONDITIONS

Bausch Health Ireland Lim...

1. A topical pharmaceutical composition for treating a skin condition or disorder, comprising:an active agent in an amount from 0.01% to 1% by weight of the composition, wherein the active agent consists of tretinoin;
a polymeric emulsifier, wherein the polymeric emulsifier comprises a cross-linked copolymer of acrylic acid and C10-C30 alkyl acrylate, and wherein the polymeric emulsifier is present in an amount from 0.02% to 0.08% by weight of the composition;
a viscosity increasing agent, wherein the viscosity increasing agent comprises a cross-linked homopolymer of an acrylic acid, and wherein the viscosity increasing agent is present in an amount from 0.1% to 2% by weight of the composition;
a moisturizing agent, wherein the moisturizing agent comprises soluble collagen and sodium hyaluronate, and wherein the moisturizing agent is present in an amount from 5% to 10% by weight of the composition;
an oil component comprising one or more oils, wherein the oil component is present in an amount from 1% to 3.5% by weight of the composition, and wherein each oil in the oil component is independently selected from the group consisting of mineral oil, light mineral oil, petrolatum, fatty alcohols, monocarboxylic acid esters, dicarboxylic acid esters, medium-chain triglycerides, and long-chain triglycerides; and
water;
wherein the composition is formulated as a lotion.
US Pat. No. 10,654,936

ANTIBODIES AGAINST OX40 AND USES THEREOF

Bristol-Myers Squibb Comp...

1. A nucleic acid encoding a heavy and/or light chain variable region of an antibody which binds to OX40, wherein the antibody comprises the heavy chain variable region sequence of SEQ ID NO: 318 and the light chain variable region sequence ofSEQ ID NO: 94.
US Pat. No. 10,654,937

CD40 SPECIFIC ANTIBODIES AND USES THEREOF

BEIJING MABWORKS BIOTECH ...

1. An isolated monoclonal antibody, or an antigen-binding portion thereof, binding to tumor necrosis factor receptor CD40, comprising a heavy chain variable region comprising a VH-CDR1 region, a VH-CDR2 region and a VH-CDR3 region, and a light chain variable region comprising a VL-CDR1 region, a VL-CDR2 region and a VL-CDR3 region, wherein the VH-CDR1 region, VH-CDR2 region, VH-CDR3 region and the VL-CDR1 region, VL-CDR2 region and VL-CDR3 region comprise amino acid sequences of SEQ ID NOs: 7, 14, 20, 26, 30 and 36, respectively.
US Pat. No. 10,653,658

BIOFILM INHIBITING COMPOSITIONS ENHANCING WEIGHT GAIN IN LIVESTOCK

Akeso Biomedical, Inc., ...

1. A method of enhancing the growth of a mammal, the method comprising causing the mammal to ingest or absorb an effective amount of a milk replacer composition comprising one or more Fe III complex compounds of Formula I:Fe(III)x(ligand)y   Formula Iwhereinx is an integer value of 1-2,
y is an integer value of 1-3, and
each ligand present is independently a conjugate base of an ?-hydroxy acid selected from the group consisting of citric acid, tartaric acid, lactic acid, glycolic acid, quinic acid, isoleucic acid, valic acid, malic acid, and mandelic acid; or each ligand is a conjugate base of an amino acid independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine;
and salts and/or hydrates thereof.
US Pat. No. 10,654,938

CD40 BINDING ANTIBODIES AND USES THEREOF

BEIJING MABWORKS BIOTECH ...

1. An isolated monoclonal antibody, or an antigen-binding portion thereof, binding to tumor necrosis factor receptor CD40, comprising a heavy chain variable region comprising a VH-CDR1 region, a VH-CDR2 region and a VH -CDR3 region, and a light chain variable region comprising a VL-CDR1 region, a VL-CDR2 region and a VL-CDR3 region, wherein the VH-CDR1 region, VH-CDR2 region, VH-CDR3 region and the VL-CDR1 region, VL-CDR2 region and VL-CDR3 region comprise amino acid sequences of SEQ ID NOs: 6, 13, 19, 25, 27 and 35, respectively.
US Pat. No. 10,655,194

HIGH-STRENGTH STEEL SHEET AND METHOD FOR PRODUCING THE SAME

JFE STEEL CORPORATION, T...

1. A high-strength steel sheet having a chemical composition comprising, by mass %:C: 0.02% or more and less than 0.10%,
Si: less than 0.10%,
Mn: less than 1.0%,
P: 0.10% or less,
S: 0.020% or less,
Al: 0.01% or more and 0.10% or less,
N: 0.010% or less,
Nb: 0.005% or more and less than 0.070%, and
the balance being Fe and inevitable impurities,
wherein the steel sheet has a microstructure including, by area fraction, ferrite: 85% or more, pearlite: 0% to 15%, and a total of martensite, retained austenite and cementite: 0% to 3%,
an average crystal grain diameter of the ferrite is 15.0 ?m or less,
an average grain diameter of a Nb carbide is in a range of 5 to 36 nm, and
the amount of Nb carbide precipitate is 0.005% to 0.050% in terms of volume fraction.
US Pat. No. 10,653,147

AGROCHEMICAL COMPOSITION AND DISPERSAL METHOD THEREFOR

KUMIAI CHEMICAL INDUSTRY ...

1. An agrochemical composition comprising:a composition (i) comprising:(A) pyribencarb, and
(B) a surfactant consisting of (B1) a lignin sulfonic acid salt having purity of 85% by mass or more, wherein a content of reducing sugars is less than 5% by mass and a content of sugar sulfonic acids is less than 6% by mass, and (B2) a monoalkylaryl sulfonic acid salt formalin condensate and/or a polycarboxylic acid salt having mass average molecular weight of 5,000 to 50,000, anda composition (ii) comprising etofenprox.
US Pat. No. 10,653,659

COMPOSITIONS COMPRISING A COMPOUND FROM THE FAMILY OF AVERMECTINS AND AN AGONIST COMPOUND FOR AT LEAST ONE OF THE RETINOIC ACID RECEPTORS FOR TREATING ACNE

GALDERMA S.A., Cham (CH)...

1. A topical composition, consisting of:(a) 0.1% to 2% by weight, relative to the total weight of the composition, of ivermectin;
(b) 0.001% to 1% by weight, relative to the total weight of the composition, of trifarotene; and
(c) one or more pharmaceutically acceptable excipients.
US Pat. No. 10,654,939

ANTIBODIES SPECIFIC TO CD40 AND USES THEREOF

BEIJING MABWORKS BIOTECH ...

1. An isolated monoclonal antibody, or an antigen-binding portion thereof, binding to tumor necrosis factor receptor CD40, comprising a heavy chain variable region comprising a VH-CDR1 region, a VH-CDR2 region and a VH-CDR3 region, and a light chain variable region comprising a VL-CDR1 region, a VL-CDR2 region and a VL-CDR3 region, wherein the VH-CDR1 region, VH-CDR2 region, VH-CDR3 region and the VL-CDR1 region, VL-CDR2 region and VL-CDR3 region comprise amino acid sequences of SEQ ID NOs: 5, 12, 18, 24, 27 and 34, respectively.
US Pat. No. 10,653,660

METHODS OF IMPROVING THE PHARMACOKINETICS OF DOXEPIN

Currax Pharmaceuticals LL...

1. A method of treating insomnia in a patient in need thereof, the method comprising:administering between about 0.5 mg and about 7 mg doxepin to the patient, wherein the doxepin is administered at least 3 hours after consuming a meal to provide faster onset of action and minimize potential for next day sedation effects.
US Pat. No. 10,654,940

METHOD FOR TREATING JOINT DAMAGE

Genentech, Inc., South S...

1. A method for the treatment of joint damage caused by rheumatoid arthritis in a subject, wherein (a) the subject has exhibited an inadequate response to one or more antitumor necrosis factor (TNF) inhibitors; (b) the subject received a prior course of treatment with two 1000 mg intravenous (IV) doses of rituximab given 14 days apart and responded to the prior course of treatment and (c) the treatment comprises administering a further course of treatment with two 1000 mg IV doses of rituximab given 14 days apart and administered at weeks 24 to 40, wherein the subject to whom the further course of treatment is administered has active disease, wherein the method slows or halts progression of structural joint damage for at least about 52 weeks in the subject.
US Pat. No. 10,653,661

TREATMENT OF ALLERGIC RHINITIS USING A COMBINATION OF MOMETASONE AND OLOPATADINE

GLENMARK SPECIALTY S.A., ...

1. A method of treating one or more symptoms associated with perennial allergic rhinitis in a human subject in need thereof comprising nasally administering, twice daily, to the human subject about 1330 mcg per nostril of olopatadine hydrochloride and about 50 mcg per nostril of mometasone furoate, wherein (i) the mometasone furoate and olopatadine hydrochloride are administered in a fixed-dose pharmaceutical composition, and (ii) the twice daily administration of the pharmaceutical composition provides a faster onset of action than twice daily administration of 1330 mcg per nostril of olopatadine hydrochloride alone.
US Pat. No. 10,654,941

ANTIBODIES AGAINST FACTOR XI AND USES THEREOF

Bayer Pharma Aktiengesell...


US Pat. No. 10,653,662

METHODS OF USING LOW-DOSE DOXEPIN FOR THE IMPROVEMENT OF SLEEP

Currax Pharmaceuticals LL...

1. A method for treating insomnia, the method comprising:administering an oral formulation comprising doxepin or a pharmaceutically acceptable salt thereof to a patient having a sleep disorder in which, for a given 8 hour period of desired sleep, the patient has difficulty staying asleep during the final 60 minutes of said period, wherein the oral formulation comprises a dosage of doxepin between about 1 and about 7 mg and is administered prior to bedtime.
US Pat. No. 10,653,151

COMPOSITION AND METHOD FOR REDUCING FUNGAL INFECTIONS IN CROPS

Phibro Animal Health Corp...

1. A process, comprising applying to a seed, or to soil in which a plant is grown, a composition comprising a protein source selected from soybean flour or cotton seed meal and from 5×107 cfu to 5×109 cfu of a Bacillus amyloliquefaciens strain per gram of the protein source.
US Pat. No. 10,654,943

TRI-SPECIFIC ANTIBODIES FOR HIV THERAPY

The Rockefeller Universit...

1. A tri-specific antibody, comprising first, second and third antigen-binding sites which are capable of binding with specificity to first, second and third distinct epitopes that are comprised by a Human Immunodeficiency Virus (HIV), wherein the first, second and third antigen-binding sites comprise antigen binding sites of PGT128/3BNC117-PGDM1400 antibodies, and wherein the antigen binding site of the PGDM1400 antibody is at the C-terminus of the tri-specific antibody, and wherein the antigen binding site of the PGDM1400 antibody is optionally linked to the C-terminus of the heavy chain of the tri-specific antibody by a GS linker.
US Pat. No. 10,655,199

STEEL SHEET FOR CROWN CAP, METHOD FOR MANUFACTURING STEEL SHEET FOR CROWN CAP, AND CROWN CAP

JFE STEEL CORPORATION, T...

1. A steel sheet for a crown cap, the steel sheet having a composition comprising:C: 0.0010% to less than 0.0050%, by mass %;
Si: 0.10% or less, by mass %;
Mn: 0.05% to less than 0.50%, by mass %;
P: 0.050% or less, by mass %;
S: 0.050% or less, by mass %;
Al: 0.020% to less than 0.070%, by mass %;
N: less than 0.0040%, by mass %;
B: 0.0005% to 0.0020%, by mass %; and
Fe and inevitable impurities,
wherein:
the steel sheet has a yield strength of 500 MPa or more in a rolling direction,
the steel sheet has an average Lankford value (r) of 1.1 or more as given by the following equation (1), and
the steel sheet has an in-plane anisotropy (?r) of Lankford value of ?0.3 to 0.3 as given by the following equation (3):
r=101.44/(145.0×E×10?6?38.83)2?0.564  (1)
where E=(E0+2E45+E90)/4  (2)
where E0, E45, and E90 are the Young's modulus (MPa) in a 0° direction, the Young's modulus (MPa) in a 45° direction, and the Young's modulus (MPa) in a 90° direction, with respect to the rolling direction, respectively,
?r=0.031?4.685×10?5×?E  (3)
where ?E=(E0?2E45+E90)/2  (4).
US Pat. No. 10,653,664

ANTIBACTERIAL COMPOSITIONS OF MONO-ALKYL ETHERS OF MONOANHYDRO-HEXITOLS AND ANTIBACTERIAL METHODS USING OF THE SAME

1. A method for disinfecting a surface and/or equipment contaminated by bacteria, said method comprising applying to said surface or equipment to be disinfected, a composition of monoanhydro-hexitol monoalkyl ether isomers bearing an alkyl ether radical (OR) in position C-3, C-5 or C-6 of the monoanhydro-hexitol, in which the alkyl group (R) is a linear or branched hydrocarbon-based group comprising from 10 to 18 carbon atoms.
US Pat. No. 10,654,944

CELL ENGAGING BINDING MOLECULES

Y-BIOLOGICS INC., (KR)

1. A binding molecule, comprising:(a) a first polypeptide and a second polypeptide, each comprising an antibody light chain,
(b) a third polypeptide comprising, in the order from N-terminus to C-terminus, a first variable heavy (VH) region and a first constant heavy 1 (CH1) region, and a second VH region; and
(c) a fourth polypeptide comprising, in the order from N-terminus to C-terminus, a third VH region and a second CH1 region, and a variable light (VL) region,
wherein the first polypeptide and the first VH region and the first CH1 region of the third polypeptide form a first antigen binding Fab region;
wherein the second polypeptide and the third VH region and the second CH1 region of the fourth polypeptide form a second antigen binding Fab region;
wherein the second VH region of the third polypeptide and the VL region of the fourth polypeptide form an antigen binding Fv region;
wherein the first Fab region and the second Fab region bind to epidermal growth factor receptor (EGFR), and the Fv region binds to Cluster of Differentiation 3 (CD3);
wherein the antibody light chains of the first and the second polypeptide each comprise three Complementarity Determining Regions (CDRs) having amino acid sequences of SEQ ID NO.: 45, SEQ ID NO.: 46, and SEQ ID NO.: 47;
wherein in the third polypeptide, the first VH region comprises three CDRs having amino acid sequences of SEQ ID NO.: 41, SEQ ID NO.: 42, and SEQ ID NO.: 43, and the second VH region comprises three CDRs having amino acid sequences of SEQ ID NO.: 13, SEQ ID NO.: 14, and SEQ ID NO.: 15; and
wherein in the fourth polypeptide, the third VH region comprises three CDRs having amino acid sequences of SEQ ID NO.: 41, SEQ ID NO.: 42, and SEQ ID NO.: 43, and the VL region comprises three CDRs having amino acid sequences of SEQ ID NO.: 17, SEQ ID NO.: 18, and SEQ ID NO.: 19.
US Pat. No. 10,653,665

METHOD OF TREATMENT

Vanda Pharmaceuticals Inc...

1. A method of treating a sleep disturbance in an individual suffering from Smith-Magenis Syndrome (SMS), the method comprising:inhibiting melatonin production in the individual during waking hours by reducing exposure of the individual's eyes to light, administering to the individual an effective amount of a beta blocker, or both; and
administering to the individual an effective amount of tasimelteon once daily before bedtime.
US Pat. No. 10,655,201

HIGH-STRENGTH COLD-ROLLED STEEL SHEET AND METHOD FOR MANUFACTURING THE SAME

JFE STEEL CORPORATION, T...

1. A high-strength, cold-rolled steel sheet having a tensile strength of 980 MPa or more, the steel sheet havinga chemical composition containing, by mass %, C: 0.070% to 0.100%, Si: 0.50% to 0.70%, Mn: 2.40% to 2.80%, P: 0.025% or less, S: 0.0020% or less, Al: 0.020% to 0.060%, N: 0.0050% or less, Nb: 0.010% to 0.060%, Ti: 0.010% to 0.030%, B: 0.0005% to 0.0030%, Sb: 0.005% to 0.015%, Ca: 0.0015% or less, Cr: 0.01% to 2.00%, Mo: 0.01% to 1.00%, Ni: 0.01% to 5.00%, Cu: 0.01% to 5.00%, and the balance being Fe and inevitable impurities,
a metallurgical microstructure including a ferrite phase in an amount of 30% or more in terms of area fraction, at least one selected from a bainite phase and a martensite phase in an amount of 40% to 65% in total in terms of area fraction, and a cementite in an amount of 5% or less in terms of area fraction at a position located at ¼ of the thickness from the surface of the steel sheet, and
a metallurgical microstructure including a ferrite phase in an amount of 40% to 55% in terms of area fraction at a position located at 50 ?m in the thickness direction from the surface of the steel sheet,
wherein the steel sheet has a bendability, represented by a ratio of a limit bending radius (R) to a thickness (t) of the steel sheet (R/t) of 2.5 or less, with bendability being measured in accordance with JIS Z 2248, and
wherein the steel sheet has a product of tensile strength (TS) and ductility (El) of 12500 MPa·% or more, with tensile strength being measured in accordance with JIS Z 2241 (2011).
US Pat. No. 10,653,666

CARDIOPROTECTIVE NANO-PHARMACEUTICAL FORMULATION

KING ABDULAZIZ UNIVERSITY...

1. A cardiac treatment nano-emulsion formulation, comprising a therapeutically effective amount of pumpkin seed oil;D-?-tocopheryl polyethylene glycol succinate (TPGS);
polyethylene glycol (PEG) 200; and
quercetin at a dosage of 1-30 mg/kg,wherein TPGS and PEG 200 are present in an amount sufficient to form a nano-emulsion.
US Pat. No. 10,653,667

DRUG FOR PREVENTING, TREATING OR PREVENTING METASTASIS OF GIANT CELL TUMOR THAT OCCURS IN BONE OR SOFT PARTS, CHONDROSARCOMA, OR OSTEOSARCOMA, LOCAL INJECTION FOR ARTERIAL EMBOLIZATION, AND ARTIFICIAL BONE

NIPPON CHEMIPHAR CO., LTD...

1. A method for therapeutic treatment of giant cell tumor occurring in bone or soft tissue, for decreasing tumor size of giant cell tumor occurring in bone or soft tissue, for suppressing proliferation of giant cell tumor occurring in bone or soft tissue, or for prevention of recurrence and/or metastasis of giant cell tumor occurring in bone or soft tissue, which comprises orally administering an effective amount of zaltoprofen for therapeutic treatment, decreasing tumor size, suppressing proliferation or prevention of recurrence and/or metastasis to a mammal in need thereof.
US Pat. No. 10,654,947

CYCLIC ORGANOSILICON COMPOUNDS AS ELECTRON DONORS IN ZEIGLER-NATTA CATALYST SYSTEMS FOR PRODUCING PROPYLENE POLYMER HAVING HIGH MELT-FLOWABILITY

Formosa Plastics Corporat...

1. A method for producing olefin homo-polymer or copolymer having high melt flowability at reduced hydrogen loading, comprising:a. providing an external electron donor comprising an oxazasiline compound; and
b. reacting monomer in the presence of the external electron donor to produce the olefin homo-polymer or copolymer;
wherein the melt flow rate of the olefin homo-polymer or copolymer is greater than 20 g/10 minutes.
US Pat. No. 10,653,668

COMPOUNDS FOR THE TREATMENT OF DISEASES LINKED TO MITOCHONDRIAL REACTIVE OXYGEN SPECIES (ROS) PRODUCTION

OP2 DRUGS, Pessac (FR) C...

1. A method for treating or preventing free oxygen radicals-related liver diseases in a subject in need thereof, said method comprising administering to said subject an inhibitor of production of reactive oxygen species (ROS),wherein said inhibitor of production of ROS is anethole trithione, and
wherein said free oxygen radicals-related liver disease is selected from the group consisting of diabetes, alcoholic fatty liver disease, non-alcoholic fatty liver disease, liver inflammation in hepatitis C and cirrhosis.
US Pat. No. 10,654,948

RADICALLY COUPLED RESINS AND METHODS OF MAKING AND USING SAME

Chevron Phillips Chemical...

1. An ethylene polymer having a density greater than 0.950 g/ml, a level of short chain branching ranging from 3.1 SCB/103 carbons to 3.2 SCB/103 carbons, a level of long chain branching ranging from about 0.001 LCB/103 carbons to about 1.5 LCB/103 carbons as determined by SEC-MALS, and a melt index of greater than about 200 g/10 min at 190° C. and 2.16 kg as determined in accordance with ASTM D1238.
US Pat. No. 10,653,669

METHOD FOR PREVENTING AND/OR TREATING AGING-ASSOCIATED COGNITIVE IMPAIRMENT AND NEUROINFLAMMATION

THE BOARD OF TRUSTEES OF ...

1. A method of slowing the progression of or alleviating cognitive impairment in persons over the age of 40, comprising the step of: administering to a subject in need thereof an effective amount of 2-[4-(1,1-dimethylethyl)phenyl]-1H-benzimidazole, or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,654,949

HIGH MOLECULAR WEIGHT FUNCTIONALIZED OLEFIN COPOLYMER QUENCHING AGENT

ExxonMobil Chemical Paten...

1. A process for producing a polymer, wherein the process comprises:polymerizing a hydrocarbon monomer present in a solvent in the presence of a catalyst system under conditions to obtain a first effluent stream comprising a solution of the polymer and the solvent;
introducing a quenching agent into the first effluent stream to quench the polymerization reaction, wherein the quenching agent has a molecular weight (Mn) greater than about 2000 g/mol and a hydroxyl value of greater than about 10 mg KOH/g.
US Pat. No. 10,653,671

TOPICAL PHARMACEUTICAL COMPOSITIONS FOR TREATMENT OF SKIN DAMAGE

S.L.A. PHARMA, AG, Liest...

1. A method of treating skin in a patient, wherein the skin has been damaged by a second degree, a third degree, or a fourth degree burn wherein the burns are selected from the group consisting of sunburn, burns from cancer therapy radiation, chemical burns, electrical burns, and thermal burns, the method comprising:topically applying a topical composition to the damaged skin, wherein the topical composition consists essentially of metronidazole in a therapeutically effective concentration of 10 wt % in a pharmacologically acceptable non-aqueous vehicle to treat the skin damaged by said burns, wherein the dosage of metronidazole for each application is from about 125 mg to about 375 mg.
US Pat. No. 10,654,951

DROPLETS DISTRIBUTED IN AN AQUEOUS MEDIUM

DDP SPECIALTY ELECTRONIC ...

1. A composition comprising droplets distributed in an aqueous medium, wherein the droplets comprise from 0.003 to 0.03 wt %, based on weight of the droplets, of 4-vinylphenyl boronic acid, and wherein the aqueous medium comprises polyvinyl alcohol.
US Pat. No. 10,653,160

PREPARED FOODS HAVING HIGH EFFICACY OMEGA 6/OMEGA 3 BALANCED POLYUNSATURATED FATTY ACIDS

Omega Foods, LLC, Two Ri...

1. A composition for manufacture of a food product, consisting essentially of a mixture of omega-6 fatty acids, omega-3 fatty acids, and an antioxidant, wherein the ratio of omega-6 fatty acids to omega-3 fatty acids by weight is from 0.01:1 to 0.65:1; the omega 3 fatty acids comprise a short-chain polyunsaturated fatty acid (“PUFA”) and a long-chain PUFA, where the short chain has fewer than 20 carbon atoms in an aliphatic tail and the long chain PUFA has 20 or greater than 20 carbons in an aliphatic tail, where the ratio of short-chain PUFA to long-chain PUFA by weight is from 0.01:1 to 5:1; and the food product is a canned/jarred good and contains at least 50 mg of long-chain PUFA per at least 10 g serving size of the canned/jarred good.
US Pat. No. 10,654,953

METHODS OF PREPARING A CATALYST

Chevron Phillips Chemical...

1. A method of preparing a catalyst support comprising:contacting an acid-soluble titanium-containing compound with an acid to form a first mixture;
contacting the first mixture with an alkali metal silicate to form a hydrogel which has a silica content of from about 18 wt. % to about 35 wt. % based on the total weight of the hydrogel;
contacting the hydrogel with an alkaline solution to form an aged hydrogel;
washing the aged hydrogel to form a washed hydrogel; and
drying the washed hydrogel to produce a titanium-containing-silica support wherein the support has a pore volume equal to or greater than about 1.4 cm3/g.
US Pat. No. 10,654,954

METHOD OF PREPARING VINYL CHLORIDE-BASED POLYMER

LG CHEM LTD., Seoul (KR)...

1. A method of preparing a vinyl chloride-based polymer, the method comprising the steps of:(S1) preparing a mixture in which a first protective colloid auxiliary agent and a chain regulator are mixed;
(S2) preparing a second protective colloid auxiliary agent including the chain regulator activated by stirring the mixture prepared in step (S1); and
(S3) performing polymerization by adding a vinyl chloride-based monomer and a polymerization initiator to the second protective colloid auxiliary agent prepared in step (S2),
wherein the first protective colloid auxiliary agent comprises polyvinyl alcohol,
wherein the degree of hydration of the polyvinyl alcohol is 60 mol % to 90 mol %,
wherein the polyvinyl alcohol is a mixture of two or more selected from the group consisting of polyvinyl alcohol having different degrees of hydration, and
wherein the stirring in step (S2) is performed at a stirring speed of 70 rpm to 100 rpm for 10 to 40 minutes.
US Pat. No. 10,657,772

PRODUCTS AND PROCESSES FOR PROCESSING INFORMATION RELATED TO WEATHER AND OTHER EVENTS

CFPH, LLC, New York, NY ...

1. A method comprising:displaying, by at least one processor, a geographic map on a graphical user interface;
displaying, by the at least one processor, a plurality of indicators across various areas on the geographic map, the indicators representing wagers that weather related events will occur on respective areas of the map at some future time;
detecting, by the at least one processor, a selection of an area on the geographic map displayed on the graphical user interface;
in response to detecting selection of the area, receiving, by the at least one processor, data indicative of a wager that a weather event will occur on the selected area at a future time; and
generating, by the at least one processor, a financial instrument whose value is based on a likelihood that the wager will be successful.
US Pat. No. 10,653,163

CHEWY CANDY COMPRISING A HIGHLY BRANCHED STARCH (HBS) AND METHOD FOR PROVIDING THE SAME

1. A soft chewable confection containing air comprising a starch-based gelling agent, wherein said gelling agent is a highly branched starch (HBS) obtained by treatment of starch or a starch derivative with glycogen branching enzyme (EC 2.4.1.18), and wherein said HBS has a molecular branching degree of at least 6%, wherein the molecular branching degree is defined as the percentage of ?-1,6 glycosidic linkages of the total of ?-1,6 and ?-1,4 glycosidic linkages ((?-1,6/(?-1,6+?-1,4)*100%), and wherein fat content is about 3 to 10% by weight of the soft chewable confection containing air.
US Pat. No. 10,653,165

SYSTEMS AND METHODS FOR PRODUCING FERMENTED MILK REPLACER AND METHODS OF FEEDING SAME TO ANIMALS

PURINA ANIMAL NUTRITION L...

1. A method of feeding a young animal, comprising:in a tank or feeder, fermenting a liquid milk replacer comprising soy by treating the liquid milk replacer with an acid-producing bacteria; and
feeding the young animal the fermenting liquid milk replacer.
US Pat. No. 10,653,166

NON-GRAIN ECOLOGICAL FEED AS WELL AS PREPARATION METHOD AND FEEDING METHOD THEREOF

1. A non-grain ecological feed for monogastric animal, prepared from the following effective components in parts by weight:40 to 80 parts of corn straws; 1 to 25 parts of jerusalem artichoke straws, 0.5 to 20 parts of residues from juicing jerusalem artichoke, 0.5 to 20 parts of residues from juicing carrot, 0.5 to 20 parts of Folium mori, 0.1 to 15 parts of Astragalus membranaceus, 0.02 to 5 parts of papain, 0.02 to 5 parts of phytase, 0.5 to 20 parts of cellobiase, 0.1 to 15 parts of glucanase, 0.02 to 5 parts of xylanase, 0.001 to 0.3 part of pectinase, 0.001 to 0.3 part of fungal amylase, 0.01 to 3 parts of beer yeast, 0.002 to 0.5 part of Aspergillus niger, 0.005 to 1 part of Tichoderma reesei and 0.001 to 0.3 part of Geotrichum candidum.
US Pat. No. 10,653,678

METHODS OF TREATMENT FOR CHOLESTATIC AND FIBROTIC DISEASES

GENFIT, Loos (FR)

1. A method of treating liver fibrosis comprising administering a therapeutically effective amount of a pharmaceutical composition to a subject in need thereof, wherein the pharmaceutical composition consists essentially of (i) nitazoxanide (NTZ) or tizoxanide (TZ), or a pharmaceutically acceptable salt of NTZ or TZ; and (ii) Atorvastatin.
US Pat. No. 10,654,958

MODIFIED POLYVINYL ALCOHOL AND WATER-SOLUBLE FILM CONTAINING SAME

KURARAY CO., LTD., Kuras...

1. A modified polyvinyl alcohol, comprising a (meth)acrylamide monomer unit having an ionic group, wherein the modified polyvinyl alcohol has a degree of saponification of from 50 to 99.99 mol % and a viscosity-average degree of polymerization of from 200 to 5000 and satisfies formulae (1) to (3):0.8?(MwUV/MwRI)?1.3  (1)
1?(MwUV/MnUV)?7  (2)
0.03?A280?0.5  (3),
MwUV: weight-average molecular weight of the modified polyvinyl alcohol measured by an absorptiometer (measurement wavelength of 280 nm) in gel permeation chromatographic measurement of the modified polyvinyl alcohol after heating at 120° C. for 3 hours,
MwRI: weight-average molecular weight of the modified polyvinyl alcohol measured by a differential refractive index detector in gel permeation chromatographic measurement of the modified polyvinyl alcohol after heating at 120° C. for 3 hours,
MnUV: number-average molecular weight of the modified polyvinyl alcohol measured by an absorptiometer (measurement wavelength of 280 nm) in gel permeation chromatographic measurement of the modified polyvinyl alcohol after heating at 120° C. for 3 hours,
A280: absorbance (optical path length of 10 mm, measurement wavelength of 280 nm) of a 1 mass % aqueous solution of the modified polyvinyl alcohol after heating at 120° C. for 3 hours.
US Pat. No. 10,653,167

GEL BASED LIVESTOCK FEED, METHOD OF MANUFACTURE AND USE

Purina Mills LLC, Arden ...

1. A method of making a livestock feed for piglets, the method comprising:forming a feed mixture by mixing feed nutrient components, a gelling agent, and a calcium component, wherein a pH during mixing of the feed nutrient components inhibits the calcium component from reacting with the gelling agent, wherein the gelling agent comprises agar, alginate, carrageenan, gum Arabic, ghatti, tragacanth, pectin, guar, Gelan, Carboxy Methylcellulose or locust bean gum; and
once the feed mixture is formed, solubilizing the calcium component to cause the gelling agent and the calcium component to react such that a gel feed is formed comprising a gel matrix containing the entire feed mixture,
wherein the feed nutrient components comprise about 2 to 25% protein, about 3 to 40% carbohydrate, and about 0 to 10% fat.
US Pat. No. 10,653,679

COMPOSITIONS AND METHODS FOR INHIBITING BACTERIAL GROWTH

Board of Trustees of Mich...

1. A method for treating a subject who is infected with bacterial cells in which the PhoPR regulon is conserved, the method comprising administering to the subject an effective amount of an inhibitor of the PhoPR regulon to thereby treat the infection, wherein the inhibitor of the PhoPR regulon is ethoxzolamide.