US Pat. No. 10,112,506

VEHICLE SEAT

TS Tech Co., Ltd., Saita...

1. A vehicle seat, comprising:a cushion frame configured as a framework of a seating portion of the vehicle seat;
a height device that connects the cushion frame and a vehicle body floor such that the cushion frame is movable up and down relative to the vehicle body floor; and
a side cover that covers the cushion frame and the height device from an outside of the cushion frame and the height device in a seat width direction;whereinthe height device includes an operation lever for moving up and down the cushion frame, the operation lever being attached to a supporting shaft that protrudes outward from a lateral surface of the cushion frame in the seat width direction to be rotatable around the supporting shaft, and
a positioning member that is separate from the side cover is provided on a surface of the side cover to position the operation lever, and
the positioning member is attached to the side cover while being supported by the side cover.

US Pat. No. 10,112,195

FLOW CELL FOR NUCLEIC ACID ANALYSIS AND NUCLEIC ACID ANALYZER

Hitachi High-Technologies...

1. A flow cell for nucleic acid analysis, comprising:a first substrate provided with an optical filter which reflects a first light for carrying out a photo-cleaving reaction with a nucleotide having an intramolecular fluorescent molecule via a photocleavable linker;
a hollow sheet having one or more hollow portions; and
a second substrate which transmits the first light,
wherein the first substrate, the hollow sheet, and the second substrate are attached to each other, with the hollow sheet being positioned between the first substrate, which underlies the hollow sheet, and the second substrate which overlies the hollow sheet, wherein the one or more hollow portions of the hollow sheet are enclosed by the optical filter of the underlying first substrate, the hollow sheet, and the overlying second substrate and form one or more flow passages;
one or more inlet and outlet holes on one of the first substrate and the second substrate and in fluid communication with the one or more flow passages;
a plurality of bead carriers, a surface of each of which bead carriers carries a plurality of molecules of the nucleotide having the intramolecular fluorescent molecule via the photocleavable linker, fixed inside the one or more flow passages, and
wherein the optical filter transmits a second light for exciting the fluorescent molecule and transmits a third light emitted from the fluorescent molecule.

US Pat. No. 10,112,128

APPARATUS FOR SECURING UNDERDRAIN FILTER BLOCK

Xylem Water Solutions Zel...

1. An underdrain filter block for use in draining and backwashing a filtering media in a filter bed, the block comprising:a top wall;
a pair of side walls extending from the top wall;
a bottom wall extending between the pair of side walls; and
a transverse wall extending from one of the pair of side walls to the other of the pair of side walls,
wherein the top wall, the pair of side walls, and the transverse wall define an upper portion, wherein the pair of side walls, the transverse wall, and the bottom wall a lower portion, including a grout chamber positioned between the bottom wall and the transverse wall, wherein at least one of the bottom wall and said side walls contains an opening, and wherein the transverse wall forms a continuous imperforate barrier between the upper portion and the grout chamber;
wherein the top wall, the bottom wall, and the pair of side walls are defined by a first piece and the transverse wall is defined by a second piece; and
wherein side portions of the transverse wall are received by grooves defined by inner surfaces of each of the pair of side walls.

US Pat. No. 10,111,866

COMPOUNDS AS REARRANGED DURING TRANSFECTION (RET) INHIBITORS

GlaxoSmithKline Intellect...

1. A compound which is N-(3-(2-(dimethylamino)ethoxy)-5-(trifluoromethyl)phenyl)-2-(4-(4-ethoxy-6-oxo-1,6-dihydropyridin-3-yl)-2-fluorophenyl)acetamide, represented by Formula (II):
or a pharmaceutically acceptable salt thereof.

US Pat. No. 10,111,712

PROXIMAL-END SECUREMENT OF A MINIMALLY INVASIVE WORKING CHANNEL

MEDOS INTERNATIONAL SARL,...

1. An apparatus comprising:a) an arm having a proximal end portion connected to a stationary object and a distal end portion,
b) a medial-lateral bar connected to the distal end portion of the arm and having a first arcuate rail;
c) a cranial-caudal bar cantilevered from the medial-lateral bar and having:
i) a first arcuate rail in slidable engagement with the first arcuate rail of the medial-lateral bar in a first direction, wherein the first arcuate rail of the cranial-caudal bar and the first arcuate rail of the medial-lateral bar have matching arcuate shapes,
ii) a second arcuate rail extending substantially perpendicularly from the first arcuate rail of the cranial-caudal bar;
iii) a third arcuate rail extending from the first arcuate rail of the cranial-caudal bar in a direction substantially parallel to the second arcuate rail of the cranial-caudal bar; and
iv) a fourth rail that connects the second arcuate rail and the third arcuate rail of the cranial-caudal bar to form a window;
d) a working channel construct comprising:
i) a tube having an outer surface and a proximal end portion and a distal end, wherein the tube extends through the window disposed between the second arcuate rail and the third arcuate rail of the cranial-caudal bar; and
ii) a slider attached to the outer surface of the tube and having a first arcuate rail and a second arcuate rail substantially parallel to the first arcuate rail, wherein the first arcuate rail of the slider is in slidable engagement with the second arcuate rail of the cranial-caudal bar and the second arcuate rail of the slider is in slidable engagement with the third arcuate rail of the cranial-caudal bar, wherein the first arcuate rail of the slider and the second arcuate rail of the cranial-caudal bar have matching arcuate shapes;
wherein the first arcuate rail of the cranial-caudal bar is configured to slide to a position along the first arcuate rail of the medial-lateral bar to configure a medial-lateral tilt angle of the proximal end portion of the tube in a first plane while maintaining a location of the distal end of the tube; and
wherein the first arcuate rail of the slider is configured to slide to a position along the second arcuate rail of the cranial-caudal bar in a second direction to configure a cranial-caudal tilt angle of the proximal end portion of the tube in a second plane while maintaining the location of the distal end of the tube.

US Pat. No. 10,111,707

RENAL NEUROMODULATION FOR TREATMENT OF HUMAN PATIENTS

Medtronic Ardian Luxembou...

1. A method, comprising:intravascularly positioning a catheter in a reduced profile delivery configuration at a treatment site within a renal artery of a human patient and adjacent to renal nerves;
at the treatment site, transforming an expandable member at a distal portion of the catheter between the reduced profile delivery configuration and a treatment configuration,
wherein, in the treatment configuration, the expandable member is sized and shaped to place a plurality of electrodes arranged thereabout into apposition with an inner wall of the renal artery of the patient;
selectively energizing a first electrode group of the expandable member to deliver a bipolar energy field to the renal nerves; and
selectively energizing a second electrode group at the distal portion of the catheter to deliver a unipolar energy field to the renal nerves,
wherein delivering the bipolar energy field and the unipolar energy field modulates neural signaling along the renal nerves, and
wherein modulating neural signaling along the renal therapeutically beneficial reduction in blood pressure of the patient.

US Pat. No. 10,111,704

INTRAOSSEOUS NERVE TREATMENT

Relievant Medsystems, Inc...

1. A method of treating back pain from a location within a bone of a spine, comprising:inserting a distal end portion of a radiofrequency energy delivery device having two electrodes through an outer cortical bone region of the bone and within an inner cancellous bone region of the bone,
positioning a first electrode of the two electrodes on a first side of a nerve within the bone and positioning a second electrode of the two electrodes on a second side of the nerve within the bone; and
applying radiofrequency energy to the inner cancellous bone region of the bone, thereby generating heat sufficient to ablate at least a portion of the nerve within the inner cancellous bone region of the bone.

US Pat. No. 10,111,698

SURGICAL INSTRUMENT WITH ROTATABLE SHAFT HAVING PLURALITY OF LOCKING POSITIONS

Ethicon LLC, Guaynabo, P...

1. An apparatus comprising:(a) a body assembly;
(b) a shaft comprising a proximal end, and a distal end, wherein the shaft extends distally from the body assembly, wherein the shaft defines a longitudinal axis;
(c) an end effector positioned at the distal end of the shaft;
(d) a rotation input feature comprising a proximal end and a distal end, wherein the rotation input feature is configured to rotate relative to the body about the longitudinal axis, wherein the rotation input feature is configured to rotate one or both of the shaft assembly or the end effector about the longitudinal axis; and
(e) a locking feature configured to transition between a locked state and an unlocked state, where the locking feature is biased toward the locked state,
wherein the locking feature is configured to prevent rotation of the one or both of the shaft or the end effector when the locking feature is in the locked state,
wherein the locking feature is configured to permit rotation of the one or both of the shaft or the end effector when the locking feature is in the unlocked state, wherein the rotational input feature is configured to rotate relative to the body about the longitudinal axis to drive the locking feature between the locked state and the unlocked state.

US Pat. No. 10,111,683

POSITIONING AND TISSUE SENSING DEVICES AND METHODS

OMEQ MEDICAL LTD., M.P. ...

1. An apparatus for safely positioning an introducer or a stylet inside a mammalian tissue, the apparatus comprising:a hollow introducer having a longitudinal axis and a distal end;
a stylet movable through the hollow introducer and arranged to be controllably pushed out of the distal end of the introducer and against the mammalian tissue;
an actuator arranged to controllably push the stylet out of the distal end of the introducer or pull it back towards the distal end;
a sensor arranged to measure a force or a pressure required to push the stylet against the mammalian tissue; and
a processor arranged to record and analyze the measurements and determine therefrom a type of the mammalian tissue and transitions between different mammalian tissues and cavities.

US Pat. No. 10,111,679

CIRCUITRY AND SENSORS FOR POWERED MEDICAL DEVICE

Ethicon LLC, Guaynabo, P...

1. An electronic system for a surgical instrument, the electronic system comprising:a main power supply circuit configured to supply electrical power to a primary circuit;
a supplementary power supply circuit configured to supply electrical power to a secondary circuit; and
a short circuit protection circuit coupled between the main power supply circuit and the supplementary power supply circuit;
wherein the short circuit protection circuit is configured to lockout the firing of the surgical instrument after a short circuit event;
wherein the supplementary power supply circuit is configured to isolate itself from the main power supply circuit after the supplementary power supply circuit detects a short circuit condition at the secondary circuit; and
wherein the supplementary power supply circuit is configured to rejoin the main power supply circuit and supply power to the secondary circuit, after the short circuit condition ends.

US Pat. No. 10,111,661

MATRIX METALLOPROTEINASE INHIBITING ADJUNCTS FOR SURGICAL DEVICES

Ethicon LLC, Guaynabo, P...

1. A staple cartridge assembly for use with a surgical stapler, comprising:a cartridge body having a plurality of staple cavities, each staple cavity having a surgical staple disposed therein;
a biocompatible adjunct material releasably retained on the cartridge body and configured to be delivered to tissue by deployment of the staples in the cartridge body to form a staple line; and
an effective amount of at least first and second medicants disposed within and releasable from the adjunct material along the staple line, the first medicant having a first absorbable coating configured to dissolve according to a first predetermined release profile, and the second medicant having a second absorbable coating configured to dissolve according to a second predetermined time release profile that is different than the first predetermined release profile such that the first and second medicants are configured to be released from the adjunct material at different times from one another, the first and second medicants including a tissue matrix degradation inhibitor and an agent configured to induce proliferation of fibroblasts.
US Pat. No. 10,111,868

ANTINEOPLASTIC COMBINATIONS CONTAINING HKI-272 AND VINORELBINE

WYETH LLC, New York, NY ...

1. A method for treating a neoplasm in a patient in need thereof, consisting of administering to the patient:i) 100-300 mg of (E)-N-{4-[3-chloro-4-(2-pyridinylmethoxy)anilino]-3-cyano-7-ethoxy-6-quinolinyl}-4-(dimethylamino)-2-butenamide, or a pharmaceutically acceptable salt thereof; and
ii) vinorelbine, or a pharmaceutically acceptable salt thereof;wherein the neoplasm:a) overexpresses or amplifies HER-2; and
b) is selected from the group consisting of prostate cancer, myeloma, head and neck cancer, transitional cell carcinoma, and small cell and large cell neuroendocrine carcinoma of the uterine cervix.
US Pat. No. 10,113,171

METHODS FOR IMPROVING COGNITIVE FUNCTION VIA MODULATION OF QUINONE REDUCTASE 2

Carmel-Haifa University E...

1. A method for improving cortex or hippocampus dependent cognition in an Alzheimer disease patient or a patient with senility, comprising administering intracerebrally to said patient a nucleic acid molecule that reduces gene expression level of quinone reductase 2; a vector comprising said nucleic acid molecule; or a pharmaceutical composition comprising said nucleic acid molecule or said vector and a pharmaceutically acceptable carrier, wherein said quinone reductase 2 is a human quinone reductase 2 encoded by a nucleic acid sequence identified as SEQ ID NO:1.
US Pat. No. 10,111,901

BETA-GLUCAN IN COMBINATION WITH ANTI-CANCER AGENTS AFFECTING THE TUMOR MICROENVIRONMENT

BIOTHERA, INC., Eagan, M...

1. A method of treating a subject having cancer, the method comprising administering soluble ?(1,6)-[poly-(1,3)-D-glucopyranosyl]-poly-?(1,3)-D-glucopyranose and an anti-PD-L1 antibody, wherein the anti-PD-L1 antibody is a non-complement-activating antibody.
US Pat. No. 10,113,205

COMPOSITIONS TO DETECT SEASONAL H1 INFLUENZA A VIRUS NUCLEIC ACIDS

GEN-PROBE INCORPORATED, ...

1. A composition comprising:at least first and second seasonal H1 influenza A-specific amplification primers, wherein the first primer comprises a H1 influenza A-specific sequence consisting of SEQ ID NO:72 and the second primer comprises a H1 influenza A-specific sequence consisting of SEQ ID:73; and
a seasonal H1 influenza A-specific oligonucleotide detection probe having a H1 influenza A-specific sequence of at least 18 contiguous nucleotides, wherein said detection probe is complementary to a H1 influenza A nucleic acid sequence that is amplifiable by the first and second primers, and wherein said detection probe comprises at least a first detectable label operably linked to said oligonucleotide detection probe.
US Pat. No. 10,111,687

METHODS AND DEVICES FOR CONDUIT OCCLUSION

FEMASYS, INC., Suwanee, ...

1. A method for occluding at least one fallopian tube in a mammal, comprising,a) positioning at a uterine fundus of a mammal a closed tip of an introducer shaft of a delivery device of a delivery system that delivers an effective amount of an occlusive material composition, the delivery system comprising the delivery device comprising a handle, the introducer shaft having a proximal end operatively connected to the handle and the opposed closed tip, the introducer shaft defining a catheter channel along the interior length of the introducer shaft and defining at least one catheter channel opening spaced proximally from the closed tip of the introducer shaft, wherein the catheter channel is configured for providing at least one catheter; at least one catheter having a delivery end and an end structure, wherein the at least one catheter is configured to be received therein the catheter channel of the introducer shaft; and elements for providing an occlusive material composition into and through the catheter;
wherein the closed tip of the introducer shaft is positioned at the uterine fundus by inserting the introducer shaft therethrough a cervix of the mammal until the closed tip contacts a uterine fundus of the mammal, and the at least one catheter channel opening is directed toward a uterine cornua of the mammal;
b) moving the at least one catheter therethrough the catheter channel until the delivery end of the at least one catheter exits the at least one catheter channel opening and the delivery end of the catheter is located within the uterine cornua and the end structure is at or near a tubal ostium, wherein the end structure maintains the delivery end in the uterine cornua and aids in localized delivery of the occlusive material composition; and
c) delivering an effective amount of an occlusive material composition through and out the delivery end of the catheter so that a fallopian tube is occluded, wherein the occlusive material composition comprises a material that polymerizes after delivery of the occlusive material composition.
US Pat. No. 10,114,027

BETA-GLUCAN ASSAY METHODS

Biothera, Inc., Eagan, M...

1. A method comprising:obtaining a biological sample from a subject;
analyzing the sample for a biomarker anti-?-glucan antibody compared to a reference standard;
computing a Relative Antibody Unit (RAU) value for anti-?-glucan antibody in the sample;
identifying the subject having a RAU value greater than or equal to a predetermined RAU value for the biomarker anti-beta-glucan antibody, and therefore is biomarker positive for beta-glucan immunotherapy, wherein the predetermined RAU value is selected based on a correlation of specificity and sensitivity to at least one endpoint that stratifies biomarker-positive subjects and biomarker negative subjects; and
administering ?-glucan immunotherapy to the biomarker-positive subject.
US Pat. No. 10,113,058

CLEAR AND IMPACT RESISTANT POLYMER COMPOSITION AND FABRICATED ARTICLE

Braskem America, Inc., P...

1. A polymer composition, comprising:from about 50 weight percent (wt. %) to about 95 wt. % of a matrix phase comprising a polypropylene polymer comprising from 0 to 7 mole percent (mol. %) of units derived from ethylene, a C4-C10 alpha olefin or combinations thereof;
from about 5 wt. % to about 50 wt. % of a dispersed phase being a propylene/alpha olefin copolymer having from 10 mol. % to 70 mol. % of units derived from ethylene or a C4-C10 alpha olefin or combinations thereof,
wherein the weight percentages of the matrix phase and the dispersed phase are based on the total weight of the matrix phase and the dispersed phase, and
the polymer composition satisfies the following inequality:
y?55x ?8, wherein x is a ratio of Mw solubles/Mw insolubles and is less than or equal to 0.85, Mw solubles is weight average molecular weight of a soluble fraction of the polymer composition in xylene at 25° C. following ASTM D5492, Mw insoluble is weight average molecular weight of an insoluble fraction of the polymer composition in xylene at 25° C. following ASTM D5492, and y is the haze value being measured on a 0.508 millimeter (20 mil) thick injection molded plaque according to ASTM D1003; and
wherein the matrix phase has a melt flow rate of from about 0.1 dg/min. to about 10 dg/min.; and the dispersed phase has a melt flow rate of from about 1 dg/min. to about 200 dg/min., being measured using a load of 2.16 kg at 230 ° C. following ASTM D 1238.
US Pat. No. 10,113,066

CURABLE COMPOSITION, CURED COATING FILM USING SAME, AND PRINTED WIRING BOARD

TAIYO INK MFG. CO., LTD.,...

1. A curable composition, comprising:a photobase generator;
an epoxy group-containing (meth)acrylate compound;
a photopolymerization initiator; and
a thermosetting component other than the epoxy group-containing (meth)acrylate compound,
wherein the epoxy group-containing (meth)acrylate compound is a low-molecular-weight material that is a monomer or an oligomer and having a molecular weight in a range of 100 to 1,000, the photobase generator is in an amount of from 0.1 to 40 parts by mass with respect to 100 parts by mass of the thermosetting component and generates a catalyst for addition reaction between the epoxy group-containing (meth)acrylate compound and the thermosetting component by photoirradiation, and the thermosetting component is in an amount of 1 to 30 parts by mass with respect to 100 parts by mass of the curable composition.

US Pat. No. 10,117,316

ROTATING IDENTIFICATIONS IN LIGHT-BASED POSITIONING SYSTEMS

OSRAM SYLVANIA Inc., Wil...

1. A light-based communication system, comprising:a plurality of luminaires, wherein each of the plurality of luminaires is configured to transmit light-based communication (LCom) signals; and
a server communicatively coupled to the plurality of luminaires and configured to:
assign an identifier to each of the plurality of luminaires;
transmit the assigned identifier to each of the plurality of luminaires, wherein each of the plurality of luminaires transmits the assigned identifier via LCom signals;
rotate, in response to receiving a trigger signal, the assigned identifier for each of the plurality of luminaires; and
transmit the rotated identifier to each of the plurality of luminaires, wherein each of the plurality of luminaires transmits the rotated identifier via LCom signals.

US Pat. No. 10,117,313

SENSING LAMP AND SENSING MODULE THEREOF

VAXCEL INTERNATIONAL CO.,...

1. A sensing module, being detachably connected to a light body to selectively turn on a light source, the sensing module comprising:a sensing unit, having at least one sensor, a control circuit and at least one parameter adjusting element, the at least one sensor and the at least one parameter adjusting element being electrically coupled to the control circuit, the control circuit being disposed in the sensing unit; and
an electrical connector, having one side electrically and mechanically connected with the sensing unit, and another side detachably and independently connected to the light body in an electrical and mechanical manner,
wherein a first side of the sensing unit is provided with the at least one sensor, and a second side of the sensing unit is provided with the at least one parameter adjusting element; wherein the second side of the sensing unit is opposite to the first side of the sensing unit; and
wherein the sensing module further comprises a cover partially covering the sensing unit, wherein the sensing unit is capable of rotating to a first angle and a second angle, wherein the at least one sensor at the first side of the sensing unit is not blocked and is capable of performing sensing function when the sensing unit is rotated to the first angle, wherein the at least one parameter adjusting element at the second side of the sensing unit is exposed to being adjusted when the sensing unit is rotated to the second angle.

US Pat. No. 10,117,312

LIGHT SOURCE DEVICE, PROJECTION DISPLAY DEVICE, AND LIGHT SOURCE CONTROL METHOD

NEC DISPLAY SOLUTIONS, LT...

1. A light source device comprising:an excitation light source unit that emits excitation light;
a phosphor wheel unit that includes a wheel that produces fluorescence by said excitation light and that, by rotating the wheel, changes a position on the wheel that is irradiated by said excitation light;
a detection unit that detects rotation of said wheel; and
a control unit that, on the basis of the detection result of said detection unit and the fluorescence characteristic of said wheel, changes an intensity of said excitation light such that a change in intensity of the fluorescence emitted by the wheel during one rotation of the wheel is reduced,
wherein said control unit changes the intensity of said excitation light by changing a drive voltage that is supplied to said excitation tight source unit and
wherein said excitation light source unit supplies a feedback voltage that accords with the intensity of said excitation light to said control unit, and
said control unit comprises:
an alternating-current voltage generating unit that generates an alternating-current voltage on the basis of said detection result and said fluorescence characteristic;
a superposing unit that supplies a superposed voltage in which said alternating-current voltage is superposed on said feedback voltage; and
a power supply unit that supplies voltage whose magnitude accords with said superposed voltage as said drive voltage.

US Pat. No. 10,117,258

WIRELESS CHANNEL REDISTRIBUTION METHOD AND APPARATUS

Beijing Qihoo Technology ...

1. A method of redistributing wireless channel by a wireless router, comprising:receiving, by the wireless router, a request for selecting an optimum wireless channel transmitted from a controller;
scanning, by the wireless router, channel quality of each wireless channel;
selecting, by the wireless router, a first channel of the wireless router according to the channel quality of each wireless channel obtained by the scanning;
storing, by the wireless router, identification information of the first channel;
restarting, by the wireless router, a wireless connection module; wherein the restarting, by the wireless router, the wireless connection module further comprises:
powering off the wireless connection module for a predetermined time interval,
re-energize the wireless connection module after the predetermined time interval, and
setting a working channel based on the stored identification information of the first channel; and
implementing, by the wireless router, information exchange with a mobile device according to the working channel, wherein the working channel is the first channel.

US Pat. No. 10,117,253

MOBILE TERMINAL AND RESOURCE MANAGEMENT METHOD OF MOBILE TERMINAL

HUAWEI TECHNOLOGIES CO., ...

1. A mobile terminal, comprising:a first and a second operating system, the first operating system configured to:
receive, via a user interface, a card operation request for a subscriber identity module (SIM) card;
notify the second operating system of the card operation request; and
a virtual resource sharing control system coupled to the first and the second operating system, the virtual resource sharing control system configured to perform coordinated management on card operations on the SIM card for the first and the second operating systems, and send a feedback result of the card operation to the first operating system according to the card operation request and a status of the SIM card, the first operating system forwarding the feedback result to the second operating system.

US Pat. No. 10,117,130

METHOD FOR CANCELLING A DATA TRANSMISSION OF A NEIGHBORING CELL

HFI Innovation Inc., Hsi...

1. A method, comprising:obtaining configuration information of a data transmission by a user equipment (UE) in a mobile communication network, wherein the data transmission is transmitted from a neighboring cell to the UE via an interference channel, wherein the configuration information includes a basic unit of physical resource blocks (PRBs) used by the neighboring cell for the data transmission;
receiving radio signals on a set of resource elements (REs);
estimating the interference channel corresponding to the data transmission from the neighboring cell based on the received radio signals on the set of resource elements; and
cancelling/suppressing the data transmission from the neighboring cell based on the estimated interference channel.

US Pat. No. 10,117,109

SYSTEM AND METHOD FOR DETERMINING OPTIMAL PLACEMENT OF TELECOMMUNICATION EQUIPMENT

Tejas Networks, Ltd., Ka...

1. A method to determine placement of one or more telecommunication equipment comprising the steps of:constructing, at a computing device, based on given network parameters and service requirements of a network, using a genetic algorithm, an initial population of possible solutions that are each encoded as a chromosome, wherein
each solution of the possible solutions pertains to a specific deployment of the one or more telecommunication equipment;
iteratively performing, at said computing device, crossover operations comprising selecting two chromosomes and exchanging features of the two chromosomes to obtain daughter chromosomes as additional possible solutions to increase optimality of the chromosomes, based on a combination of cost of placement of the one or more telecommunication equipment and number of telecommunication equipment to be placed as well as the length of the paths over which traffic is routed; and
identifying, at the computing device, based on the iterative crossover operations, a most optimal chromosome as a final solution for the placement of the one or more telecommunication equipment to minimize network cost, maximize network utilization, and meet Service Level Agreements (SLA) for a given network topology and demand requirements.

US Pat. No. 10,117,096

SYSTEMS AND METHODS TO DETERMINE SAFE ZONES AND SAFE ROUTES OF A DEVICE

Athentek Innovations, Inc...

1. A system to authenticate a device, the system comprising:a fixed wireless infrastructure device, wherein the fixed wireless infrastructure device comprises a processor, a memory, and a communication unit, and the processor is programmed to scan, periodically, using the communication unit, a radio environment surrounding the fixed wireless infrastructure device to obtain a radio signal fingerprint;
an authentication server comprising a processing unit, a memory unit, and a server communication unit, wherein the server communication unit is in communication with the fixed wireless infrastructure device, and the processing unit is programmed to:
transmit, periodically, a first cryptographic key to the fixed wireless infrastructure device, wherein the first cryptographic key is included as part of a wireless broadcast frame of a wireless communication protocol;
receive from the fixed wireless infrastructure device the radio signal fingerprint to corroborate a geographic location of the fixed wireless infrastructure device;
wherein the processor of the fixed wireless infrastructure device is further programmed to broadcast, via the communication unit, the first cryptographic key;
wherein the processing unit of the authentication server is further programmed to:
receive a second cryptographic key from an application server originating from the device, wherein the application server is configured to receive the second cryptographic key as part of a request from the device to access a resource provided by the application server; and
generate a request approval recommendation to allow the device access to the resource provided by the application server when the first cryptographic key matches the second cryptographic key and the radio signal fingerprint matches a preapproved radio signal fingerprint.

US Pat. No. 10,117,080

APPARATUS AND METHOD OF DETERMINING AN OPEN STATUS OF A CONTAINER USING RFID TAG DEVICES

Walmart Apollo, LLC, Ben...

1. A radio frequency identification (RFID) device comprising:a first portion of a container, the container being in a closed orientation and configured to be moved into an open orientation by a user;
a second portion of the container removably coupled to the first portion;
a first RFID tag fixed to the first portion and configured to communicate only in a near field of RFID communication;
a conductive element implemented at the second portion and located in proximity to the first RFID tag when the container is in the closed orientation and configured to function as a far field antenna for the first RFID tag such that the first RFID tag is readable by an RFID reader in a far field of RFID communication when the container is in the closed orientation; and
a second RFID tag fixed to the first portion such that the second RFID tag is shielded by the second portion and is not readable by the RFID reader when the container is in the closed orientation;
wherein the first portion and the second portion are configured such that upon a user action to open the container at least a first amount, the first portion and the second portion move relative to each other decoupling the conductive element from the first RFID tag such that the first RFID tag is no longer readable in the far field indicating a first open status of the container; and
wherein the first portion and the second portion are further configured such that upon a user action to open the container at least a second amount, the first portion and the second portion move relative to each other such that the second RFID tag is no longer shielded and is readable by the RFID reader indicating a second open status of the container.

US Pat. No. 10,117,077

PACKET-BASED USAGE TRACKING FOR A WIRELESS DEVICE

TracFone Wireless, Inc., ...

1. A system for tracking usage of a wireless device, comprising:a tracking processor configured to be implemented in at least one of the following: a mobile network operator system and the wireless device;
the tracking processor further configured to receive a first data packet and a second data packet that each include an identifier of a first type of wireless service;
the tracking processor further configured to monitor information regarding the first data packet, wherein the information regarding the first data packet includes the identifier of the wireless device, the identifier of a first type of wireless service, and an amount of data for the first type of wireless service;
the tracking processor further configured to determine a first usage of the first type of wireless service based on information regarding the first data packet;
the tracking processor further configured to store the first usage of the first type of wireless service for the wireless device;
the tracking processor further configured to monitor information regarding the second data packet, wherein the information regarding the second data packet includes the identifier of the wireless device, the identifier of the first type of wireless service, and an amount of data for the first type of wireless service;
the tracking processor further configured to determine second usage of the first type of wireless service based on the information regarding the second data packet;
the tracking processor further configured to store the second usage of the first type of wireless service for the wireless device;
the tracking processor further configured to accumulate the first usage of the first type of wireless service and the second usage of the first type of wireless service as a total usage of the first type of wireless service for the wireless device; and
the tracking processor further configured to store the total usage of the first type of wireless service for the wireless device,
wherein the identifier of the first type of wireless service is included in the first data packet and the second data packet.

US Pat. No. 10,117,072

SYSTEM AND METHOD FOR EFFICIENT SHORT MESSAGE SERVICE DELIVERY USING PRIVATE SUBSCRIBER IDENTITY INFORMATION

Verizon Patent and Licens...

1. A device, comprising:one or more memories; and
one or more processors, communicatively coupled to the one or more memories, to:
receive, from a subscriber identity module (SIM) over-the-air (OTA) (SIM OTA) device, a short message peer-to-peer (SMPP) message,
the SMPP message including an international mobile subscriber identity (IMSI) associated with a user device, and
the SMPP message being associated with modifying a universal integrated circuit card (UICC) of the user device;
determine, using the IMSI associated with the user device and without using a mobile station international subscriber directory number (MSISDN) of the user device, a network device to which the user device is connected; and
provide, to the network device, a short message service (SMS) message associated with modifying the UICC of the user device to permit the UICC of the user device to be modified.

US Pat. No. 10,117,059

WIRELESS BRIDGE HARDWARE SYSTEM FOR ACTIVE RFID IDENTIFICATION AND LOCATION TRACKING

General Electric Company,...

1. A beacon badge comprising:a motion sensor to transition a state of the beacon badge from a low power utilization state to a normal power utilization state when motion of the beacon badge is determined;
a wireless transceiver to, when activated by the motion sensor in the normal power utilization state, receive a beacon message; and
a proximity engine to manage, when activated by the motion sensor in the normal power utilization state, the beacon message, wherein the proximity engine instructs the wireless transceiver to transmit the beacon message to a real time location (RTLS) server when a received signal strength indication (RSSI) value of the beacon message satisfies a proximity threshold and to discard the beacon message when the RSSI value of the beacon message does not satisfy the proximity threshold.

US Pat. No. 10,117,041

SYSTEMS AND METHOD FOR CONFIGURING MOBILE DEVICE APPLICATIONS BASED ON LOCATION

eBay, Inc., San Jose, CA...

1. A method comprising:monitoring, on a mobile device, a parent geofence that geographically encompasses a plurality of child geofences, each of the child geofences representing a physical location within the parent geofence;
detecting, based at least in part on a first location of the mobile device, entry into a first child geofence of the plurality of child geofences within the parent geofence;
receiving a first user request at the mobile device, the first user request including a request type and a first location identifier based on the first location of the mobile device, the first location identifier identifying the first geofence;
performing a first function in response to the receiving the user request, the performing the first function based on the request type and the first location identifier identifying the first geofence;
detecting, based at least in part on a second location of the mobile device, entry into a second child geofence of the plurality of the child geofences within the parent geofence;
receiving a second user request at the mobile device, the second user request including the request type and a second location identifier based on the second location of the mobile device, the second location identifier identifying the second geofence; and
performing a second function in response to the receiving the second user request, the performing the second function based on the request type and the second location identifier identifying the second geofence.

US Pat. No. 10,117,035

ACTIVE OUTPUT DRIVER SUPPLY COMPENSATION FOR NOISE REDUCTION

SEMICONDUCTOR COMPONENTS ...

19. An audio noise reduction method, comprising:taking a first measurement of a power source voltage at a first time;
taking a second measurement of said power source voltage at a second time;
calculating a rate of change based on said first and second voltage measurements;
generating an amplitude correction signal based at least partially on the calculated rate of change and a target load voltage;
generating a switch control signal using the amplitude correction signal and an audio signal; and
controlling one or more switches using the switch control signal to regulate the provision of power to a load.

US Pat. No. 10,116,830

DOCUMENT DATA PROCESSING INCLUDING IMAGE-BASED TOKENIZATION

ACCENTURE GLOBAL SOLUTION...

1. A system to perform image-based tokenization, the system comprising:a memory storing a processing application comprising machine readable instructions;
a processor that executes the stored processing application to:
prompt a user via a display to capture a first image of a physical item;
control an imaging sensor to capture the first image; and
measure pixel parameters of pixels in a region of the captured first image to identify a unique feature of the physical item;
a tokenization server to:
receive the unique feature identified by the processing application;
apply the unique feature to a cryptographic function to generate a token for the physical item;
capture a second image of the physical item,
the physical item rendered unusable for an intended purpose after a modification of the physical item;
verify whether the physical item is rendered unusable for the intended purpose based on the captured second image of the physical item; and
in response to the verifying that the physical item is rendered unusable for the intended purpose, release the token for use by the user; and
a token database to store the token and information related to the physical item.

US Pat. No. 10,116,729

DYNAMIC MEDIA TRANSFORMATION SERVICE IN A CDN

VERIZON DIGITAL MEDIA SER...

1. A method, comprising:configuring a network device in a content delivery network (CDN) with a plurality of visual presentation transformations the network device selectively applies during distribution of customer media, with application of each visual presentation transformation of the plurality visual presentation transformations changing presentation of the customer media on a display by changing a different visual property of the customer media;
receiving, at the network device from the customer, data associated with original customer media, wherein rendering the original customer media produces a first presentation on the display;
receiving, at the network device from the customer originating the original customer media, selection of a subset of visual presentation transformations from the plurality of media transformations that are to be applied to the original customer media prior to delivery;
receiving, at the network device from a client browser, a request for the original customer media;
applying, at the network device responsive to receipt of the request for the original customer media from the client browser, the subset of visual presentation transformations to the original customer media based on the selection of the subset of visual presentation transformations by the customer, wherein said applying generates modified customer media producing a second presentation on the display that is different than the first presentation of the original customer media; and
sending, from the network device to the client browser, the modified customer media in response to said request for the original customer media.

US Pat. No. 10,116,696

NETWORK PRIVILEGE MANAGER FOR A DYNAMICALLY PROGRAMMABLE COMPUTER NETWORK

SRI International, Menlo...

1. A method comprising:obtaining, by a computing device on a network, data comprising network activity data and reputation data and role data, wherein the network activity data includes data corresponding to a state of one or more network flows in the network and the reputation data identifies one or more acceptable or unacceptable network flows over the network and the role data identifies a role associated with an endpoint of a network flow on the network and at least some of the data corresponds to real-time activity;
determining a current network context using at least some of the data;
selecting a security policy from one or more security policies by matching a first portion of the current network context to a criterion of the security policy;
adjusting a value of a threshold attribute of the security policy based on the data that corresponds to real-time activity, wherein the value of the attribute identifies one or more of a number and a duration associated with network flows;
in response to a second portion of the current network context matching the adjusted value of the threshold attribute, cause execution of the security policy on the network to control traffic over the network.

US Pat. No. 10,116,679

PRIVILEGE INFERENCE AND MONITORING BASED ON NETWORK BEHAVIOR

ExtraHop Networks, Inc., ...

1. A method for monitoring network traffic using one or more network computers, wherein execution of instructions by the one or more network computers perform the method comprising:instantiating a monitoring engine to perform actions, including:
monitoring network traffic associated with a plurality of entities in one or more networks to provide one or more metrics, wherein the entities include one or more of a source entity and one or more of a target entity; and
providing a device relation model based on the plurality of entities, the network traffic, and the one or more metrics; and
instantiating an inference engine to perform actions, including:
associating the plurality of entities with one or more privilege levels based on the device relation model and the one or more metrics, wherein a value for each of the one or more privilege levels is based on one or more of an amount of access or an amount of control that the one or more source entities exert over the one or more target entities; and
increasing the one or more privilege levels for a source entity based on one or more metric values that are associated with the one or more target entities that are linked to the source entity; and
instantiating an anomaly engine to perform actions, including:
determine one or more interactions between the one or more source entities and the one or more target entities based on the monitored network traffic;
generating one or more escalation events based on the one or more interactions and the one or more privilege levels associated with the one or more source entities and the one or more target entities, wherein the one or more interactions or the one or more target entities are associated with a privilege level that exceeds the one or more privilege levels associated with the one or more source entities; and
providing the one or more escalation events to one or more users.

US Pat. No. 10,116,596

PERSONALIZING DATA SYSTEM COMPONENTS AND DATA SOURCES AS CHATBOTS IN A GROUP CHAT SESSION

International Business Ma...

1. A computer program product, the computer program product comprising a computer readable storage medium having program code embodied therewith, the program code executable by at least one processor to perform:providing, by the at least one processor, a social media gateway interface with a chat adapter for a chat application, wherein the chat adapter comprises (1) an Extract Transform and Load (ETL) job chatbot for accessing a data system and (2) message mapping definitions, wherein the data system comprises an ETL server;
receiving, by the at least one processor, from a group chat server, a request to start a chat session;
creating, by the at least one processor, a chat session between a mobile chat participant using the chat application and the ETL job chatbot; and
in response to receiving a chat message from the mobile chat participant,
converting, by the at least one processor, the chat message to a method invocation for the chatbot using the message mapping definitions;
executing, by the at least one processor, a request of the converted chat message with the chatbot to generate a response chat message by:
selecting an interface of a plurality of interfaces of the data system based on the converted chat message, wherein the plurality of interfaces comprise a first interface to import an ETL job and a second interface to design and monitor the ETL job;
calling, by the at least one processor, the selected interface to obtain the response; and
returning, by the at least one processor, the response chat message.

US Pat. No. 10,116,560

SYSTEMS, METHODS, AND APPARATUS FOR COMMUNICATING MESSAGES OF DISTRIBUTED PRIVATE NETWORKS OVER MULTIPLE PUBLIC COMMUNICATION NETWORKS

CAUSAM ENERGY, INC., Ral...

1. A system for communicating messages of a distributed private network (DPN) over a plurality of communication networks for critical infrastructure, the system comprising:at least one of an inter-network interface and a message coordinator; wherein the inter-network interface comprises at least one network interface, a processing function and a memory; and wherein the message coordinator comprises at least one network interface, a processing device and a memory;
wherein the inter-network interface is part of a service area of a first electric utility;
wherein the inter-network interface is communicatively coupled to the message coordinator;
wherein the inter-network interface is operable to receive a packetized message from a first DPN network element of the service area of the first electric utility over a first communication network;
wherein the packetized message utilizes a complete Open Systems Interconnection (OSI) protocol stack, including physical, data link, network, transport with an aggregation sublayer, session, presentation, and application layers, wherein the protocol stack identifies the packetized message as being a message communicated within the DPN;
wherein the inter-network interface is operable to process the packetized message from lowest to highest OSI layer using only physical, data link, network, and transport layers with aggregation sublayer;
wherein the inter-network interface is operable to communicate the packetized message to the message coordinator;
wherein the message coordinator is operable to:
receive the packetized message from the inter-network interface;
assign a transport route for the packetized message;
assign a priority and a security protocol to the packetized message based on a prioritization protocol for the DPN, wherein the prioritization protocol is based on a class of service to a second DPN network element of a second service area of a second electric utility; and
return the packetized message to the inter-network interface;
wherein the inter-network interface is operable to determine whether the assigned transport route is available;
wherein the inter-network interface is operable to communicate the packetized message to the second DPN network element over a second communication network based on the assigned transport route or an alternative transport route when the assigned transport route is unavailable; and
wherein the first DPN network element has a lower class of service than the inter-network interface.

US Pat. No. 10,116,420

ERROR RETRANSMISSION MECHANISM-COMPRISED METHODS, APPARATUSES AND SYSTEMS FOR TRANSMITTING AND RECEIVING VISIBLE LIGHT SIGNAL

KUANG-CHI INTELLIGENT PHO...

1. An error retransmission mechanism-comprised method for transmitting a visible light signal, comprising the following steps:during transmission of a visible light signal, when a photonic key executes signal transmission on an error sensitive level each time, reading, by the photonic key, an execution duration of the photonic key;
comparing the execution duration with a signal duration range;
when the execution duration does not fall within the signal duration range, performing, by the photonic key, signal retransmission; and
when the execution duration falls within the signal duration range, continuing, by the photonic key, signal transmission;
wherein the error sensitive level refers to a level having an abnormal duration that causes an identification error at a receive end.

US Pat. No. 10,116,360

METHOD AND APPARATUS FOR UPLINK MULTI-USER TRANSMISSION IN A HIGH EFFICIENCY WIRELESS LAN

Newracom, Inc., Lake For...

1. A method for performing a frame exchange sequence including an uplink multi-user (UL MU) transmission by an access point (AP) in a wireless local area network, the method comprising:acquiring a transmission opportunity (TXOP) for initiating the frame exchange sequence;
determining whether a time required for the frame exchange sequence that excludes a control response frame exceeds a TXOP limit;
transmitting a trigger frame to one or more stations (STAs) when the time required for the frame exchange sequence was determined not to exceed the TXOP limit; and
when the time required for the frame exchange sequence was determined to exceed the TXOP limit:
adjusting a duration value of the UL MU transmission included in the trigger frame to meet the TXOP limit; and
transmitting the trigger frame with the adjusted duration value of the UL MU transmission to the one or more STAs.

US Pat. No. 10,116,342

APPARATUS AND METHOD FOR CONTROLLING SIGNAL GAIN IN WIRELESS TRANSMITTER

Samsung Electronics Co., ...

1. An apparatus for a transmitter, the apparatus comprising:a plurality of mixers respectively coupled with a baseband processor providing a baseband signal;
a plurality of variable gain amplifiers (VGAs) respectively coupled with the plurality of mixers;
a plurality of local oscillators (LOs) respectively coupled with the plurality of mixers, the plurality of LOs comprising a first LO for a gain greater than a first threshold and a second LO for a gain lower than a second threshold which is greater than the first threshold;
an antenna operatively coupled to each of the plurality of VGAs; and
a controller configured to, if a required gain of the transmitter is greater than the first threshold and is lower than the second threshold,
identify a signal path from a first signal path for a high performance mode and a second signal path for a low power consumption mode among a plurality of signal paths, each of the plurality of signal paths comprising each of the plurality of mixers, each of the plurality of VGAs, and each of the plurality of LOs, respectively,
wherein the antenna is configured to transmit an output signal generated by using the identified signal path from the baseband signal,
wherein the first signal path corresponds to the required gain and the first LO in the first signal path is configured to consume a first current quantity, and
wherein the second signal path corresponds to the required gain and the second LO in the second signal path is configured to consume a second current quantity less than the first current quantity.

US Pat. No. 10,116,336

ERROR CORRECTING CODE ADJUSTMENT FOR A DATA STORAGE DEVICE

SanDisk Technologies LLC,...

1. A data storage device comprising:a non-volatile memory; and
a controller coupled to the non-volatile memory, the controller configured to:
initiate a read operation to access information of a codeword stored in a word line on a silicon substrate of the non-volatile memory, the codeword comprising a user data portion and an error correcting code (ECC) portion, wherein the controller includes an ECC distributor configured to statistically distribute positions of ECC portions of codewords relative to positions of user data portions;
generate, during a decoding process associated with the read operation, a modified ECC portion corresponding to the user data portion in response to an error rate associated with the information satisfying a threshold; and
write at least one bit of the modified ECC portion to a location at the non-volatile memory, wherein a physical position of the location relative to the user data portion is set to substantially equally program storage elements at the non-volatile memory based on the statistically distributed positions of ECC portions of codewords relative to positions of user data portions.

US Pat. No. 10,116,313

APPARATUS AND METHOD TO MITIGATE PHASE AND FREQUENCY MODULATION DUE TO INDUCTIVE COUPLING

Intel Corporation, Santa...

1. An apparatus comprising:a first clocking source having a first divider;
a second clocking source having a second divider, wherein the first and second clocking sources are close enough in proximity to one another such that they are inductively coupled to one another; and
calibration logic to monitor clock signals associated with the first and second clocking sources and to generate at least one calibration code to adjust at least one divider ratio of the first or second dividers according to the monitored clock signals; and
a sigma-delta modulator to receive the at least one calibration code from the calibration logic, wherein the at least one calibration code is generated according to the monitored clock signals.

US Pat. No. 10,116,282

MULTI-FUNCTION FREQUENCY CONTROL DEVICE

RAKON LIMITED, Auckland ...

1. A frequency control device, constructed as a single component, comprising at least three thermally coupled elements: a first resonating element whose resonant frequency is within the HF band or higher, a second resonating element whose resonant frequency is within the LF band or lower, and a temperature sensing element, and wherein, in addition to facilitating the generation of high frequency and low frequency signals, the said resonating elements allow, when used in conjunction with the said temperature sensing element, for high resolution determination of the said device's temperature.

US Pat. No. 10,116,217

DIGITAL AVERAGE INPUT CURRENT CONTROL IN POWER CONVERTER

Solaredge Technologies Lt...

1. A method comprising:predicting an inductor current based on at least one of a sampled inductor current, a sampled input voltage, or a sampled output voltage;
controlling a duty cycle based on the predicted inductor current to cause an input current of a converter to approach a particular input current; and
switching the converter from a buck-boost mode to a boost mode in response to determining that the duty cycle has been above a threshold for more than a plurality of consecutive switching cycles.

US Pat. No. 10,116,213

SEMICONDUCTOR MODULE AND ELECTRIC POWER CONVERSION APPARATUS

DENSO CORPORATION, Kariy...

1. An electric power conversion apparatus comprising:an IGBT made of a silicon semiconductor; and
a MOSFET made of a wide-bandgap semiconductor having a wider bandgap than the silicon semiconductor,
wherein
the IGBT and the MOSFET are connected in parallel to each other to form a semiconductor element pair,
a surface area of the IGBT is greater than a surface area of the MOSFET,
in a low-temperature state in which temperature of the semiconductor element pair is lower than in a high-temperature state, on-resistance of the MOSFET is lower than on-resistance of the IGBT at a given electric current, and
in the high-temperature state in which the temperature of the semiconductor element pair is higher than in the low-temperature state, the on-resistance of the IGBT is lower than the on-resistance of the MOSFET at the given electric current.

US Pat. No. 10,116,206

LOOP COMPENSATION CIRCUIT AND SWITCHING POWER SUPPLY CIRCUIT

Shenzhen China Star Optoe...

6. A switching power supply circuit, wherein the switching power supply circuit comprises a voltage generation circuit and a loop compensation circuit, and the loop compensation circuit comprises a voltage detection circuit, a control chip and a RC circuit, wherein:the voltage detection circuit is coupled to the voltage generation circuit, and employed to detect a variation of an output voltage of the voltage generation circuit;
the control chip is respectively coupled to the voltage detection circuit and the RC circuit, and employed to detect a response speed of the loop compensation circuit and to adjust a parameter of the RC circuit according to the response speed of the loop compensation circuit and the variation of the output voltage of the voltage generation circuit for adjusting the response speed of the loop compensation circuit;
wherein the RC circuit comprises a resistance circuit, a capacitance circuit and a switching circuit, wherein the switching circuit is respectively coupled to the control chip, the resistance circuit and the capacitance circuit, and employed to be on or off according to a control signal outputted by the control chip to adjust a resistance value of the resistance circuit and a capacitance value of the capacitance circuit;
wherein the resistance circuit comprises at least two resistances, and the capacitance circuit comprises at least two capacitances, and the switching circuit comprises at least two switching transistors;
at least one resistance in the at least two resistances is coupled to at least one switching transistor in the switching circuit in series or in parallel; at least one capacitance in the at least two capacitances is coupled to at least one switching transistor in the switching circuit in series or in parallel;
wherein the control chip comprises a control circuit and a PWM output circuit, wherein the control circuit is coupled to the voltage detection circuit, the RC circuit and the PWM output circuit, and employed to detect the response speed of the loop compensation circuit, and to control a Pulse Width Modulation PWM signal outputted by the PWM output circuit according to response speed of the loop compensation circuit and a variation of the output voltage;
the PWM output circuit comprises at least two PWM output ends, and the at least two PWM output ends are coupled to the at least two switching transistors, and employed to respectively output PWM signals to the at least two switching transistors for controlling the at least two switching transistors to be on or off; and
wherein the resistance circuit comprises a first resistance, a second resistance and a third resistance, and the switching circuit comprises a first switching transistor and a second switching transistor, wherein:
the first resistance and the first switching transistor are connected in parallel and are coupled between the control circuit and one end of the second resistance in series;
the third resistance and the second switching transistor are coupled between the control circuit and the other end of the second resistance in series;
the first switching transistor and a second switching transistor are respectively coupled to the at least two PWM output ends.

US Pat. No. 10,116,083

NETWORK CABLE CONNECTOR

JYH ENG TECHNOLOGY CO., L...

1. A network cable connector, comprising:a main body, with a front end plugged into an external network jack, and with an end plugged into an external network cable, and the main body having a clamping base and a clamping cover, and the clamping cover being pivotally coupled to the clamping base, such that when the clamping cover is opened, the network cable is received, and when the clamping cover is closed and engaged with the clamping base, a pushing pipe is formed, and the pushing pipe also has an outer thread formed thereon;
an elastic ejection block, installed in the clamping base, and a distance between the elastic ejection block and the clamping cover being smaller than a cable diameter of the network cable, so that when the network cable presses the elastic ejection block, an expansion force is produced to expand the clamping base and the clamping cover outwardly; and
a hollow compression device, with an internal front end having an inner thread, and the outer thread being screwed into the inner thread, so that the hollow compression device produces a compression force towards the inside, and the hollow compression device has a tapered internal end, so that an end of the hollow compression device has a hole diameter smaller than a hole diameter of the front end, wherein a linearly displacing clamping part is disposed between the internal front end and the end of the hollow compression device, and the pushing pipe pushes the clamping part to move to an end of the hollow compression device, and the clamping part compresses towards the inside, so that the clamping part has an internal diameter smaller than the cable diameter of the network cable;
when the hollow compression device is screwed into the pushing pipe, the clamping base and the clamping cover are expanded towards outside, so that the hollow compression device is locked securely to the pushing pipe, while the pushing pipe is pushing the clamping part to move to the tapered end of the hollow compression device, and since the clamping part has an internal diameter smaller than the cable diameter of the network cable, the clamping part is clamped securely to the network cable to form a clamping force, while fixing the hollow compression device.

US Pat. No. 10,116,027

RF FILTER TUNING SYSTEM AND METHOD FOR MANUFACTURING FILTER USING THE SAME

KMW INC., Hwaseong, Gyeo...

1. An RF filter tuning system for tuning an RF filter that includes a plurality of cavities having resonance elements and a cover having tuning areas that are positioned correspondingly to the resonance elements, the RF filter tuning system comprising:a measuring unit configured to measure resonance characteristics of the plurality of the cavities of the RF filter and a separation distance between at least a pair of the cavities;
a control unit configured to calculate a tuning value of the RF filter based on the resonance characteristics;
a tuning unit configured to tune the RF filter based on the tuning value calculated by the control unit; and
a screw cutter configured to cut a screw based on the separation distance between at least the pair of the cavities, wherein the tuning unit includes a striking unit configured to strike the tuning area of the cover of the RF filter to adjust a resonance value and a fastening unit configured to fasten the screw cut by the screw cutter between at least the pair of the cavities, thereby tuning the RF filter.

US Pat. No. 10,115,988

HEALTH MONITORING OF AN ELECTROCHEMICAL CELL STACK

Nuvera Fuel Cells, LLC, ...

1. An electrochemical cell system, comprising:an electrochemical cell;
a voltage measurement device adapted to measure a voltage across the electrochemical cell;
pressure transmitters connected to an inlet gas channel and an outlet gas channel, wherein the pressure transmitters are configured to measure the pressure at the inlet (Pin ) and at the outlet (Pout ); and
a control unit configured to process voltage signals received from the voltage measurement device, wherein the control unit is configured to:
conduct a linear current sweep across the electrochemical cell;
generate a voltage-current (V-I) curve based on the linear current sweep;
generate a baseline V-I curve of the electrochemical cell using a predetermined ratio of pressures of Pin and Pout and to calculate a slope of the baseline V-I curve;
generate an aged V-I curve of the electrochemical cell at any time point during operation of the electrochemical cell and to calculate a slope of the aged V-I curve;
to calculate a difference in value between the slopes of the baseline V-I curve and the aged V-I curve;
compare the difference in value between the slopes of the baseline V-I curve and the aged V-I curve to a preset reference value; and
automatically initiate at least one corrective action if the difference in value between the slopes of the baseline V-I curve and the aged V-I curve is greater than the preset reference value,
wherein the corrective action is chosen from alerting an operator and initiating a preventative action.

US Pat. No. 10,115,969

BATTERY, ELECTRODE, BATTERY PACK, ELECTRONIC DEVICE, ELECTRIC VEHICLE, POWER STORAGE DEVICE, AND POWER SYSTEM

Murata Manufacturing Co.,...

1. A battery comprising:a positive electrode; and
a negative electrode,
wherein at least one electrode of the positive electrode and the negative electrode includes
a current collector,
a mixture layer over one main surface of the current collector, the mixture layer including a gap through which a part of the current collector is exposed,
a lead bonded to an exposed surface of the current collector exposed through the gap, and
a protective layer configured to protect the current collector, wherein the protective layer includes at least one of a resin material and a carbon material, and the protective layer is provided away from edges of the current collector and is over the exposed surface of the current collector and the protective layer interposes between an end part of the lead and the exposed surface of the current collector,
wherein the end part of the lead includes an entire end edge portion and two side edge portions of the lead, and the protective layer separates the entire end edge portion of the lead from the exposed surface of the current collector,
wherein the entire end edge portion of the lead is not in contact with the exposed surface of the current collector and at least a portion of the two side edge portions is in contact with the exposed surface of the current collector, and
wherein at least one end portion of the protective layer is positioned over the mixture layer.

US Pat. No. 10,115,940

RECHARGEABLE BATTERY

SAMSUNG SDI CO., LTD., Y...

1. A rechargeable battery, comprising:an electrode assembly to be charged and discharged;
a case including the electrode assembly;
a cap plate closing and sealing an opening of the case; and
an electrode terminal connected to the electrode assembly and provided in a terminal hole of the cap plate, wherein the cap plate includes:
a welded portion on an inner surface of the cap plate facing the electrode assembly and welded to the opening of the case;
an adhesive portion on the inner surface of the cap plate and recessed in a lateral direction relative to an edge of the cap plate, the adhesive portion recessed to accommodate the welded portion by a thickness of the case, the adhesive portion thicker than the welded portion to protrude inward and having a lateral surface contacting an inner surface of the opening; and
a separated portion on the inner surface of the cap plate and connected to the adhesive portion in the lateral direction, further recessed in a thickness direction of the case, and separated from the inner surface of the opening, wherein
the welded portion is on an end portion of the opening and forms a welding line in a lateral direction of the case,
the adhesive portion and the welded portion form a first step, and
the separated portion and the welded portion form a second step that is connected to the first step in a planar direction.

US Pat. No. 10,115,919

OPTOELECTRONIC DIODES AND ELECTRONIC DEVICES INCLUDING SAME

SAMSUNG ELECTRONICS CO., ...

1. An optoelectronic diode, comprising:a first electrode and a second electrode electrically connected to each other, the second electrode having a greater resistance than a resistance of the first electrode,
a third electrode proximate to at least one electrode of the first electrode and the second electrode,
a first active layer between a first two electrodes of the first electrode, the second electrode, and the third electrode, and
a second active layer between a second two electrodes of the first electrode, the second electrode, and the third electrode, the second active layer isolated from the first active layer.

US Pat. No. 10,115,839

MODULE FABRICATION OF SOLAR CELLS WITH LOW RESISTIVITY ELECTRODES

Tesla, Inc., Palo Alto, ...

1. A solar module, comprising:a first solar cell having a first back-side emitter layer, and having only an area along one edge on a back-side surface covered by a first busbar; and
a second solar cell having only an area along one edge on a front-side surface covered by a second busbar;
wherein the first solar cell and second solar cell are coupled by overlapping the first busbar and second busbar.

US Pat. No. 10,115,744

ARRAY SUBSTRATE AND FABRICATION METHOD, DISPLAY PANEL, AND DISPLAY DEVICE

Shanghai Tianma AM-OLED C...

1. An array substrate, comprising: a substrate; a first functional layer configured on one side of the substrate; a first insulating layer configured on the first functional layer facing away from the substrate; a second functional layer configured on the first insulating layer facing away from the substrate; a second insulating layer configured on the second functional layer facing away from the substrate; a third functional layer configured on the second insulating layer facing away from the substrate; a third insulating layer configured on the third functional layer facing away from the substrate; a fourth functional layer configured on the third insulating layer facing away from the substrate; a plurality of through-holes configured to electrically connect different functional layers, wherein a depth of any through-holes does not exceed the thickness of two adjacent insulating layers; and a plurality of pixel driving circuits, wherein a pixel driving circuit comprises a first transistor, wherein a semiconductor layer of the first transistor is located in the first functional layer, a gate electrode of the first transistor is located in the second functional layer, and a source electrode and a drain electrode of the first transistor are both located in the fourth functional layer.

US Pat. No. 10,115,560

APPARATUS FOR MODIFYING SURFACES OF TITANIUM IMPLANTS MADE OF TITANIUM ALLOY

Sodick Co., Ltd., Kanaga...

1. A metal surface modification apparatus for modifying surfaces of titanium implants made of a titanium alloy, the metal surface modification apparatus comprising:a vacuum chamber configured to accommodate the implants in a vacuum environment;
a transfer unit disposed within the vacuum chamber, and configured to move the implants at least in a first horizontal uniaxial direction and in a second horizontal uniaxial direction perpendicular to the first horizontal uniaxial direction;
a table disposed on the transfer unit, and configured such that the implants are placed thereon;
an electron gun including a cathode electrode, an annular anode electrode configured to generate plasma, and a solenoid configured to generate a magnetic field; and
a tilting unit configured to tilt the implants to a predetermined angle as the transfer unit moves the implants;
wherein the tilting unit further comprises:
a plurality of holding jigs configured to have a plurality of respective lower parts having curved surfaces, respectively, and to hold the implants, respectively;
a movable holding base fastened onto the table, and configured to have a plurality of receiving depressions formed through an upper surface thereof to have curved surfaces corresponding to the curved surfaces of the lower parts of the holding jigs; and
a stationary pushing plate disposed on the movable holding base to cover the movable holding base, and configured to be moved relative to the movable holding base and to have a plurality of through holes positioned to face the receiving depressions.

US Pat. No. 10,115,288

AUTOMATIC BATTERY FLUID REMINDER SYSTEM FOR VEHICLES WITH FLOODED LEAD ACID BATTERIES AND METHOD THEREOF

INGERSOLL-RAND COMPANY, ...

1. A battery fluid level monitoring system comprising:a battery having an internal fluid;
a fluid level monitoring system in operative communication with the battery, wherein the fluid level monitoring system calculates consumption of the internal fluid based on a parameter,
wherein the fluid level monitoring system determines a level of the internal fluid based on the consumption of the internal fluid and compares the level with a predetermined level,
wherein when the level of the internal fluid is equal to or less than the predetermined level the fluid monitoring system communicates a warning; and
a battery charger in operative communication with the battery, and wherein when the level of the internal fluid is greater than the predetermined level the fluid level monitoring system instructs the battery charger to begin charging the battery, and
wherein the fluid level monitoring system measures a duration of the warning and compares the duration with a predetermined duration, wherein when the duration of the warning is greater than the predetermined duration the fluid level monitoring system alters a charge cycle of the battery to reduce the consumption of the internal fluid.

US Pat. No. 10,115,272

ELECTRONIC GAME AND METHOD FOR PLAYING A GAME BASED UPON REMOVAL AND REPLACING SYMBOLS IN THE GAME MATRIX

IGT, Las Vegas, NV (US)

1. A gaming system comprising:a processor; and
a memory device that stores instructions that, when executed by the processor, cause the processor to:
responsive to a placement of a wager, for a play of a game:
randomly select at least two of a plurality of symbols,
cause a display of the randomly selected symbols at a plurality of symbol display positions,
determine whether said displayed randomly selected symbols form any of a plurality of winning symbol combinations, and
responsive to determining that the displayed randomly selected symbols form at least one of the winning symbol combinations, for each formed winning symbol combination:
independent of any player input to reposition any of the displayed randomly selected symbols, remove at least one of the displayed randomly selected symbols that forms that winning symbol combination, and
for each removed symbol:
 select one of the plurality of symbols as a replacement for that removed symbol, and
 cause a display of that selected symbol.

US Pat. No. 10,115,098

INVOICELESS TRADING AND SETTLEMENT METHOD AND SYSTEM

FAST 101 PTY LTD, Victor...

1. A computer implemented method, the method comprising:receiving, on an authorization date and by a server, an electronic authorization, the electronic authorization relating to an invoice between a customer and a supplier, the electronic authorization authorizing payment for the invoice, the invoice comprising an invoice amount and an invoice due date, the invoice due date being after the authorization date;
based on the electronic authorization, a funds provider electronically transferring to a supplier account, on an early payment date, the early payment date being before the invoice due date, a discounted payment amount for settlement of the invoice, the discounted payment amount discounted from the invoice amount based at least on:
one or more fiscal attributes of the customer; and
a credit period, the credit period being an amount of time between the early payment date and the invoice due date; and
after the credit period, electronically debiting a customer payment from an account associated with the customer, wherein the customer payment is at least the discounted payment amount.

US Pat. No. 10,115,087

EVENT-TRIGGERED BUSINESS-TO-BUSINESS ELECTRONIC PAYMENT PROCESSING APPARATUSES, METHODS AND SYSTEMS

VISA INTERNATIONAL SERVIC...

1. A business-to-business transaction processing processor-implemented method, comprising:obtaining, by a processor, a purchase payment request having a processor-executable link from a user triggering event indication, said user triggering event indication being received upon user instantiation of a web-enabled device at a B2B/Pay platform of a first business entity, said user triggering event indication comprises a business-to-business payment event indication, said first business entity being different from the user, said web-enabled device providing user interface elements for the user to interact with user interface elements provided by the B2B/Pay platform;
determining, by the processor, in response to executing the processor-executable link a second business entity sponsoring the purchase payment request in response to parsing the purchase payment request, said second business entity being different from the first business entity and the user, said determining comprises receiving an instruction in response to a selection from the user for the second business entity on the web-enabled device;
obtaining, by the processor, purchase sponsoring instructions provided by the second business entity, said obtained purchase sponsoring instructions comprising verifying payment eligibility data of the user;
determining, by the processor, a payment sponsoring amount from the second business entity to the first business entity in response to the obtained purchase sponsoring instructions and the purchase payment request;
generating, by the processor, a business-to-business financial transaction request for the second business entity to transfer the determined payment sponsoring amount to the first business entity;
initiating, by the processor, a business-to-business financial transaction between the second business entity to the first business entity in response to the received user triggering event indication by sending the generated business-to-business financial transaction request to the second business entity;
receiving, by the processor, a payment amount adjudication indication from the second business entity;
retrieving, by the processor, account details of a first bank account of the first business entity and a second bank account of the second business entity, said first bank account being different from the second bank account and being different from a user bank account of the user; and
transacting, by the processor, the adjudicated payment amount from the second bank account of the second business entity to the first bank account of the first business entity.

US Pat. No. 10,115,083

CAMERA ACTIVATION AND IMAGE PROCESSING FOR TRANSACTION VERIFICATION

Capital One Services, LLC...

1. A device, comprising:one or more memories; and
one or more processors, communicatively coupled to the one or more memories, to:
receive, from a transaction terminal, first information related to a transaction, the transaction being completed via the transaction terminal;
identify, based on receiving the first information, a user device;
provide, to the user device, a notification relating to the transaction, the notification causing:
the user device to activate a camera associated with the user device, and
the user device to initiate a timer that provides an indication of an amount of time relating to capturing an image of a receipt associated with the transaction;
receive, from the user device, the image of the receipt;
process the image of the receipt to perform an analysis of the transaction; and
perform an action related to the transaction based on a result of processing the image of the receipt.

US Pat. No. 10,115,064

BUSINESS STORYBOARDING

SUGARCRM INC., Cupertino...

1. A storyboard generation method comprising:defining and persisting into memory of a computer, a template specifying a collection of visualizations in a storyboard, each visualization being generated based upon different data objects in an enterprise application for a business and each visualization reflecting a performance aspect of the business;
partitioning the template into frames of a sequence;
generating the storyboard by creating each of the visualizations specified by the template based upon data objects of the enterprise application and allocating in the storyboard, a larger portion for visualizations that reflect an excess of performance beyond a threshold level and visualizations that reflect a dearth of performance below a threshold level, and a smaller portion for visualizations that reflect a nominal performance relative to a threshold level;
formatting the storyboard as a slideshow with each slide corresponding to one of the frames; and,
saving the storyboard into fixed storage of the computer for subsequent playback.

US Pat. No. 10,115,047

TRANSACTION CARD WITH SECURED MAGNETIC STRIP AND METHOD FOR MAKING THE SAME

Capital One Services, LLC...

1. A transaction card comprising:a card inlay having an outer surface and an inner surface opposite thereto;
a first data storage component having a first surface and a second surface opposite thereto;
a card body comprising an outer surface and an inner surface opposite thereto; and
a window formed in the transaction card and housing the first data storage component;
wherein the card inlay is joined to the card body such that:
the outer surface of the card inlay substantially forms a first outer surface of the transaction card and the outer surface of the card body forms a second outer surface of the transaction card;
a portion of the inner surface of the card inlay contacts a reflective material positioned between the inner surface of the inlay and the inner surface of the body; and
the first data storage component is exposed through the window.

US Pat. No. 10,115,039

METHOD AND SYSTEM FOR MACHINE LEARNING BASED CLASSIFICATION OF VASCULAR BRANCHES

Siemens Healthcare GmbH, ...

1. A method for machine learning based classification of vascular branches to distinguish falsely detected branches from true branches, comprising:sampling a plurality of overlapping fixed size branch segments from one or more branches of a detected centerline tree of a target vessel extracted from a medical image of a patient;
extracting a plurality of 1D profiles along each of the plurality of overlapping fixed size branch segments;
calculating a probability score for each of the plurality of overlapping fixed size branch segments based on the plurality of 1D profiles using a trained deep neural network classifier;
assigning a final probability score to each of a plurality of centerline points in the one or more branches of the detected centerline tree of the target vessel based on the probability scores of the overlapping fixed size branch segments containing that centerline point; and
pruning the one or more branches of the detected centerline tree of the target vessel based on the final probability scores of the plurality of centerline points in the one or more branches of the detected centerline tree of the target vessel to remove falsely detected branches from true branches in the one or more branches of the detected centerline tree of the target vessel.

US Pat. No. 10,115,034

METHOD AND SYSTEM FOR PROJECTING IMAGE WITH DIFFERING EXPOSURE TIMES

LIFE TECHNOLOGIES HOLDING...

1. A computer implemented method for generating a projected image at an optimal exposure time, comprising:capturing a plurality of images with each image captured at a different exposure time;
assessing each image of the plurality of images and selecting pixels that have intensity values that satisfy an intensity threshold percentage for each image, wherein the intensity threshold percentage is a percentage of pixels included in the image with each pixel included in the percentage of pixels having an intensity value that is higher than an intensity value for each pixel that is excluded from the percentage of pixels;
evaluating whether the intensity values of the selected pixels are distributed above a lower intensity threshold and below an upper intensity threshold;
determining whether a linear relationship exists for the intensity values between each of the captured images for which the intensity values of the selected pixels are above the lower intensity threshold and below the upper intensity threshold, wherein the determining whether the linear relationship exists comprises:
determining a theoretical linear relationship between a first image with a first exposure time duration and a second image with a second exposure time duration, wherein the first exposure time duration is shorter than the second exposure time duration;
projecting the linear relationship to determine an optimal exposure time that has an exposure time duration that exceeds each exposure time duration associated with each of the captured images when the linear relationship exists between each of the captured images, wherein the optimal exposure time is based upon a pixel intensity saturation level threshold; and
generating a projected image associated with the optimal exposure time from one or more of the captured images; and
determining whether each image that has an exposure time duration that is between the first exposure time duration of the first image and the second exposure time duration of the second image is within a threshold distance of the theoretical linear relationship.

US Pat. No. 10,114,955

INCREASING SEARCH ABILITY OF PRIVATE, ENCRYPTED DATA

Visa International Servic...

1. A method for searching a database to obtain data, comprising:receiving, by a computer database system, a request for data comprising a search string;
determining a search column of a first table indicated in relation to the search string, the first table storing plaintext data of a particular type of personally identifiable information (PII) within the search column;
searching the search column of the first table of the computer database system using the search string to identify a matching string, wherein the first table includes an encrypted foreign key for each field, and the matching string is identified from the plaintext data;
obtaining at least one encrypted foreign key corresponding to the matching string identified using the search string;
sending the at least one encrypted foreign key to a decryption engine executing on one or more processors of the computer database system;
receiving from the decryption engine, at least one decrypted foreign key corresponding to the at least one encrypted foreign key, wherein the decrypted foreign key is generated by the decryption engine using a decryption key unique to the first table;
searching a second table of the computer database system using the at least one decrypted foreign key to obtain encrypted data, wherein the encrypted data comprises a different second type of PII;
sending the encrypted data to the decryption engine to decrypt the encrypted data; and
receiving, from the decryption engine, decrypted data resulting from decryption of the encrypted data, wherein the decrypted data comprises the requested data.

US Pat. No. 10,114,942

INTERACTIVE CAPTCHA

PAYPAL, INC., San Jose, ...

1. A system, comprising:a non-transitory memory; and
one or more hardware processors coupled to the non-transitory memory and configured to read instructions from the non-transitory memory to cause the system to perform operations comprising:
receiving a request from a user device;
generating obfuscated instructions to be presented on the user device;
constructing a media object that contains a plurality of media components that interact with each other and create a solvable puzzle, wherein the solvable puzzle is culturally relevant to a determined country associated with the user device;
transmitting the media object and the obfuscated instructions to the user device for display;
transmitting media instructions on how to solve the solvable puzzle and a prompt to solve the solvable puzzle to the user device for display;
receiving a description of an action performed by a user on the user device in response to the prompt;
determining, based on the description of the action performed by the user, that the user is human; and
granting the request in response to determining that the user is human.

US Pat. No. 10,114,938

SECURE ELECTRONIC LOCK

UTC FIRE AND SECURITY AME...

1. A method for simulating an operation of a mechanical lock in an electronic context, comprising:applying a contactless wireless credential to a lock;
authenticating the credential;
unlocking the lock to provide access to a resource protected by the lock based on having authenticated the credential;
determining a security level associated with the lock; and
conditionally capturing the credential based on the security level, wherein conditionally capturing the credential comprises revoking the credential until a re-lock status of the lock is indicated;
wherein conditionally capturing the credential comprises when a low security level is associated with the lock, the credential is not captured;
wherein conditionally capturing the credential comprises when a security level greater than the low security level is associated with the lock, the credential is captured to restrict access to a second resource during a time when the credential is captured;
determining that the lock is relocked subsequent to unlocking the lock;
based on determining that the lock is relocked, releasing the credential when the credential was captured.

US Pat. No. 10,114,654

METHOD OF BOOTING A PRODUCTION COMPUTER SYSTEM

Fujitsu Technology Soluti...

1. A method of booting a production computer system comprising:establishing a connection between a key computer system and the production computer system;
transmitting at least one specified program by the key computer system to the production computer system;
executing said specified program in the production computer system;
gathering information about system data of the production computer system by the executed program;
transmitting the information about the system data of the production computer system to the key computer system;
comparing the gathered information with comparison information stored in the key computer system;
automated transmitting of a passphrase from the key computer system to the production computer system to decrypt encrypted file system data on a medium within the production computer system if the comparison is successful;
decrypting the encrypted file system data on the medium by the passphrase; and
loading the decrypted file system data and booting the production computer system,
wherein the key computer system transmits at least one specified program to the production computer system and executes said program in the production computer system, and the information about the system data of the production computer system is gathered by the program and transmitted to the key computer program.

US Pat. No. 10,114,566

SYSTEMS, DEVICES AND METHODS USING A SOLID STATE DEVICE AS A CACHING MEDIUM WITH A READ-MODIFY-WRITE OFFLOAD ALGORITHM TO ASSIST SNAPSHOTS

AMERICAN MEGATRENDS, INC....

1. A computer-implemented method for offloading read-modify-write (RMW) operations on a volume of a data storage system to a caching medium for the data storage system, comprising:providing an SSD cache including a plurality of cache lines;
providing a data structure including a plurality of buckets for managing the SSD cache;
providing a plurality of cache headers for managing the cache lines, each cache header associating a cache line and a corresponding data block of the volume;
maintaining one or more of the cache headers for one or more of the cache lines that cache data for a same chunk of the volume as a group within a same bucket of the data structure;
creating a snapshot of the volume;
after creating the snapshot of the volume, receiving a write I/O operation directed to a portion of the same chunk of the volume;
allocating a new RMW header for at least one of the cache lines that cache new data for the write I/O operation;
maintaining the new RMW header in a new group within one of the buckets of the data structure;
performing the write I/O operation on the SSD cache by writing the new data to the at least one of the cache lines;
allocating an old RMW header for the group of the cache headers for the cache lines that cache data for the same chunk of the volume;
maintaining the old RMW header with the group of the cache headers for the cache lines that cache data for the same chunk of the volume; and
providing a link between the new and old RMW headers.

US Pat. No. 10,114,553

METHOD AND DEVICE FOR SCHEDULING VIRTUAL DISK INPUT AND OUTPUT PORTS

Alibaba Group Holding Lim...

1. A method for scheduling virtual disk input and output (I/O) ports, comprising:assigning a set of service quality ratings to a corresponding set of virtual disk I/O ports based on a set of reading-writing bandwidth quotas associated with the corresponding set of virtual disk I/O ports in a physical machine;
determining a total forecast value of a data bandwidth to be used by reading-writing requests within a current time segment and determining virtual disk I/O ports corresponding to the reading-writing requests, comprising:
determining a sum of data bandwidth generated by previous reading-writing requests within a previous time segment; and
determining the total forecast value within the current time segment based on the sum of data bandwidth generated by the previous reading-writing requests within the previous time segment, comprising:
generating a random value corresponding to the total forecast value within the current time segment;
determining whether a difference between an actual statistical bandwidth value and the random value is less than or equal to a threshold, the threshold relating to a preset value, the actual statistical bandwidth value relating to the previous reading-writing requests within the previous time segment; and
in response to a determination that the difference is less than or equal to the threshold, increasing the random value based on the actual statistical bandwidth value;
allocating reading-writing bandwidth limits to the virtual disk I/O ports corresponding to the reading-writing requests based at least in part on the total forecast value of the data bandwidth and the service quality ratings corresponding to the virtual disk I/O ports corresponding to the reading-writing requests; and
scheduling virtual disk I/O ports on the physical machine based at least in part on actual bandwidths to be used by the reading-writing requests within the current time segment and the reading-writing bandwidth limits for the virtual disk I/O ports corresponding to the reading-writing requests.

US Pat. No. 10,114,548

SYNCHRONOUS DYNAMIC RANDOM ACCESS MEMORY (SDRAM) DEVICE, MEMORY CONTROLLER FOR SAME, AND METHOD OF OPERATING SAME

SAMSUNG ELECTRONICS CO., ...

1. A synchronous dynamic random access memory (SDRAM) device comprising:a memory cell array; and
a control logic to
receive an active command during 2*N clock cycles, the N being an integer and 2*N clock cycles indicating doubled N clock cycles, the active command including a first portion and a second portion, the first portion and the second portion being received consecutively in a first mode, and being received separately in a second mode;
receive a CAS command during N clock cycles, the CAS command being received between the first portion and the second portion of the active command in the second mode; wherein a CAS command to CAS command delay (tCCD) is 3*N clock cycles in the first mode and the tCCD is 2*N clock cycles in the second mode respectively, the tCCD is a minimally required delay between two successive CAS commands.

US Pat. No. 10,114,482

COLOR CONTROL

Microsoft Technology Lice...

1. A system comprising:a stylus; and
a computing device, comprising:
a processor; and
a computer-readable storage medium storing instructions which, when executed by the processor, cause the processor to:
at a first time, receive a user input associating a specific data item with a specific color;
at a second time:
receive the specific color from the stylus;
responsive to receiving the specific color from the stylus, retrieve the specific data item that was associated with the specific color by the user input at the first time; and
display the specific data item on the computing device,
the stylus being configured to capture the specific color from a physical object.

US Pat. No. 10,114,475

POSITION DETECTION SYSTEM AND CONTROL METHOD OF POSITION DETECTION SYSTEM

SEIKO EPSON CORPORATION, ...

1. A position detection system comprising:a light emitting apparatus that emits detection light to a detection area for detecting an indication position of an indicator; and
a position detection apparatus that includes:
an imaging portion that captures an image of the detection area, and
a position detection portion that:
detects light from the indicator based on data of the image captured by the imaging portion,
detects the indication position of the indicator in the detection area, and
determines whether the indicator is a light emitting indicator that emits light or an indicator that does not emit light, wherein the light emitting apparatus is turned on and off repeatedly, and when the indication position of the indicator is detected White the light emitting apparatus is turned off, the position detection portion determines that the indicator is the light emitting indicator.

US Pat. No. 10,114,467

SYSTEMS AND METHODS FOR PROCESSING IMAGE INFORMATION

Photopotech LLC, Mariett...

1. A method for processing image information, the method comprising:receiving a first data set representative of a cross-polarized image of a scene, wherein subject matter is illuminated to substantially avoid shadows in the cross-polarized image to provide a diffuse surface texture;
receiving a second data set representative of a co-polarized image of substantially the same scene illuminated to substantially avoid shadows in the co-polarized image; and
performing a difference blend operation with the first data set and the second data set to provide an isolated-specular surface texture,
wherein an image-capture system applies a first illumination power to illuminate the scene in coordination with an exposure that generates the cross-polarized image,
wherein the image-capture system applies a second illumination power different from the first illumination power to illuminate the scene in coordination with a second exposure that generates the co-polarized image,
wherein an elapsed time between separate exposures that generates the cross-polarized image and the co-polarized image is controlled.

US Pat. No. 10,114,435

METHOD AND APPARATUS TO CONTROL CURRENT TRANSIENTS IN A PROCESSOR

Intel Corporation, Santa...

1. A processor comprising:at least one core including a first core, the first core comprising:
an execution unit;
counter logic to determine a first plurality of sums of power weights of a first plurality of instructions to be executed by the execution unit in a first time window, wherein each instruction is assigned a corresponding power weight that is determined independent of an instruction width of the corresponding instruction; and
control logic to:
categorize each sum of the first plurality of sums of power weights to increment a plurality of bin counters, each bin counter corresponding to one of a first plurality of thresholds;
for each bin counter of the plurality of bin counters, multiply a count of the bin counter by the threshold corresponding to the bin counter to obtain a product associated with the bin counter;
sum the products associated with the plurality of bin counters to determine a value of a first current protection license request for the first core based on the first plurality of bin counters; and
request the first current protection license for the first core using the determined value.

US Pat. No. 10,114,425

PORTABLE ELECTRONIC DEVICE

ASUSTEK COMPUTER INC., T...

1. A portable electronic device, comprising:a body, including a first engaging surface and a first groove, and an opening of the first groove is formed at the first engaging surface;
a stationary magnetic element, disposed at a periphery of the first groove; and
a base, including:
a bottom plate;
a connecting element, disposed on the bottom plate and including a second engaging surface and a second groove, and the opening of the second groove is formed on the second engaging surface;
a rotatable magnetic element, pivotally connected with the second groove, wherein one end of the rotatable magnetic element is adapted to rotate out or rotate in the second groove, when a distance between the first engaging surface and the second engaging surface is less than a predetermined value, and the opening of the first groove faces to the opening of the second groove, the rotatable magnetic element is attracted by the stationary magnetic element to rotate out of the second groove and get into the first groove; and
an auxiliary magnetic element disposed on the other end of the rotatable magnetic element configured such that the other end of the rotatable magnetic element rotates toward the second groove under a magnetic repulsion force between the auxiliary magnetic element and the rotatable magnetic element.

US Pat. No. 10,114,421

ELECTRONIC DEVICE

PEGATRON CORPORATION, Ta...

1. An electronic device, comprising:a case, comprising a plurality of first components and a plurality of second components; the first components and the second components arranged alternately and pivoted each other; the first component comprising an accommodating slot, and the second component comprising a connecting part, at least one curved part, and at least one protrusion; the curved part connected to the connecting part and received in the accommodating slot of the adjacent first component, and the protrusion arranged at a side of the curved part opposite to a side connected to the connecting part; the first component and the second component being capable of pivoting in response to bending of the case to make the first component move relative to the second component between the connecting part and the protrusion to change a region where the curved part is received in the accommodating slot;
a flexible display panel, assembled with the case; and
at least one flexible circuit board, electrically connected to the flexible display panel and arranged in the case.

US Pat. No. 10,114,420

FLEXIBLE SCREEN EXTENSION STRUCTURE, FLEXIBLE SCREEN ASSEMBLY, AND TERMINAL

SHENZHEN ROYOLE TECHNOLOG...

1. A flexible screen extension structure, comprising:a first panel comprising a first guiding mechanism;
a first sliding element slidably connected to the first guiding mechanism along a first direction, wherein under the guide of the first guiding mechanism, the first sliding element is slidable to a first position where the first sliding element is overlapped with the first panel, and to a second position where the first sliding element is at least partially misaligned with respect to the first panel;
a second panel comprising a second guiding mechanism;
a second sliding element slidably connected to the second guiding mechanism along a second direction, wherein under the guide of the second guiding mechanism, the second sliding element is slidable to a third position where the second sliding element is adjacent to the first panel, and to a fourth position where the second sliding element is far away from the first panel, and the second direction is parallel to the first direction; and
a first elastic element arranged between the first sliding element and the second sliding element;
wherein, when the first sliding element is located in the first position and the second sliding element is located in the fourth position, the first panel and the second panel are overlapped with each other, and the first elastic element provides an elastic force to cause the first sliding element and the second sliding element to get close to each other in a direction from the first panel towards the second panel; when the first sliding element is located in the second position and the second sliding element is located in the third position, the first panel and the second panel are kept side by side under the effect of the elastic force.

US Pat. No. 10,114,410

COVER

ASUSTEK COMPUTER INC., T...

1. A cover, adapted to an electronic device, the cover comprising:a first plate including a plurality of sub-plate areas, a plurality of crease areas and at least a flexible area, the plurality of sub-plate areas and the plurality of crease areas are alternately disposed on the first plate;
a second plate connected to the flexible area of the first plate;
an input device disposed on the second plate;
a connecting base disposed on the flexible area adjacent to the second plate, and
a plurality of fixing components disposed on at least one of the first plate and the second plate, wherein the plurality of fixing components includes at least one first fixing component disposed on the first plate and a plurality of seventh fixing components disposed on the connecting base, the connecting base and the electronic device are fixed to each other;
wherein the first plate is folded along at least one of the crease area to make the cover in a first state, in the first state, the seventh fixing components are fixed to the first fixing components, and wherein the first plate turns over relative to the second plate to make the cover in a second state.

US Pat. No. 10,114,391

LOW-NOISE HIGH EFFICIENCY BIAS GENERATION CIRCUITS AND METHOD

pSemi Corporation, San D...

1. An apparatus for generating a steady state positive voltage signal (PVS) and a steady state negative voltage signal (NVS), including:a bias signal generation module (BSGM) for generating a steady state reference voltage signal (RVS), the RVS having a voltage level less than the PVS;
a positive signal generation module (PSGM) generating the PVS, the PSGM including a first capacitor, the PSGM employing the first capacitor to generate a portion of the PVS based on the RVS; and
a negative signal generation module (NSGM) generating the NVS, the NSGM including a second capacitor, the NSGM employing the second capacitor to generate a portion of the NVS based on the RVS.

US Pat. No. 10,114,354

PERSONAL GROOMING APPLIANCE

BRAUN GMBH, Kronberg (DE...

1. A packaged personal grooming appliance unit, in combination with a packaging that at least partly houses the personal grooming appliance, comprising a personal grooming appliance includingan energy source;
an electronic circuit comprising at least one electric load;
a first sensor for providing a first signal indicating a relevant change of a first external condition;
wherein the personal grooming appliance is arranged to stay in a sleep mode in which the electronic circuit consumes at least a reduced average energy amount in comparison to an active mode and to initiate the active mode when the first signal indicating a change of the first external condition is received;
wherein the electronic circuit is arranged to perform a welcome routine in response to a first active mode initialization and a standard routine, different from the welcome routine, in response to receiving the first signal indicating a relevant change in the first external condition after the welcome routine has been performed, and
wherein the first sensor is sensitive to a change of the packaging condition comprising at least an opening of the packaging.

US Pat. No. 10,114,255

DISPLAY APPARATUS

Sakai Display Products Co...

1. A display apparatus including a liquid crystal panel having a plurality pixels arranged in a matrix shape, in which the plurality of pixels each has a first subpixel and a second subpixel that are divided from each other, the display apparatus comprising:a controller configured to control a level of brightness values of the first subpixel and the second subpixel of any one pixel of the plurality of pixels so as to be switched at a prescribed period, wherein, when a gradation value of any one pixel of the plurality of pixels is lower than a prescribed value, the controller controls so that the brightness values of the first subpixel and the second subpixel of the pixel are equal to each other.

US Pat. No. 10,114,240

SPRAYING DEVICE AND COATING METHOD

BOE TECHNOLOGY GROUP CO.,...

1. A coating method, in which a first spray unit and a second spray unit are adopted, comprising:during coating, advancing the first spray unit and the second spray unit in the same direction, wherein the second spray unit is arranged directly behind the first spray unit in the advancing direction;
spraying a first solution on a surface of a substrate with the first spray unit, wherein the first solution is used for wetting the surface of the substrate, and wherein the first spray unit comprises a plurality of first nozzles, the first nozzles are flat and are arranged in a horizontal direction, and the first spray unit is configured to spray by repeating a fan pattern linearly in the horizontal direction; and
spraying a second solution with the second spray unit in a region of the surface of the substrate on which the first solution has been sprayed, wherein the second solution is used for coating the surface of the substrate, and wherein the second spray unit comprises a plurality of second nozzles, the second nozzles are arranged into two rows in the horizontal direction, the second nozzles in one of the rows are offset with respect to the second nozzles in the other row, and the second spray unit is configured to spray linearly in a longitudinal direction.

US Pat. No. 10,114,216

MINIMALLY INVASIVE LENS CLEANER

C-CLEAR LLC, Midvale, UT...

1. A cleaning device for cleaning a lens of an endoscope, the cleaning device comprising:a sleeve comprising an inner surface configured to engage a medical device;
a first tab linearly extending outward from a first longitudinal end of the sleeve at an inclined angle ranging from 45° to 80° with respect to the first longitudinal end, and a second tab linearly extending outward from a second longitudinal end of the sleeve at an inclined angle ranging from 45° to 80° with respect to the second longitudinal end, the first and second longitudinal ends being located on opposite ends of the sleeve, and wherein the first and second tabs are only partially coterminous with the sleeve; and
a pad secured around the sleeve and configured to wipe the lens, wherein the cleaning device does not include a reservoir for cleaning fluid.

US Pat. No. 10,114,141

SUBSURFACE RESISTIVITY MODELING WITH ELECTROMAGNETIC FIELDS USING A CONDUCTIVE CASING

GroundMetrics, Inc., San...

1. A method for conducting an electromagnetic survey of subsurface targets of interest by calculating AC electromagnetic fields below an earth surface comprising:modeling the earth below the earth surface using a known distribution of electrical resistivity, or a representative approximation of the electrical resistivity distribution derived from current or historical data, to form a subsurface model;
transmitting current from a source, at least in part, along a conducting casing of a borehole to produce a primary electromagnetic field, said field being a DC electric field;
calculating the primary electromagnetic field produced by the casing to determine a casing model and then create an equivalent electromagnetic source based on the casing model;
representing the casing within the subsurface model with the equivalent electromagnetic source embedded in the subsurface model, wherein the casing is removed from the subsurface model and the equivalent electromagnetic source is located where the casing was located;
calculating the AC electromagnetic fields produced by the equivalent electromagnetic source; and
determining a depth, thickness or lateral extent of the target of interest based on the AC electromagnetic fields produced by the equivalent electromagnetic source.

US Pat. No. 10,114,064

ERROR DETECTION DEVICE

PANASONIC INTELLECTUAL PR...

1. An abnormality detection device comprising:a coupling capacitor including:
a first end; and
a second end to be coupled with a high-voltage circuit;
a signal output unit which outputs an alternating-current inspection signal, the signal output unit being coupled with the first end of the coupling capacitor via a detection resistor;
a signal extraction unit which extracts the inspection signal as an extraction signal, the inspection signal being output between the detection resistor and the coupling capacitor; and
a signal input unit which receives the extraction signal and detects an abnormality of insulation resistance of the high-voltage circuit based on a level of the received extraction signal,
wherein the signal extraction unit includes:
a signal removing filter which removes a signal equal in frequency to the inspection signal, and passes, through the signal removing filter, a low-frequency noise lower in frequency than the inspection signal; and
a subtraction circuit which outputs a differential signal as the extraction signal, the differential signal being a difference between a signal having been passed through the signal removing filter and a signal not having been passed through the signal removing filter, and
wherein the signal removing filter is a low-pass filter which removes the signal equal in frequency to the inspection signal and passes the low-frequency noise through the signal removing filter.

US Pat. No. 10,114,037

SYSTEMS AND METHODS FOR CURRENT AND VOLTAGE MONITORING

SCHNEIDER ELECTRIC IT COR...

1. A cable, comprising; a plug at a first end of the cable; a socket at a second end of the cable; first and second conductors extending from the plug to the socket; a current and voltage, monitoring module coupled to the first and the second conductors and configured to measure current and voltage levels of the conductors; a transceiver coupled to the current and voltage monitoring, module, configured to receive data related to the current and voltage levels and transmit the data related to the current and voltage levels; and a housing configured to house the current and voltage monitoring module, the transceiver, and one of the socket and the plug, wherein the current and voltage monitoring module is configured to cycle between a sleep mode and a wake mode, and in a first wake mode cycle determine if received data related to current and voltage levels has changed by a predetermined amount, and in response to the change in current and voltage levels being over the predetermined amount, provide the received data to the transceiver for transmission by the transceiver in a next wake mode cycle.

US Pat. No. 10,113,985

ACTIVE MATRIX DEVICE AND METHOD OF DRIVING

Sharp Life Science (EU) L...

1. An active matrix electro-wetting on dielectric (AM-EWOD) device comprising:a plurality of array elements arranged in an array of rows and columns, each of the array elements including array element circuitry, an element electrode, and a reference electrode;
wherein the array element circuitry comprises an actuation circuit that applies actuation voltages to the element and reference electrodes for actuating the array element, and an impedance sensor circuit that senses impedance at the array element electrode to determine a droplet property at the array element; and
wherein the actuation circuitry comprises a memory part including a memory capacitor for storing voltage data corresponding to either an actuated state or an unactuated state of the array element, and an input signal applied to the memory capacitor effects an operation of the impedance sensor circuit;
the actuation circuit comprising a first transistor, the memory capacitor, and a second transistor; wherein:
a drain of the first transistor is connected to an input DATA line, a gate of the first transistor is connected to an input ENABLE line, and a source of the first transistor is connected to a gate of the second transistor;
the memory capacitor is connected between the gate of the second transistor and a row select line; and
a drain of the second transistor is connected to an input actuation signal, and a source of the second transistor is connected to the impedance sensor circuit and the element electrode.

US Pat. No. 10,113,979

SYSTEMS, PROBES, AND METHODS FOR DIELECTRIC TESTING OF WINE IN BOTTLE

THE TRUSTEES OF DARTMOUTH...

1. A probe for radio-wave interrogation of wine in a bottle, comprising:an inner conductor;
an outer conductor coaxial with the inner conductor, the outer conductor being spaced apart from the inner conductor by a dielectric material; and
a concave open end configured to interface with a convex exterior surface of the bottle during said radio-wave interrogation, the concave open end including an end face of the inner conductor and an end face of the outer conductor, curvature of the concave open end matching curvature of the convex exterior surface.

US Pat. No. 10,113,961

APPARATUS AND METHOD FOR QUANTITIVE PHASE TOMOGRAPHY THROUGH LINEAR SCANNING WITH COHERENT AND NON-COHERENT DETECTION

ECOLE POLYTECHNIQUE FEDER...

1. An apparatus for performing quantitative phase tomography on a specimen, comprising:an illumination source for providing an illuminating beam;
a condenser lens having an optical axis direction arranged to transform the illuminating beam into a convergent illuminating beam;
a microscope objective arranged to collect a beam that is back-scattered by the specimen, the illumination source arranged to illuminate the specimen from a same side as the beam collected by the microscope objective; and
a wave front analyzer for analyzing a wave field amplitude and phase of the beam back-scattered by the specimen, the wave front analyzer including,
an array sensor for measuring an intensity of the beam back-scattered by the specimen and collected by the microscope objective, and outputting a measurement signal,
a displacement device to move the specimen in a plane normal to the optical axis direction, and
a processing device configured to process the measurement signal output by the array sensor to deliver quantitative phase tomography images representing the specimen in three dimensions based on the beam back-scattered by the specimen, and to provide quantitative values of a refractive index distribution.

US Pat. No. 10,113,959

TERAHERTZ WAVE GENERATING DEVICE AND SPECTROSCOPIC DEVICE USING SAME

Hitachi High-Technologies...

1. A terahertz wave generating device comprising:a fixed-wavelength pump optical laser that generates a single wavelength pump beam;
a variable-wavelength laser that emits a seed beam and is capable of making the wavelength of the seed beam variable;
a delay element that delays pulses of the pump beam;
a first non-linear crystal that generates terahertz waves by receiving the seed beam, a first pump beam that is not delayed by the delay element, and a second pump beam that is delayed by the delay element; and
a control portion which controls the wavelength of the seed beam output from the variable-wavelength laser in accordance with the time by which the second pump beam is delayed by the delay element.

US Pat. No. 10,113,872

MICRO-ELECTRO-MECHANICAL DEVICE WITH COMPENSATION OF ERRORS DUE TO DISTURBANCE FORCES, SUCH AS QUADRATURE COMPONENTS

STMicroelectronics S.r.l....

1. A gyroscope comprising:a substrate;
elastic elements;
a drive system; and
a plurality of movable mass systems elastically coupled to the substrate and the drive system by the elastic elements, the plurality of movable mass systems being configured to be driven by the drive system, each of the plurality of movable mass systems including:
a suspended mass configured to be subjected to disturbance forces; and
a damping mass coupled to the suspended mass by elastic elements and configured to resonate at its natural frequency in response to the respective movable mass systems being driven by the drive system, the damping mass being configured to reduce movements of the suspended mass due to the disturbance forces.

US Pat. No. 10,113,860

INSPECTING A MULTILAYER SAMPLE

APPLEJACK 199, L.P., Mil...

1. A method for inspecting a multilayer sample, the method comprising:(b) emitting light from a broadband light source;
(c) receiving, at a beam splitter, the light and splitting, at the beam splitter, the light into first and second portions;
(d) directing, from the beam splitter, the first portion of the light toward a multilayer sample positioned a first optical distance from the beam splitter;
(e) directing, from the beam splitter, the second portion of the light onto a reflector positioned a second optical distance from the beam splitter;
(f) combining, at the beam splitter, the first portion of the light after being reflected from the multilayer sample and the second portion of the light after being reflected from the reflector;
(g) directing, from the beam splitter, the combined light toward a system for analyzing Fabry-Perot fringes;
(h) receiving, at a computer-controlled etalon filter included in the system for analyzing Fabry-Perot fringes, the combined light, filtering the combined light at the computer-controlled etalon filter, directing, from the computer-controlled etalon filter, the filtered light over a single-mode optical fiber, receiving, at a computer-controlled spectrograph included in the system for analyzing Fabry-Perot fringes, the filtered light over the single-mode optical fiber, and spectrally analyzing the filtered light using the computer-controlled spectrograph to determine a value of a total power impinging a slit of the system for analyzing Fabry-Perot fringes;
(i) determining an optical path difference (OPD) between an optical path of the first portion of the light and an optical path of the second portion of the light;
(j) recording an interferogram that plots the value versus the OPD for the OPD;
(k) performing (b)-(j) one or more additional times after decreasing the first optical distance by moving the multilayer sample closer to the beam splitter resulting in a different OPD; and
(l) using the interferogram for each of the different OPDs to determine the thicknesses and order of the layers of the multilayer sample.

US Pat. No. 10,113,847

ARM-FIRE DEVICE AND METHOD OF IGNITING PROPULSION SYSTEM USING THE SAME

AGENCY FOR DEFENSE DEVELO...

1. An arm-fire device comprising:a capacitor charged by an arming signal;
an acceleration switch for generating an operation signal if an acceleration more than a predetermined acceleration is sensed;
a controller electrically connected with the capacitor and the acceleration switch, controlling generation of a firing signal by discharging the capacitor when the operation signal and an externally-applied launching signal are all sensed in a state that capacitor is charged; and
a through bulkhead initiator provided with an ignition portion installed at a space separated by a bulkhead and configured to be electrically connected with the controller to ignite the ignition portion if the firing signal is transferred thereto,
wherein the acceleration switch includes:
a stator having a first contact point;
a proof mass accommodated within the stator and supported by an elastic member to be movable with respect to the stator;
a second contact point formed at one side of the proof mass and formed to contact the first contact point if the acceleration more than the predetermined acceleration is applied thereto;
a plurality of first electrode plates formed to be protruded from the stator in a direction crossing a moving direction of the proof mass;
a plurality of second electrode plates formed to be protruded from the proof mass and thus arranged alternately with the first electrode plates along the moving direction of the proof mass;
a base glass coupled to a lower portion of the stator to cover a lower portion of the proof mass; and
a cup glass coupled to an upper portion of the stator to cover an upper portion of the proof mass,
wherein a protrusion protrudes from the cup glass toward a groove formed at the upper portion of the proof mass to be caught in the groove, such that the cup glass and the base glass restrict a displacement of the proof mass.

US Pat. No. 10,113,808

HEAT-DISSIPATING STRUCTURE HAVING SUSPENDED EXTERNAL TUBE AND INTERNALLY RECYCLING HEAT TRANSFER FLUID AND APPLICATION APPARATUS

1. A heat-dissipating structure with internally recycling gaseous heat transfer fluid, comprising:a suspended external tube (101) and at least one inner tube (103) installed within the external tube (101), the external tube (101) having an inner diameter that is larger than an outer diameter of the at least one inner tube (103), a space between the inner diameter of the external tube (101) and the outer diameter of the at least one inner tube (103) forming an exterior fluid path,
wherein the suspended external tube (101) and the at least one inner tube (103) each has a front end and a distal end,
wherein the front end of each of the suspended external tube (101) and the at least one inner tube (103) includes a front tube port through which the gaseous heat transfer fluid passes to or returns from an electric energy application device assembly (108),
wherein the distal end of the external tube (101) is closed and the distal end of the at least one inner tube (103) includes fluid holes or is spaced from the distal end of the external tube (101) to enable the gaseous heat transfer fluid to flow between the exterior fluid path and an interior fluid path within the at least one inner tube (103) and thereby provide a fluid circulation path for circulation of the recycling gaseous heat transfer fluid, and
at least one fluid pump (105) installed in at least one of the at least one exterior fluid path and the interior fluid path to control a flow direction of the gaseous heat transfer fluid in the fluid circulation path,
wherein the electric energy application device assembly (108) includes at least one heat transfer fluid path, a fluid inlet port, and a fluid outlet port, the fluid inlet port being connected to one of the front tube port of the external tube (101) and the front tube port of the inner tube (103), the fluid outlet port being connected to the other of the front tube port of the external tube (101) and the front tube port of the inner tube (103), and the at least one heat transfer fluid path being formed within the electric energy application device assembly (108) according to at least one of the following configurations:
(a) the at least one heat transfer fluid path extends through or past the electric energy application device assembly (108) from said front tube port of the at least one inner tube (103) to the front tube port of the external tube (101),
(b) the at least one heat transfer fluid path extends through or past a heat dissipater (104) of the electric energy application device assembly (108) from said front tube port of the at least one inner tube (103) to the front tube port of the external tube (101),
(c) the at least one heat transfer fluid path of the electric energy application device assembly (108) is connected to at least one heat transfer fluid path of the heat dissipater (104), and the respective heat transfer fluid paths of the electric energy application device (108) and heat dissipater (104) are connected to the respective front tube ports of the at least one inner tube (103) and external tube (101),
(d) the electric energy application device assembly (108) includes at least two internal heat transfer fluid paths (1081), or a U-shaped or L-shaped internal fluid path, connected through external tubes to form a fluid inlet port and a fluid outlet port respectively connected to the front tube ports of the at least one inner tube (103) and external tube (101),
(e) an exterior of the electric energy application device (108) is enclosed within a sealed housing, thereby forming a space between the electric energy application device (108) and the sealed housing to allow fluid to pass, said space being in communication with the front tube ports of the at least one inner tube (103) and the external tube (101) through at least one fluid inlet/outlet port,
(f) a sealed space allowing passage of the gaseous heat transfer fluid is formed between the electric energy application device assembly (108), the heat dissipater (104), and a housing of the electric energy application assembly (108) and the beat dissipater (104), said sealed space being in communication with the front tube ports of the at least one inner tube (103) and the external tube (101) through at least one fluid inlet/outlet port,
(g1) a sealed space allowing passage of the gaseous heat transfer fluid is jointly formed by a matched housing and an exterior of the electric energy application device assembly (108), and the electric energy application device assembly (108) and/or the heat dissipater (104) includes at least one heat transfer fluid path, one end of which is formed with a heat transfer fluid connection port connected to the front tube port of the at least one inner tube (103) and a second end of which is formed with a heat transfer fluid connection port in communication with the sealed space, the sealed space being in communication with the front port of the external tube (101) via a heat transfer fluid connection port of the sealed housing,
(g2) a sealed space allowing passage of the gaseous heat transfer fluid is jointly formed by a matched housing and an exterior of the heat dissipater (104), and the electric energy application device assembly (108) and/or the heat dissipater (104) includes at least one heat transfer fluid path, one end of which is formed with a heat transfer fluid connection port connected to the front tube port of the at least one inner tube (103) and a second end of which is formed with a heat transfer fluid connection port in communication with the sealed space, the sealed space being in communication with the front port of the external tube (101) via a heat transfer fluid connection port of the sealed housing, and
(g3) a sealed space allowing passage of the gaseous heat transfer fluid is jointly formed by a matched housing and an exterior of the electric energy application device assembly (108) and heat dissipater (104), and the electric energy application device assembly (108) and/or the heat dissipater (104) includes at least one heat transfer fluid path, one end of which is formed with a heat transfer fluid connection port connected to the front tube port of the at least one inner tube (103) and a second end of which is formed with a heat transfer fluid connection port in communication with the sealed space, the sealed space being in communication with the front port of the external tube (101) via a heat transfer fluid connection port of the sealed housing,
wherein the gaseous heat transfer fluid pumped by the at least one fluid pump (105) passes through the exterior fluid path to transfer heat from the electric energy application device assembly (108) and/or heat dissipater (104) to an external gaseous environment surrounding the external tube (101),
wherein the electric energy application device assembly (108) includes at least one of an illumination device, a photovoltaic or photoelectric generator device, a wind powered generator, a transformer, and electrical motor, and
wherein the inner tube (103) is made of a thermal insulating material, or the inner tube (103) includes a thermal insulating material on an inside or outside of the inner tube (103), and wherein the external tube (101) is made of a heat conductive material.

US Pat. No. 10,113,776

PACKAGED TERMINAL AIR CONDITIONER UNIT

Haier US Appliance Soluti...

1. A packaged terminal air conditioner unit, comprising:a casing extending between an exterior side portion and an interior side portion;
a compressor positioned within the casing, the compressor operable to compress a refrigerant;
an exterior coil positioned within the casing at the exterior side portion of the casing;
a primary interior coil positioned within the casing at the interior side portion of the casing;
a secondary interior coil positioned within the casing at the interior side portion of the casing;
a reversing valve positioned within the casing, the reversing valve being in fluid communication with the compressor in order to receive compressed refrigerant from the compressor and selectively direct the compressed refrigerant from the compressor;
an ejector configured for combining two or more streams of refrigerant;
a primary loop having a first portion extending between the reversing valve and the exterior coil, a second portion extending between the exterior coil and the ejector, a third portion extending between the ejector and the primary interior coil, and a fourth portion extending between the primary interior coil and the reversing valve;
an auxiliary loop conduit having a first portion extending between the third portion of the primary loop and the secondary interior coil, a second portion extending between the secondary interior coil and the second portion of the primary loop, and a third portion extending between the secondary interior coil and the ejector; and
a check valve coupled to the second portion of the auxiliary loop conduit to prevent refrigerant from flowing from the exterior coil into the secondary interior coil.

US Pat. No. 10,113,771

CARBON DIOXIDE-BASED HEATER

1. A method comprising:providing a quantity of carbon dioxide in gaseous form within an interior volume of a vessel;
wherein the vessel is comprised of walls transparent to infrared radiation; and
contacting the carbon dioxide gas with a heat exchanger disposed within the interior volume of the vessel;
exposing the vessel to solar radiation, wherein the carbon dioxide absorbs radiation in one or more vibration bands of the carbon dioxide, the absorbed radiation obtained from the solar radiation; and
transferring, via the heat exchanger, heat within the first quantity of carbon dioxide produced by collisional thermalization of the absorbed radiation to a heat transfer medium within the heat exchanger and in fluid communication with an external environment of the vessel; and
wherein the vessel comprises a fan disposed within the interior volume, the fan stirring the quantity of carbon dioxide within the interior volume of the vessel.

US Pat. No. 10,113,752

CEILING-EMBEDDED AIR CONDITIONER WITH A BLOWOFF STRUCTURE BLOWING AIR TO ALL DIRECTIONS

FUJITSU GENERAL LIMITED, ...

1. A ceiling-embedded air conditioner comprising:a casing main body embedded in a ceiling;
a decorative panel mounted on a bottom surface of the casing main body;
a turbo fan disposed in the casing main body;
a heat exchanger disposed in the casing main body to surround an outer periphery of the turbo fan;
a drain pan that is disposed in the casing main body along a bottom side of the heat exchanger and includes a foamed resin drain pan main body and a resin drain sheet integrated with the foamed resin drain pan main body on a side of the heat exchanger;
an air suction path that is disposed in a center of the drain pan in a horizontal direction and reaches the turbo fan;
an air blowoff path for conditioned air having passed through the heat exchanger, the air blowoff path being provided at four places along the sides surrounding the air suction path, wherein the sides are parallel to sides of the casing main body;
an air suction opening that is provided in the decorative panel and communicates with the air suction path; and
a rectangular air blowoff opening that is provided in the decorative panel and communicates with the air blowoff path, wherein
the air blowoff path is integrated with the drain pan, as a cuboidal shape having a pair of second side walls disposed with a predetermined space therebetween in parallel to the sides surrounding the air suction path and a pair of first side walls connecting ends of the second side walls, the second side wall being longer than the first side wall,
an airflow guide vane is provided in the air blowoff path to direct part of the blown airflow of the conditioned air toward a first side of the rectangular air blowoff opening,
an attachment portion formed of the same material as that for the drain sheet and configured to attach the airflow guide vane is provided at an inflow-side opening portion of the air blowoff path,
the airflow guide vane includes:
a base plate disposed along the second side walls;
a plurality of guide fins that is vertically erected from a surface of the base plate in parallel to one another with a predetermined space therebetween; and
a lock piece that is provided at an upper end of a back surface of the base plate and is locked in the attachment portion,
the attachment portion has a lock concave formed by recessing, in a thickness direction, part of the inflow-side opening of the air blowoff path, and
the lock piece is housed in the lock concave such that the lock piece is flush with an inflow-side upper end surface of an upper end portion of the air blowoff path.

US Pat. No. 10,113,748

GRIDDLE AND GAS BURNER RANGE HAVING A HEAT BARRIER

BSH Home Appliances Corpo...

1. A griddle and gas burner range, comprising:a griddle comprising an electric heating element, and a griddle plate that is disposed over the electric heating element;
at least one open top gas burner disposed adjacent to the griddle; and
a heat barrier installed between the griddle and the at least one open top gas burner, so as to block the escape of heat from the griddle and into an area of the at least one open top gas burner during operation of the griddle,
wherein the heat barrier comprises an elongated plate disposed in a fire box of the griddle and which extends upward in a height direction to a height above an edge of the fire box,
wherein the heat barrier has a mounting flange on at least one end thereof, and
wherein the mounting flange extends substantially perpendicular from the elongated plate and also extends upward in the height direction.

US Pat. No. 10,113,719

DISPLAY APPARATUS

Sakai Display Products Co...

1. A display apparatus, comprising:a display panel configured to display an image;
a support plate which is disposed on a rear side of the display panel and supports a light source on a front surface of the support plate; and
a support member which is disposed between the support plate and the display panel, which is provided along an edge portion of the support plate, and which includes a square pipe with a rectangular cross section orthogonal to an axial direction of the square pipe,
wherein the square pipe comprises:
a first side part which is fixed at an edge part of the front surface of the support plate;
a second side part which is opposite to the first side part and located close to the display panel;
a third side part which connects the first side part and the second side part; and
a fourth side part which is opposite to the third side part and located closer to a center part of the support plate than the third side part and connects the first side part and the second side part, and
the support member is made up of a plurality of sheet metal members.

US Pat. No. 10,113,714

LIGHTING UNITS WITH REFLECTIVE ELEMENTS

PHILIPS LIGHTING HOLDING ...

1. A lighting unit, comprising:a base adapted to be inserted into a socket of a luminaire or lighting fixture;
one or more light sources to emit light at least in a first direction; and
one or more reflective elements arranged to:
define-an aperture through which a first spatial portion of the emitted light continues in the first direction;
prevent a second spatial portion of the emitted light from continuing in the first direction; and
reflect at least part of the second spatial portion of the light in a second direction that is different than the first direction;
wherein the one or more reflective elements comprise a plurality of reflective blades of a diaphragm shutter, wherein the plurality of reflective blades is configured to be slid over each other to alter a diameter of the aperture.

US Pat. No. 10,113,707

ILLUMINATION DEVICE FOR VISUALLY SUPPRESSING A GAP BETWEEN TWO ADJACENT REFLECTIVE SURFACES

CAE INC., Saint-Laurent ...

1. A reflective display comprising:at least two reflective surfaces defining a gap therebetween;
a strip of light propagating material, the strip of light propagating material defining a front surface, two side surfaces and a back surface, the side surfaces being adapted for positioning between the two reflective surfaces and the front surface;
a plurality of lighting units positioned along the back surface of the strip of light propagating material for propagating light in the strip of light propagating material, whereby light propagated in the light propagating material visually suppresses the gap between the two reflective surfaces; and
a plurality of light detectors, the light detectors being positioned along the strip of light propagating material, each light detector collecting light projected on the reflective surfaces in an area surrounding the light detector and generating corresponding lighting data.

US Pat. No. 10,113,698

LIGHTING ASSEMBLY EMITTING A PORTION OF UV LIGHT

PHILIPS LIGHTING HOLDING ...

1. A lighting assembly for illumination, the lighting assembly comprising:a light exit window for emitting light into an ambient of the lighting assembly,
a first light emitting element for emitting visible light, the first light emitting element being capable of emitting visible light having a color point in a CIE XYZ color space, the color point having a distance smaller than 25 SDCM to a black body line in said color space, the first light emitting element being arranged to emit the visible light directly towards the light exit window,
a second light source for emitting UV light, the UV light having a spectral range from 280 nm to 350 nm, wherein the UV light is at least partly emitted through the light exit window, the second light source being arranged not to emit the UV light directly towards the light exit window,
a reflection element configured to reflect the UV light, the reflection element being arranged at a position for receiving at least a portion of the UV light and is arranged for reflecting the received UV light towards the light exit window, wherein the lighting assembly is configured to emit an amount of the UV light in the spectral range through the light exit window, the amount of the UV light having a first radiant flux and the lighting assembly is configured to emit a second radiant flux of the visible light through the light exit window, a ratio between the first radiant flux and the second radiant flux is in a range from 0.01 to 0.0001.

US Pat. No. 10,113,679

FLUID LINER WEAR INDICATOR FOR SUCTION MANIFOLD OF RECIPROCATING PUMP ASSEMBLY

S.P.M. FLOW CONTROL, INC....

1. A manifold through which a fluid is adapted to flow, the manifold comprising:an elongated member at least partially defining a fluid chamber through which the fluid is adapted to flow, a longitudinal axis, and an interior surface, the elongated member comprising: one or more inlets via which the fluid flows into the fluid chamber; and one or more outlets via which the fluid flows out of the fluid chamber;
a fluid liner disposed within the fluid chamber and adapted to dynamically respond to pressure fluctuations within the fluid chamber as the fluid flows therethrough, the fluid liner being subject to at least one of wear and erosion due to the flow of the fluid therethrough and the dynamic response of the fluid liner to the pressure fluctuations; and
a wear indicator positioned radially between the interior surface of the elongated member and the longitudinal axis, the wear indicator comprising a wear groove formed in the fluid liner and devoid of any component of the manifold;
wherein the wear indicator is adapted to indicate the degree to which the fluid liner has been subjected to the at least one of wear and erosion.

US Pat. No. 10,113,675

DEVICE FOR CONNECTING TWO FLUID-CONDUCTING LINES

Eugen Forschner GMBH, Sp...

1. A device (1) for connecting two fluid-conducting lines (10, 20) having a first end and a second end, wherein the device (1) has a continuous drilled hole (2) that leads from one end of the device to the other end of the device for passing on the fluid,characterized in that the device (1) has two line receptacles (11, 21) lying opposite one another in the direction of a longitudinal axis (3), which line receptacles (11, 21) end at a distance (4) from one another within the device (1), wherein each of the line receptacles (11, 21) lying opposite one another is embodied in such a way that each line receptacle (11, 21) is provided with a first part (12, 22) through which the continuous drilled hole (2) leads, and a second part (13, 23) which surrounds the first part (12, 22), with the result that an annular space (14, 24) whose bottom (15, 25) defines the end of the respective line receptacle (11, 21) is formed between the first part (12, 22) and the second part (13, 23), and a first of the fluid-conducting lines (10, 20) is arranged in one of the line receptacles (11, 21) in such a way that the first of the fluid-conducting lines (10, 20) is arranged with an inner cross section (16, 26) in a seal-forming fashion against the first part (12, 22) of the device (1), and with an outer cross section (17, 27) in the annular space (14, 24) and is secured there and not contacting the second part, and a second of the fluid-conducting lines (10, 20) is arranged in the other of the line receptacles (11, 21) in such a way that it is arranged with an inner cross section (16, 26) in a seal-forming fashion against the first part (12, 22) of the device (1) and with an outer cross section (17, 27) in the annular space (14, 24) and is secured there and not contacting the second part, characterized in that the first of the fluid-conducting lines (10, 20) is designed for use in a relatively high temperature range T2, and in that each of the fluid-conducting lines (10, 20) is manufactured at least partially from a different material, wherein the two different lines (10,20) are connected in a sealed and compact fashion by a single component and a heating wire is wound around each fluid conducting line (10,20).

US Pat. No. 10,113,670

SINGLE USE WALL PASS-THROUGH SYSTEM

NewAge Industries, Inc., ...

1. A single use wall pass-through system, comprisinga tube assembly that is attachable through an opening in a wall, including a tubular body,
a clamping flange connected to each end of the tubular body,
a hose or tube is arranged through the tubular body and passes through a hose opening in an integral one-piece isolating gasket and end cap formed of an elastomer that extends in one piece from the hose or tube to the clamping flange at one end of the tubular body,
a clamp ring that clamps the one-piece isolating gasket and end cap to one of the clamping flanges forming a seal between the clamping flange and the one-piece isolating gasket,
the tube or hose and the one-piece isolating gasket and end cap are single use, and
the one-piece isolating gasket and end cap includes reinforcing ribs.

US Pat. No. 10,113,641

SHIFT DEVICE OF DUAL CLUTCH TRANSMISSION

Hyundai Dymos Incorporate...

1. A shift device of a dual clutch transmission, comprising:a select motor;
a select guide block moving in a straight direction by a driving of the select motor;
a pair of odd-stage and even-stage control shafts arranged parallel to one another and at opposite sides of the select guide block, each shaft moving in an axial select direction by the straight movement of the select guide block;
a pair of odd-stage and even-stage shift motors each providing a shaft rotating force to the pair of control shafts in a shift direction; and
a lead screw rotating by the select motor to provide a straight moving force to the select guide block, said select guide block having internal threads mating with external threads of the lead screw;
wherein the lead screw is configured to interlock with the select motor through a reducer,
wherein the select guide block is provided with a pair of guide grooves for providing a shaft moving force to the pair of control shafts, respectively, in the select direction and the guide grooves are formed on opposing side surfaces of the select guide block, the grooves facing and engaged with the control shafts and
wherein each guide groove continuously forms a flat surface and an inclined surface having a multi-stage structure to adjust a shaft moving displacement of the pair of control shafts in the select direction as determined by a straight moving distance of the select guide block.

US Pat. No. 10,113,639

TRANSMISSION WITH L1-L2 SHIFT METHOD WHILE ENGINE BRAKING

GM Global Technology Oper...

1. A transmission for use with an engine, the transmission comprising:a stationary member;
an input member connectable to the engine;
a plurality of gear sets each having a plurality of nodes, including a ring gear, a sun gear, and a carrier member;
a first clutch that, when applied, connects a node of one of the gear sets to the stationary member to establish a 1st gear low (L1) mode;
a second clutch that, when applied, connects a node of another one of the gear sets to the stationary member to establish a 2nd gear low (L2) mode;
a selectable one-way clutch (SOWC) connected between nodes of two of the gear sets; and
a controller programmed, in response to a requested shift from the L1 mode to the L2 mode during an engine braking maneuver, to release the first clutch and thereby enter a neutral mode of the transmission, release the SOWC when a slip level across the first clutch exceeds a first calibrated slip threshold, reapply the first clutch when a slip level of the SOWC exceeds a second calibrated slip threshold to thereby enter a 1st gear freewheeling mode, and apply the second clutch to enter the L2 mode and resume the engine braking maneuver.

US Pat. No. 10,113,607

ACTIVE VIBRATION DAMPING DEVICE AND ACTIVE VIBRATION DAMPING METHOD

HONDA MOTOR CO., LTD., T...

1. An active vibration damping device, comprising:an actuator disposed between a drive source and a vehicle body; and
a computer configured to suppress transmission of vibrations from the drive source to the vehicle body by causing the actuator to actively generate vibrations;
wherein the computer comprises:
an internal temperature estimating unit configured to calculate an internal temperature of the actuator;
a command value calculating unit configured to calculate an operation command value for the actuator from rotation information of the drive source;
a command value correction unit configured to correct the operation command value in accordance with the internal temperature;
a drive control unit configured to apply a drive voltage to the actuator using a voltage duty ratio based on the corrected operation command value; and
a point number calculating unit configured to obtain an integer value point number which is set so as to become larger as a period of rotation of the drive source becomes longer; and
wherein the internal temperature estimating unit comprises:
an output average duty ratio calculating unit configured to calculate an output average duty ratio, which is an average of target values or actually measured values of the voltage duty ratios that are used for realizing the operation command value, when the period of rotation of the drive source is a predetermined period;
a reference average duty ratio calculating unit configured to calculate, on basis of the operation command value and the point number, a reference average duty ratio, which is an average of the voltage duty ratios that realize the operation command value when the internal temperature is a reference temperature and the period of rotation of the drive source is the predetermined period;
an average duty ratio rate-of-change calculating unit configured to calculate, from the operation command value and the point number, an average duty ratio rate of change, which indicates a relationship between an amount of change of the internal temperature and an amount of change of an average duty ratio which is an average of the voltage duty ratios, when the period of rotation of the drive source is the predetermined period; and
an internal temperature calculating unit configured to calculate as the internal temperature a value obtained by adding the reference temperature to a product of the average duty ratio rate of change and a deviation between the output average duty ratio and the reference average duty ratio.

US Pat. No. 10,113,517

AIR CLEANER FOR STRATIFIED SCAVENGING TWO-STROKE INTERNAL COMBUSTION ENGINE

Yamabiko Corporation, To...

1. An air cleaner for a stratified scavenging two-stroke internal combustion engine, wherein the air cleaner is connected to a carburetor with an air passage and an air-fuel mixture passage to supply clean air filtered by the air cleaner to the air passage and the air-fuel mixture passage of the carburetor, the air cleaner comprising:an element member provided with a cleaner element for filtering air, an outer circumferential surface of the cleaner element forming an outer circumferential surface of the air cleaner;
an air cleaner base having a first inlet and a second inlet;
a ceiling plate member opposed to the air cleaner base to define a ceiling wall of the air cleaner and;
an air cleaner clean space formed by the air cleaner base, the ceiling plate member and the cleaner element;
a passage forming member forming an extended passage leading to the second inlet,
wherein the passage forming member is shaped to surround a periphery of the first inlet, and
wherein the passage forming member forms a blown-back fuel diffusion preventing region leading to the first inlet,
wherein the blown-back fuel diffusion preventing region is closed by the air cleaner base and the ceiling plate member, and defined by the air cleaner base, the ceiling plate member and a peripheral wall surface of the passage forming member,
wherein the passage forming member has an entrance opening at one end in a longitudinal direction of the passage forming member and an exit opening at another end of the passage forming member,
wherein the entrance opening is opened to the air cleaner clean space, and the exit opening is connected to the second inlet,
wherein the blown-back fuel diffusion preventing region is opened to an air cleaner clean space that is defined by the cleaner element and outside of the passage forming member, and the blown-back fuel diffusion preventing region is opened to the air cleaner clean space through a clearance gap between the entrance opening and the exit opening,
wherein the first inlet is connected to one of the air passage and the air-fuel mixture passage, the second inlet is connected to the other of the air passage and the air-fuel mixture passage.

US Pat. No. 10,113,239

CUTTING TOOL

KYOCERA CORPORATION, Kyo...

1. A cutting tool comprising:a base including cemented carbide containing W, C, Co, Cr, Si and Fe; and
a coating layer comprising a Ti-based layer including at least a layer of Ti(Cx1Ny1Oz1) (0?x1?1, 0?y1?1, 0?z1?1, x1+y1+z1=1), an Al2O3 layer, and an outermost layer of Ti(Cx3Ny3Oz3) (0?x3?1, 0?y3?1, 0?z3?1, x3+y3+z3=1), which are laminated in order from the base side on a surface of the base, wherein a content of Cr contained at a thickness-center position of a first Ti-based layer of the Ti-based layer on a side closer to the base is lower than a content of Cr contained in the base, and higher than a content of Cr contained at a thickness-center position of the Al2O3 layer, and a content of Cr contained at a thickness-center position of the outermost layer is higher than the content of Cr contained at the thickness-center position of the Al2O3 layer in a glow-discharge emission spectrometry (GDS analysis).

US Pat. No. 10,113,037

SILICONE SURFACTANT, W/O EMULSION COMPOSITION, POWDER COMPOSITION, AND COSMETIC/MEDICAL APPLICATION THEREOF

DOW CORNING TORAY CO., LT...

1. A silicone surfactant comprising a co-modified organopolysiloxane represented by the following general formula (1):
wherein
R1 is a monovalent hydrocarbon group having from 1 to 30 carbons, or is a hydrogen atom;
R2 is a straight or branched monovalent hydrocarbon group having from 6 to 30 carbons;
Q is a hydrophilic group consisting of a polyoxyalkylene group represented by structural formula (2):
—(C2H4O)r—(C3H6O)s—R3
wherein
R3 is a hydrogen atom or an alkyl group having from 1 to 4 carbons,
r is a number in a range of 0 to 100,
s is a number in a range of 0 to 50, and
r+s is a number in a range of 3 to 100;
R is a group selected from R1, R2, and Q;
provided that, when n3=0, at least one R is Q;
(n1+n2+n3) is a number in a range of 40 to 75;
n1 is a number in a range of 1 to 65;
n2 is a number in a range of 1 to 20; and
n3 is a number in a range of 0 to 5.

US Pat. No. 10,112,914

POLYMORPHS OF A MPGES-1 INHIBITING TRIAZOLONE COMPOUND

GLENMARK PHARMACEUTICALS ...

1. A crystalline form of N-(4-chloro-3-(5-oxo-1-(4-(trifluoromethyl)phenyl)-4,5-dihydro-1H-1,2,4-triazol-3-yl)benzyl)pivalamide (Compound formula II), structurally represented as

US Pat. No. 10,112,794

REMOVAL MACHINE TO TAKE PAVEMENT MARKINGS OFF OF PAVED SURFACES

James P. Shea, Waterford...

1. A temporary tape removal apparatus that comprises:a chassis having a front end and a rear end with drive wheels near the rear end of the chassis and guiding wheels near the front end of the chassis;
a boom arm extending outward from the chassis and being movable between up and down and side to side positions relative to the chassis;
a spool assembly including a rotatable spool for winding used temporary tape thereon mounted on the boom arm, the boom arm extending outward from the front end of the chassis so that the spool is located beyond the front end of the chassis; and
controllable drive means to rotate the rotatable spool.

US Pat. No. 10,112,747

FOAM GENERATOR FOR COMPRESSION RECEPTACLES

APOLLO INDUSTRIAL CO., LT...

1. A foam generator for a compression receptacle, mounted to a neck of the compression receptacle having liquid contents stored therein for mixing the liquid contents, discharged out of the compression receptacle when the compression receptacle is compressed, with air and discharging the mixed liquid contents in a form of foam, wherein the foam generator comprises:a cap main body comprising a large cap part fastened to the neck of the compression receptacle in a screw coupling manner, an upward and downward movement guide wall disposed at an outside of the large cap part, the upward and downward movement guide wall being formed in a shape of a cylinder, and a foam discharge part protruding from an upper part of the large cap part in a shape of a pipe having a diameter while a step is formed at a lower end thereof, an upper part of the foam discharge part being open, an air hole for allowing external air to be introduced therethrough being formed in the step;
a content discharge guide configured such that an edge thereof is fitted, received, and disposed in an upper end of the large cap part of the cap main body so as to be spaced apart from a lower part of the step of the cap main body, the content discharge guide comprising a discharge guide part having a liquid discharge port formed in a central region thereof so as to be recessed concavely and a tube coupling port provided at a center of a bottom surface of the discharge guide part, a discharge tube for discharging the liquid contents stored in the compression receptacle being coupled to the tube coupling port, the discharge guide part being provided at an edge thereof with an air discharge port, through which air in the compression receptacle can move to an upper side of the discharge guide part when the compression receptacle is compressed, and with an air introduction port, through which external air is introduced into the compression receptacle when the compression receptacle is restored to an original state thereof;
a check valve unit made of an elastic material, the check valve unit comprising a ring-shaped partition wall, having a lower end disposed in tight contact with an upper surface of the content discharge guide and an upper end disposed in tight contact with the lower part of the step of the cap main body, for defining an air and liquid mixing chamber in the foam discharge part, a first check valve part disposed inside the partition wall so as to extend downward toward a central part thereof, an end of the first check valve part being disposed in elastically tight contact with the discharge guide part of the content discharge guide, the first check valve part being configured to selectively allow the air in the compression receptacle to move to the air and liquid mixing chamber through the air discharge port when the compression receptacle is compressed, and a second check valve part disposed outside the partition wall so as to extend upward toward an outside, an end of the second check valve part being disposed in elastically tight contact with an outside of the step of the cap main body, the second check valve part being configured to close the air hole when the compression receptacle is compressed and to open the air hole when the compression receptacle is restored to the original state thereof such that external air can be introduced;
a filtration member fitted, received, and disposed in the foam discharge part of the cap main body, the filtration member being formed in a shape of a cylinder having open upper and lower parts, the filtration member being provided at upper and lower surfaces thereof with filtration nets, the filtration member being configured to guide a discharge of foam formed as a result of the liquid contents being mixed with air in the air and liquid mixing chamber while homogenizing the foam; and
an upward and downward movement cap comprising a cylindrical wall surface having a lower end received in and coupled to the upward and downward movement guide wall of the cap main body so as to be movable upward and downward and an upper surface configured to cover an upper part of the cap main body, the upper surface being provided with a plurality of foam distribution holes, through which the foam that has passed through the filtration member is discharged to the outside in a distributed manner, the upward and downward movement cap being provided at a center of the upper surface thereof with a cylindrical blocking wall for selectively opening and closing the foam discharge part according to an upward and downward manipulation thereof.

US Pat. No. 10,112,682

METHOD TO SEVER AND DISENGAGE A BICYCLE DRIVETRAIN BETWEEN THE CRANK AXIS AND REAR WHEEL AXLE, THEREBY ENABLING A FOLD IN THE BICYCLE FRAME AT A SPECIFIED POINT BETWEEN SAID CRANK AXIS AND REAR WHEEL AXLE ON A VERTICAL OR NEAR VERTICAL AXIS PARALLEL TO TH

T. PONG COMPANY, Raymond...

1. A folding bicycle comprising:a frame having a front subframe, a middle subframe, and a rear subframe;
the front subframe and the rear subframe are coupled to opposite front and rear ends of the middle subframe via a front hinge and a rear hinge, respectively;
the front hinge defining a front axis that runs vertically there through and the rear hinge defining a rear axis that runs vertically there through;
the folding bicycle configured to have a first unfolded configuration for operation wherein the front, middle, and rear subframes are disposed lengthwise along a single axis, the front subframe is positioned in front of the middle and rear subframes, the middle subframe is position between the front and rear subframes, and the rear subframe is positioned behind the front and middle subframes;
the folding bicycle configured to a have a second folded configuration for storage wherein the front and rear subframes are each folded 180° with respect to the middle subframe and are positioned parallel thereto;
a front wheel coupled to the front subframe;
a rear wheel coupled to the rear subframe about a rotational axis, the rear wheel having a rear wheel sprocket operatively coupled thereto and disposed along the rotational axis;
a crankset coupled to the middle subframe, the crankset including a crank sprocket;
a rear wheel drivetrain having at least a first gear intermeshed with a second gear, the rear wheel drivetrain operatively coupling the crank sprocket to the rear wheel sprocket and configured to drive the rear wheel of the folding bicycle via rotation of the crankset;
wherein the first gear of the rear wheel drivetrain is disposed on the middle subframe and the second gear of the rear wheel drivetrain is disposed on the rear subframe, the first and second gears intermeshed with one another along the rear axis when the folding bicycle is in the first unfolded configuration, and
wherein the first and second gears are disengaged from one another and parallel to each other when the folding bicycle is in the second folded configuration thereby disengaging the crankset from the rear wheel and allowing the rear wheel to freely rotate in either direction independent of the crankset.

US Pat. No. 10,112,636

SHOPPING AID

Cart Mama LLC, Warwick, ...

1. A shopping aid adapted to be conveniently attached to and removed from the side of a shopping cart, comprising:a rear panel, fabricated from a sheet of durable and washable fabric, said rear panel having an upper edge comprising a stiffening member fabricated of a length of woven webbing;
an outer panel, fabricated from a sheet of durable and washable fabric;
said outer panel being joined to said rear panel at forward, rearward, and lower peripheral edges, and along one or more lines spaced between said forward and rearward peripheral edges, defining a plurality of pockets between said rear and outer panels; and
forward and rearward straps fixed to forward and rearward upper corners of at least said rear panel, said straps being adapted to be secured to the side of a shopping cart to support said shopping aid thereon.

US Pat. No. 10,112,607

DRIVING SUPPORT DEVICE THAT PERFORMS DRIVING SUPPORT IN ACCORDANCE WITH CHARACTERISTICS AND SKILLS OF DRIVER

HONDA MOTOR CO., LTD., T...

1. A driving support device comprising:a processing device that performs driving support by controlling in-vehicle equipment having an influence on running of a subject vehicle equipped with the driving support device,
the processing device being configured to
repeatedly obtain and store, at a predetermined time interval or a predetermined distance interval, a pair of a value of longitudinal acceleration and a value of lateral acceleration that are generated as a result of a driving operation performed by a driver, the longitudinal acceleration being an acceleration in a traveling direction of the subject vehicle, the lateral acceleration being an acceleration in a direction orthogonal to the traveling direction,
set at least one parameter of a support operation for performing the driving support, by using a plurality of pairs of the value of the longitudinal acceleration and the value of the lateral acceleration, repeatedly obtained and stored,
plot points, each representing the respective pairs, on a two-dimensional coordinate plane that includes two axes respectively representing the longitudinal acceleration and the lateral acceleration,
generate a first shape, which is a closed shape, by connecting the plotted points adjacent to one another by line segments,
generate a second shape, which is a closed shape, formed of a circumscribed curve of the first shape,
calculate an area difference by subtracting an area of the first shape from an area of the second shape, and
set the one parameter of the support operation for performing the driving support, by using the area difference.

US Pat. No. 10,112,512

SUSPENSION DEVICE

GRAMMER AG, Amberg (DE)

1. A suspension device for a vehicle seat, comprising:an upper suspension portion and a lower suspension portion, said suspension portions being connected to one another by a first swivel connector and a second swivel connector, said first swivel connector being arranged on the lower suspension portion in such a way that said first swivel connector can swivel about a first swivel pin, and the second swivel connector being arranged on the lower suspension portion in such a way that said second swivel connector can swivel about a second swivel pin, a first tension spring and a second tension spring being respectively connected to the first swivel connector by a first end region and to the upper suspension portion or the lower suspension portion by a second end region,
wherein the first end region of the first tension spring is attached to the first swivel connector at a first distance, and the first end region of the second tension spring is attached to said first swivel connector at a second distance, the length of the first distance being variable,
wherein the first distance between the first end region of the first tension spring and the first swivel connector can be adjusted by an adjustment device, which is connected to the first swivel connector at one end and to the first end region at the other end.

US Pat. No. 10,112,489

METHOD OF CONTROLLING REGENERATIVE BRAKING COOPERATION FOR ELECTRIC VEHICLE

Hyundai Motor Company, S...

1. A method of controlling a regenerative braking cooperation for an electric vehicle, the method comprising:a correction mode entering operation, of entering a correction mode when a braking quantity of a driver is detected by a pedal stroke sensor of the vehicle;
a first braking pattern analyzing operation, by a controller, of comparing an accumulated correction hydraulic pressure braking quantity with a predetermined first hydraulic pressure braking quantity, to analyze a braking pattern of the driver through the entering to the correction mode, the first braking pattern analyzing operation including a total required braking quantity determining operation;
a regenerative braking restriction requesting operation of, when the accumulated correction hydraulic pressure braking quantity is smaller than the first hydraulic pressure braking quantity, determining, by the pedal stroke sensor, that the driver has a gradual braking-centered braking pattern and transferring a signal for requesting a regenerative braking restriction of a motor to the controller; and
a hydraulic pressure braking operation, by the controller, of determining a correction hydraulic pressure braking quantity based on a braking quantity of the driver input into the pedal stroke sensor in a state where regenerative braking of the motor is restricted, and performing a hydraulic pressure braking according to the correction hydraulic pressure braking quantity,
wherein the total required braking quantity determining operation includes a second braking pattern analyzing operation, by the controller, in which when it is determined that a traveling distance of the vehicle in a state where the total required braking quantity is determined is equal to or larger than a predetermined distance, an accumulated general hydraulic pressure braking quantity according to the travelling distance equal to or larger than the predetermined distance is compared with a predetermined second hydraulic pressure braking quantity.

US Pat. No. 10,112,411

TRANSFER APPARATUS

CANON FINETECH NISCA INC....

1. A transfer apparatus comprising:a transfer section that transfers a transfer surface of a transfer or protective film to one surface or both surfaces of a card-shaped recording medium;
a reverse section that reverses a front side and a backside of the recording medium in two-sided transfer;
a correction section that corrects a curl of the recording medium with the transfer surface transferred in the transfer section; and
a control section that controls the correction section,
wherein the control section controls the correction section so that a correction amount for the recording medium with the transfer surface firstly transferred to one surface in two-sided transfer is smaller than a correction amount for the recording medium with the transfer surface transferred to one surface in one-sided transfer; and
wherein the control section controls the correction section so that respective correction amounts to one and opposite surfaces for the recording medium in two-sided transfer are smaller than the correction amount for the recording medium to the one surface in one-sided transfer.

US Pat. No. 10,112,358

PRESS FOR SHAPING PELLETS IN A RESTRICTED AND HOSTILE ENVIRONMENT AND METHOD FOR ASSEMBLING THE PRESS

CHAMPALLE, Peronnas (FR)...

1. A press comprising:a die in which pellets are shaped by compression;
a first upper punch and a second lower punch, the upper punch and the lower punch being aligned with the die and penetrating the die by opposite ends of the die to compress the pellets and extract the pellets from the die;
a lower platen to which the lower punch is fastened;
parallel columns, also fastened to the lower platen;
a die platen and an upper punch platen to which the die and the upper punch are respectively fastened, and which are slidingly placed onto the columns;
an upper motor displacing the upper punch platen and a lower motor displacing the die platen by actuating parts;
wherein the actuating parts of the motors are joined to the die platen and to the upper punch platen by detachable connections comprising screws,
the upper punch is joined to the upper punch platen by detachable connections comprising screws,
the lower punch is joined to the lower platen by detachable connections comprising screws, and
the actuating part of the lower motor comprises a knuckle connector joined to the die platen and to an actuating rod of the lower motor, the actuating rod being at a non-zero angle with the columns.

US Pat. No. 10,112,352

PRESS MOULDING METHOD

Gurit (UK) Ltd., Newport...

1. A method of press moulding a multilayer moulding material structure to form a moulded part of fibre-reinforced resin matrix composite material, the method comprising the steps of:i. providing a multilayer moulding material structure, the multilayer moulding material structure containing fibres, resin and a syntactic layer comprising a polymer matrix and a plurality of hollow bodies distributed within the polymer matrix, wherein the multilayer moulding material structure comprises a multilayer laminate and the syntactic layer is a core layer between first and second fibre layers, and then in a loading step locating the multilayer moulding material structure into a mould tool which comprises a lower part and an upper part, wherein at least the upper part is heated to an elevated temperature;
ii. draping a lower surface of the multilayer moulding material structure onto at least a part of a lower moulding surface of the mould tool thereby permitting the multilayer moulding material structure to drape at least partly under the action of gravity within the mould tool so as to configure at least part of the draped multilayer moulding material structure in a partly moulded shape, wherein the multilayer moulding material structure drapes by bending about a neutral axis substantially centrally located with respect to the thickness of the multilayer moulding material structure, the neutral axis being located within the syntactic layer;
iii. fully closing the mould tool to define a closed mould cavity containing the multilayer moulding material structure;
iv. applying pressure to the mould cavity to cause resin to flow and impregnate the fibres and to configure the multilayer moulding material structure in a fully moulded shape; and
v. substantially fully curing the resin to form a moulded part from the multilayer moulding material structure, wherein steps ii and iv are carried out at elevated temperature, from step i until at least the commencement of step iii the lower part is at a lower temperature than the upper part, and in step ii the multilayer moulding material structure is heated to cause the viscosity of the resin initially to decrease as a result of an increase in resin temperature and then to increase as a result of initiation of curing prior to step iii, and the temperature of the lower part is controlled so as to delay the onset of gelation of the resin until after step iii.

US Pat. No. 10,112,236

DEVICE AND METHOD FOR THE MANUFACTURE OR REPAIR OF A THREE-DIMENSIONAL OBJECT

MTU AERO ENGINES AG, Mun...

1. A device for the manufacture or repair of a three-dimensional object, comprising:at least one construction chamber for successive solidification of at least one solidifiable material layer by layer in predefined regions for the layer-by-layer buildup of the three-dimensional object or for layer-by-layer repair of individual regions of the three-dimensional object within the construction chamber, and
at least one inlet nozzle and at least one suction nozzle for a process gas, with the inlet nozzle and the suction nozzle being arranged where a gas flow that passes at least partially over a buildup and joining zone of a construction platform formed in the construction chamber is created,
wherein the ratio of the sums of the fluid-dynamically relevant cross-sectional areas of the at least one suction nozzle to the at least one inlet nozzle is 2.5:1 to 0.3:1, and
wherein the at least one suction nozzle comprises at least two suction orifices, wherein said at least two suction orifices are each connected to an associated suction channel in such a way as to carry the flow, and each suction channel has wall surfaces that have a contoured course that is curved at least in sections in the flow direction and the associated suction channels are separated from one another.

US Pat. No. 10,112,153

THIN FILM COMPOSITE MEMBRANE STRUCTURES

3M Innovative Properties ...

1. A thin film composite membrane structure comprising: a selective membrane layer for ion rejection attached to a hydrophilic support layer, the hydrophilic support layer comprising a multi-zone microfiltration membrane that is asymmetric comprising:a porous support material; and
at least two microfiltration zones, where a first zone comprises a first membrane and a second zone that is attached to the first zone and that coats at least a portion of the depth of the porous support material;
wherein the first zone comprises a pore size that is smaller than a pore size of the second zone; and the pore size of the second zone is greater than the pore size of the first zone by a factor in the range of 1.1 to 500.

US Pat. No. 10,112,091

REMOVABLE, ROTATABLE GRIP ELEMENT FOR A BALL BAT OR OTHER SPORTING-GOOD IMPLEMENT

EASTON DIAMOND SPORTS, LL...

1. A grip element for use on a sporting-good implement having a knob, the grip element comprising:a body having a length, a first end, and a second end;
a substantially linear opening along the length of the body;
a low-friction inner surface; and
a projection located substantially at the first end, the projection being configured to mate with a groove in the knob;
wherein a portion of the grip element is positioned to rotate against a portion of the knob; and
wherein the body is tapered between the first end and the second end.

US Pat. No. 10,112,022

METHOD FOR DETECTING AN INSPIRATORY FLOW LIMITATION DURING SLEEP-DISORDERED BREATHING

DeVilbiss Healthcare LLC,...

1. A breathing therapy machine having an optimized auto-adjust capability comprising:a. a blower, for delivering air to a user of said device at a pressure;
b. a processor, for controlling said blower;
c. non-volatile memory, accessible by said processor, said non-volatile memory including operational programming;
d. an airflow sensor, electrically connected to said processor for gathering data regarding a volume of airflow to said patient, said operational programming producing an airflow waveform from said gathered data; and
e. a flow limitation detection module, stored in said non-volatile memory as part of said operational programming, wherein said flow limitation detection module is configured to detect a flow limitation condition by:
grouping data points sampled from an inspiration portion of the airflow waveform into a plurality of bins;
for each bin, calculating an average slope value using the data points within the bin;
computing a plurality of variance values, wherein each variance value is computed by defining a moving window that utilizes average slope values calculated for at least three of the bins; and
selecting and analyzing a lowest variance value of the plurality of variance values to determine if the flow limitation condition exists;
wherein said pressure of said air is altered based on detection of the flow limitation condition.

US Pat. No. 10,112,011

TIME AVERAGED BASAL RATE OPTIMIZER

DexCom, Inc., San Diego,...

1. A method for optimizing a basal rate profile for use with continuous insulin therapy, comprising:providing a programmed basal rate profile for insulin therapy, wherein the basal rate profile comprises an insulin delivery schedule that includes one or more blocks of time, and wherein each block of time defines an insulin delivery rate;
periodically or intermittently updating the programmed basal rate profile based on a retrospective analysis of continuous glucose sensor data over a predetermined time window; and
adjusting the basal rate profile of the updated programmed basal rate profile in response to real time continuous glucose sensor data indicative of actual or impending hyperglycemia or hypoglycemia, wherein adjusting comprises dynamically increasing or decreasing the basal rate of the updated programmed basal rate profile in real time in response to real time continuous glucose sensor data indicating actual hyperglycemia, impending hyperglycemia, actual hypoglycemia, or impending hypoglycemia.

US Pat. No. 10,111,974

METHOD AND APPARATUS FOR ON-SITE MICROBIAL REMEDIATION AND SANITIZATION OF HOUSEHOLD ITEMS

Vacu Fog LLC, Atlanta, G...

1. A method for remediating a crushable, air permeable, household item that may have been exposed to mold, comprising the steps of:(a) preparing said item to prevent it from being crushed by bracing said item;
(b) sealing said item inside a sealable vacuum bag;
(c) evacuating air from the inside of said bag, said step of evacuating air from the inside of said bag causing the evacuation of air from within said air permeable item occurring after said step of preparing said item;
(d) introducing an antimocrobial remedial fog into said bag;
(e) infusing said antimicrobial remedial fog into said air permeable item; and
(f) removing said item from said bag.

US Pat. No. 10,111,892

ANTI-CANCER AGENT

Nippon Chemical Industria...

1. An anti-cancer agent comprising:at least one kind of phosphine transition metal complex selected from a group of compounds represented by Formulae (1a) to (1d),

at least one kind of phosphine transition metal complex selected from a group of compounds represented by Formulae (2a) to (2c),
anda phosphine transition metal complex represented by Formula (3),

wherein in the Formulae, R1 and R2 represent a linear or branched alkyl group, a cycloalkyl group, a cycloalkyl group having a substituent, an adamantyl group, a phenyl group, or a phenyl group having a substituent that has 1 to 10 carbon atoms; R1 and R2 are different from each other, and R1 has a higher priority than R2 as ranked according to RS notation; R3 and R4 represent a hydrogen atom or a linear or branched alkyl group having 1 to 6 carbon atoms, and may be groups that are the same as or different from each other; R3 and R4 may form a saturated or unsaturated ring by binding to each other, and the saturated or unsaturated ring may have a substituent; M represents an atom of a transition metal selected from a group consisting of gold, copper, and silver; and X? represents an anion; and
wherein the mixing ratio (molar ratio) among the total amount of the compounds represented by Formulae (1a) to (1d), the total amount of the compounds represented by Formulae (2a) to (2c), and the compound represented by Formula (3) is Formulae (1a) to (1d):Formulae (2a) to (2c):Formula (3)=20 to 80:10 to 30:10 to 80.

US Pat. No. 10,111,781

EAR WARMER WITH A SUBSTANTIALLY CONTINUOUS SURFACE

180s, Inc., Baltimore, M...

1. An ear warmer frame, comprising:a band having an upper surface and an end portion having an end surface; and
an ear member having an upper surface and an end portion movably coupled to the first end portion of the band so that the ear member can be pivoted between a first position relative to the band and a second position relative to the band, the end portion of the ear member including an end surface,
when the ear member is in the first position, an ear member axis nonparallel to a band end portion axis,
when the ear member is in the second position, the ear member axis substantially parallel to the band end portion axis and at least a portion of the end surface of the end portion of the band abutting at least a portion of the end surface of the ear member and the upper surface of the band portion and the upper surface of the ear member forming a substantially continuous surface.

US Pat. No. 10,111,752

CRANIOPLASTY PLATE

UNIVERSITY OF IOWA RESEAR...

1. A cranioplasty plate, comprising: a body adapted to cover a skull opening exposing the brain and having opposite upper and lower surfaces and a perimeter edge; a gasket on the lower surface of the body adjacent the perimeter to space the body apart from the skull; the gasket being adapted to shrink over time so that the body settles onto the skull;elastic fasteners fixed to the body and extending radially outward; and
cranial screws adapted to fix the elastic fasteners to the skull;
whereby the elastic fasteners pull the body towards the skull as the gasket shrinks over time.

US Pat. No. 10,111,739

METHOD FOR REHYDRATION OF LYOPHILIZED BIOLOGIC MATERIALS

C.R. Bard, Inc., Murray ...

1. A method of storing and rehydrating a lyophilized medical implement, the method comprising:sealing the lyophilized medical implement within a sealed flexible container capable of being expanded away from the lyophilized medical implement to a maximum predetermined internal volume, the maximum predetermined internal volume corresponding to a certain volume of rehydration fluid for properly hydrating the lyophilized medical implement, the flexible container including a resealable port for receiving rehydration liquid therethrough into the flexible container;
opening the resealable port and introducing rehydration liquid into the flexible container through the resealable port until the flexible container has expanded to the maximum, predetermined internal volume;
resealing the resealable port;
waiting for the lyophilized medical implement to rehydrate within the sealed resealable container;
opening the sealed flexible container via a second opening through which the medical implement may be removed from the resealable container; and
removing the medical implement from the flexible container.

US Pat. No. 10,111,703

ELECTROSURGICAL GENERATOR

COSMAN INSTRUMENTS, LLC, ...

1. A system for tissue ablation that includes a radiofrequency generator, a radiofrequency ablation electrode, and a controller; wherein the radiofrequency generator is configured to deliver a radiofrequency signal via the radiofrequency ablation electrode; wherein the controller automatically produces a sequence of on periods and off periods; wherein during each on period, the controller configures the signal level to heat tissue in order to increase the volume ablated tissue and to produce boiling in the tissue; wherein during each off period, the controller configures the signal level to allow for cooling of heated tissue; wherein the controller terminates an on period based in part on a measured indication of boiling in the tissue; wherein after the signal is first configured to heat tissue in order to increase the volume ablated tissue, the controller configures both increases and decreases of the signal level delivered during on periods based in part on the duration of a present on period or of a previous on period.

US Pat. No. 10,111,700

SURGICAL INSTRUMENTS INCLUDING 3D INJECTION MOLDED ELECTRICAL CIRCUITS AND CONNECTIONS

COVIDIEN LP, Mansfield, ...

1. An end effector assembly comprising:a first jaw member including a first electrically conductive plate; and
a second jaw member including a second electrically conductive plate, the first and second jaw members being operably moveable relative to one another between an open position and a clamped position wherein the first and second electrically conductive plates oppose each other, the first and second electrically conductive plates being configured to conduct energy through tissue clamped therebetween, the first jaw member further including:
a first insulative spacer having a rib and a conductive strip, the rib extending from a surface of the first insulative spacer towards the first electrically conductive plate, the conductive strip integrally formed on a surface of the rib contacting the first electrically conductive plate, the conductive strip configured to transmit a first electrical potential to the first electrically conductive plate.

US Pat. No. 10,111,680

THERAPEUTIC ULTRASOUND SYSTEM

Flowcardia, Inc., Tempe,...

1. An ultrasound catheter comprising:an elongated catheter body having a proximal end, a distal end and at least one lumen extending longitudinally therethrough;
a proximal housing that is coupled to the proximal end of the elongated catheter body, the proximal housing having a distal bore;
an ultrasound transmission member extending longitudinally through the lumen of the catheter body;
a sonic connector positioned on the proximal end of the ultrasound transmission member for connecting the ultrasound transmission member to a separate ultrasound generating device at a connection location, the sonic connector comprising a proximal section for connection to the separate ultrasound generating device, and a front portion which connects to the proximal end of the ultrasound transmission member;
and
an absorber retained inside the distal bore of the proximal housing and which substantially surrounds the ultrasound transmission member.

US Pat. No. 10,111,669

FLUOROSCOPY-INDEPENDENT, ENDOVASCULAR AORTIC OCCLUSION SYSTEM

THE REGENTS OF THE UNIVER...

1. A vessel occlusion system for occluding a thoracic artery of a patient between the left subclavian artery and an aortic bifurcation to reduce blood flow to the patients extremities, the system comprising:a balloon shaft including a distal end portion and a proximal end portion, the proximal end portion including a port, the balloon shaft also including pre-calibrated length indicia on an external surface;
an occlusion balloon connected to the distal end portion, the port being in fluid communication with the occlusion balloon;
a balloon inflation lumen extending along a length of the balloon shaft, the balloon inflation lumen being in fluid communication with the balloon and the port;
a curved tip at the distal end portion, the curved tip configured to limit perforation of vessels as the balloon shaft is advanced through blood vessels of the patient toward and through the target blood vessel; and
a nomogram correlating a first distance between at least two externally identifiable boney anatomical landmarks of humans of a pool of humans and a second distance from an insertion puncture to the predetermined location of the humans, wherein a reference distance between the at least two externally identifiable external boney anatomical landmarks of the patients torso, the nomogram configured to enable a comparison of a measurement on the patient to the first distance on the nomogram to determine the correlated second distance such that the predetermined location is the determined second distance from the insertion puncture and the occlusion balloon is to be inserted into the patient and positioned at the predetermined location within the target blood vessel without using fluoroscopy, the pre-calibrated length indicia providing an indication of an insertion distance of the occlusion balloon from the insertion puncture, the nomogram also including a listing of a diameter of the aorta.

US Pat. No. 10,111,663

IMPLANT RETRIEVAL DEVICE

Ancora Heart, Inc., Sant...

1. A retrievable implant assembly comprising:an anchor delivery catheter comprising a proximal end, a distal end, and a longitudinal lumen therebetween;
an implantable tissue anchor disposed within the longitudinal lumen of the anchor delivery catheter, wherein the implantable tissue anchor comprises an eyelet;
a tether coupled to the tissue anchor eyelet and extending through the longitudinal lumen of the anchor delivery catheter from the proximal end;
an implant retrieval device comprising:
an outer elongate body having a first longitudinal lumen extending therethrough;
an inner elongate body configured to be slidably disposed within the first longitudinal lumen, wherein the inner elongate body comprises a second longitudinal lumen and a stop located within the second longitudinal lumen at a distal portion thereof;
an actuator slidably coupled to the inner elongate body;
a retrieval cable slidably disposed within the second longitudinal lumen of the inner elongate body and connected to the actuator such that the retrieval cable at least partially surrounds the stop to define a loop configured to capture the tether therein; and
a retainer comprising a clamp disposed over the inner elongate body that locks the position of the actuator with respect to the inner elongate body such that the tether is restrained within the loop against the stop.

US Pat. No. 10,111,612

VIRTUAL MAGNETIC TRANSMISSION LINES FOR COMMUNICATION AND POWER TRANSFER IN CONDUCTING MEDIA

ARIZONA BOARD OF REGENTS ...

1. A neuronal radio-frequency (RF) telemetry system comprising:a microscopically-sized neuronal sensor tuned to a resonance at a chosen radio-frequency;
an electronic circuitry operably connected to said neuronal sensor,
a passive array of microscopically-sized neuronal transmitter elements separated from one another by a distance that defines near-field interaction between immediately neighboring neuronal transmitter elements of the passive array, wherein an outmost transmitter element of said array is separated from the neuronal sensor by the distance, and
a receiver in RF communication at least with the outmost transmitter element.

US Pat. No. 10,111,382

MID-MOUNT RIDING GRASS MOWER WITH A MOWER UNIT COVER

Kubota Corporation, Osak...

1. A mid-mount riding grass mower comprising:a traveling vehicle body;
a mower unit liftably suspension-supported at a front/rear intermediate lower portion of the traveling vehicle body;
a belt transmission device attached to an upper portion of the mower unit; and
a cover unit that covers the belt transmission device;
wherein the mower unit includes a blade rotatable with a driven pulley of the belt transmission device, and a mower deck that covers the blade from the above;
the cover unit includes a lower cover extending upward from the mower deck so as to surround three sides of the belt transmission device, and right and left side covers detachably attached to right and left end portions of the traveling vehicle body;
the lower cover has an upper end disposed higher than an upper end of the belt transmission device, the lower cover having a vertical length for forming a maintenance space relative to the front/rear intermediate lower portion of the traveling vehicle body when the mower unit is located at its lower limit position; and
each of the right and left side covers has a vertical wall that overlaps respective outermost sides of the lower cover as seen in a right/left direction in a lifting range of the mower unit.

US Pat. No. 10,111,374

ROTATABLE TWO-POINT HITCH SYSTEM

CNH Industrial America LL...

1. A two-point hitch system, comprising:an attachment assembly configured to attach the two-point hitch system to a towable implement;
a mount member mechanically coupled to the attachment assembly; and
two rotatable ends rotatably coupled to the mount member, each rotatable end of the two rotate ends configured to rotate between 0 and 360 degrees, each rotatable end configured to rotate independently; wherein each of the two rotatable ends comprise a removable fastener configured to attach the two-point hitch system to a towing vehicle, to an agricultural implement, or to a combination thereof, via the two rotatable ends.
US Pat. No. 10,111,854

SYNTHESIS AND USE OF AMINE-CONTAINING FLAVONOIDS AS POTENT ANTI-LEISHMANIAL AGENTS

The Hong Kong Polytechnic...

1. An anti-leishmanial compound having the general formula of:Flavonoid-X—NR1R2 or Flavonoid-X—R1R2,
or a pharmaceutically acceptable salt thereof,wherein:the flavonoid is selected from the group consisting of flavone, flavonol, flavanone, and isoflavonoid;
X is a linker, wherein each linker independently comprises one or more groups selected from the group consisting of alkylene, ethyleneoxy, propyleneoxy, butyleneoxy, alkylC(O)—, ethylene amine, propylene amine, butylene amine, alkylcyclic amine, alkylcyclic diamine, or a combination thereof;
wherein:
(i) R1 is independently selected from the group consisting of H, —(CH2)n-aryl, and —(CH2)n-heteroaryl which may be optionally substituted; R2 is independently selected from the group consisting of H, —(CH2)n-aryl, and —(CH2)n-heteroaryl which may be optionally substituted; or
(ii) R1R2 forms a cyclic compound with a general structure of —(CH2)n—Y—(CH2)m— wherein Y is CH2, O, or NR1, any of which may be optionally substituted; and
wherein n and m are independently selected from an integer between 1 to 6.
US Pat. No. 10,115,963

NEGATIVE ELECTRODE MATERIAL FOR SECONDARY BATTERY AND SECONDARY BATTERY USING THE SAME

LG Chem, Ltd., (KR)

1. A negative electrode material for a secondary battery capable of intercalating and de-intercalating lithium, wherein the negative electrode material consists of alloy particles including a silicon phase and a metal phase, and a carbonaceous material, whereinthe silicon phase has a crystallite size of 10 nm or less,
the metal phase comprises two or more kinds of metals alloying with silicon but not with lithium,
the carbonaceous material has a crystallite size of 30 nm or more, and
the carbonaceous material is present on a surface of, or within the alloy particles.
US Pat. No. 10,113,150

ENGINEERED CARDIAC TISSUES AND METHODS OF USING THEM

InvivoSciences, Inc., Ma...

1. An engineered cardiac tissue comprising human cardiomyocyte cells comprising a transgene encoding a protein that results in resistance to a pharmacologic inhibitor wherein said transgene is operably linked to a cardiac-specific promoter, cardiac fibroblast cells and an extracellular matrix component, wherein the ratio of fibroblasts to cardiomyocytes is between 0.1:1 and 2:1, and wherein the tissue contracts coherently.
US Pat. No. 10,113,943

MULTIPLE AGGRESSOR HAIR ASSESSMENT METHOD

Conopco, Inc., Englewood...

1. A method of comparatively evaluating the efficacy of a series of hair products, the method comprising, in any order, the steps of;applying each individual product or product system to an individual test hair switch;
subjecting each hair switch to the same regime of two or more aggressors, once a day for 4 or more days; and
assessing and comparing a condition of the switches that have been treated with the product or product system and subjected to said regime,wherein the individual product or product system is selected from the group consisting of shampoos, conditioners, and styling products, and the condition is a measurable physical feature or characteristic of the hair switches.
US Pat. No. 10,113,180

WHEAT STEM RUST RESISTANCE GENE

Commonwealth Scientific a...

1. A transgenic plant which has integrated into its genome a transgene comprising an exogenous polynucleotide encoding an Sr33 polypeptide, the polypeptide comprising an amino acid sequence which is at least 95% identical to the sequence set forth as SEQ ID NO: 1, wherein the polynucleotide is operably linked to a promoter capable of directing expression of the polynucleotide in a cell of the plant.
US Pat. No. 10,111,932

COAGONISTS OF GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AND NEUROPEPTIDE Y2 RECEPTOR

Syracuse University, Syr...

1. A composition for simultaneously treating obesity and insulin deficiency, comprising a peptide sequence selected from the group consisting of HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3), HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4), IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2 (SEQ ID NO: 15), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2 (SEQ ID NO: 16), and HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY (SEQ ID NO: 17).
US Pat. No. 10,113,222

ALUMINIUM ALLOY WHICH IS RESISTANT TO INTERCRYSTALLINE CORROSION

Hydro Aluminium Rolled Pr...

1. Aluminium alloy consisting of alloy components, which have the following composition in % by weight:2.91%?Mg?4.5%,
0.5%?Mn?0.8%,
0.05%?Cu?0.30%,
0.05%?Cr?0.30%,
0.05%?Zn?0.9%,
Fe<0.40%,
Si<0.25%,
Ti<0.20%,the balance Al and impurities individually less than 0.05% and in total a maximum of 0.15% and wherein the following applies to the alloy components Zn, Cr, Cu and Mn:(2.3* %Zn+1.25* %Cr+0.65* %Cu+0.05* %Mn) +2.4?%Mg and
(2.3* %Zn+1.25* %Cr+0.65* %Cu+0.05* %Mn) +1.4?%Mg.
US Pat. No. 10,113,038

THERMOPLASTIC RESIN COMPOSITION FOR EXTERIOR MATERIAL, AND MOLDED

Lotte Advanced Materials ...

1. A thermoplastic resin composition for an exterior material, comprising:a thermoplastic resin and at least two cellulose fibers,
wherein the cellulose fibers are present in an amount of 0.1 parts by weight to 5 parts by weight relative to 100 parts by weight of the thermoplastic resin, and
wherein the cellulose fibers comprise first cellulose fibers having an average diameter of 5 ?m to 20 ?m and second cellulose fibers having an average diameter of 40 ?m to 400 ?m.
US Pat. No. 10,113,099

HIGH PRESSURE HIGH TEMPERATURE (HPHT) AQUEOUS DRILLING MUD COMPOSITION AND PROCESS FOR PREPARING THE SAME

ISP INVESTMENTS LLC, Wil...

1. An aqueous high-temperature high-pressure (HTHP) stable drilling mud composition comprising:i. about 20 wt. % to about 80 wt. % of 0-60% w/w brine solution;
ii. about 0.1 wt. % to about 3 wt. % of butylated reaction product of p-cresol and dicyclopentadiene;
iii. about 0.1 wt. % to about 10.0 wt. % of triethanol amine;
iv. (a) about 0.1 wt. % to about 10 wt. % of rheology modifier (RM); and (b) about 0.5 wt. % to about 30 wt. % of fluid loss additive (FLA), wherein said fluid loss additive (FLA) is a terpolymer of (a) about 30 to about 70 wt. % of acrylamide (AM), (b) about 30 to about 70 wt. % of 2-acrylamido-2-methyl propanesulfonic acid (AMPS), salts thereof, and (c) about 2.0 to about 50 wt. % of cationic monomer selected from the group consisting of quaternized (meth)acrylate monomers, quaternized (meth)acrylamide monomers, diallyldimethyl ammonium chloride (DADM AC), dimethylaminoethyl methacrylate (DMAEMA), 3-methacryloyloxy-2-hydroxypropyl-trimethylammonium chloride, 3-acrylamido-3-methylbutyl-trimethyl ammonium chloride, N-methyl-2-vinyl pyridinium methyl sulfate, N-propyl acrylamido trimethylammonium chloride, 2-methacryloyloxy-ethyl trimethyl ammonium methosulfate, acrylamidopropyltrimethylammonium chloride (APT AC), methacrylamidopropyltrimethylammonium chloride (MAPTAC), and combinations thereof;
v. about 20 wt. % to about 80 wt. % of weighting agent;
vi. about 0 wt. % to about 20 wt. % of drilling solid; and
vii. about 0 wtyryy. % to about 50 wt % of water.

US Pat. No. 10,117,338

METHOD FOR MANUFACTURING LIGHT EMITTING DEVICE

NICHIA CORPORATION, Anan...

1. A method for manufacturing a light emitting device comprising:joining a light transmissive substrate and two or more light emitting elements with top surfaces of the light emitting elements facing a bottom surface of the light transmissive substrate;
separating the light transmissive substrate into a plurality of light transmissive pieces such that one or more of the light emitting elements remains in a state joined to one of the light transmissive pieces after separation;
mounting the one or more of the light emitting elements joined to the one of the light transmissive pieces on a mounting unit, with a bottom surface of the one or more of the light emitting elements facing a top surface of the mounting unit;
removing a portion of the one of the light transmissive pieces joined with the one or more of the light emitting elements mounted on the mounting unit such that a top surface of the one of the light transmissive pieces becomes a predetermined shape; and
after the removing of the portion of the one of the light transmissive pieces, separating the mounting unit into a plurality of board pieces such that one or more of the light transmissive pieces remain on one of the board pieces after separation.

US Pat. No. 10,117,235

METHOD AND DEVICE FOR SUPPORTING HARQ IN UNLICENSED BAND

LG ELECTRONICS INC., Seo...

1. A method for supporting a hybrid automatic repeat request (HARQ) in an unlicensed band, the method comprising:receiving, by a user equipment, first downlink control information (DCI) including uplink scheduling information, the first DCI further including a carrier indicator field (CIF) indicating a cell to be scheduled;
determining, by the user equipment, a format of the DCI in accordance with a type of the cell indicated by the CIF; and
transmitting, by the user equipment, uplink data using the uplink scheduling information,
wherein, if the type of the cell indicated by the CIF is a licensed cell, the format of the DCI is determined as a first DCI format including a first resource allocation (RA) field used for the uplink scheduling information,
wherein, if the type of the cell indicated by the CIF is an unlicensed cell, the format of the DCI is determined as a second DCI format including a second RA field used for the uplink scheduling information,
wherein a number of bits for the second RA field is less than a number of bits for the first RA field,
wherein remaining bits of the first RA field are unused bits by the second RA field among the first RA field, and
wherein the remaining bits of the first RA field are defined as pre-set information, and most significant bit (MSB) of the remaining bits of the first RA field are pre-set to ‘1’.

US Pat. No. 10,117,182

COMMUNICATING CONTROL MESSAGES THAT INDICATE FREQUENCY RESOURCE INFORMATION TO RECEIVE DATA

InterDigital Technology C...

1. A method performed by a wireless device, the method comprising:receiving, by the wireless device, a wireless signal that includes a plurality of control messages, wherein each control message from the plurality of control messages points to a different message and indicates frequency resource information and coding information of data for each respective different message;
determining, by the wireless device, that a control message from the plurality of control messages corresponds to the wireless device; and
receiving, by the wireless device, the data pointed to by the control message that corresponds to the wireless device.

US Pat. No. 10,117,156

BLOCKED DEVICE CHECKING IN ROAMING SCENARIOS

T-Mobile USA, Inc., Bell...

1. A wireless telecommunication system comprising:one or more processors; and
one or more non-transitory computer-readable media storing computer-executable instructions that, when executed by the one or more processors, cause the one or more processors to perform actions comprising:
receiving, by a home wireless telecommunication network from a visited wireless telecommunication network, a request to grant a communication device access to the visited wireless telecommunication network, the request specifying a device identifier of the communication device;
determining whether the device identifier is specified as blocked within a database of device identifiers maintained by the home wireless telecommunication network; and
in response to determining that the device identifier is specified as blocked within the database of device identifiers, sending, to the visited wireless telecommunication network, a response to the request, the response denying the request to grant the communication device access to the visited wireless telecommunication network.

US Pat. No. 10,117,129

METHOD AND APPARATUS FOR BROADCASTING USING CHANNEL INFORMATION

Samsung Electronics Co., ...

1. An electronic device, comprising:a wireless communication module; and
a processor configured to:
transmit a broadcasting signal using at least one first channel predetermined among a plurality of channels, through the wireless communication module,
identify at least one channel used to transmit at least one signal by at least one external device, using the wireless communication module,
determine whether the at least one channel overlaps the at least one first channel,
determine at least one second channel among a remainder of the plurality of channels when the at least one channel overlaps the at least one first channel, and
transmit another broadcasting signal using the at least one second channel, through the wireless communication module.

US Pat. No. 10,117,105

NETWORK CONTROLLER, STATION, AND METHOD FOR ESTABLISHING GUARD PERIOD

Huawei Technologies Co., ...

1. A method, comprising:acquiring, by a first network controller, scheduling information of an adjacent network controller of the first network controller, wherein scheduling information of a network controller comprises an identifier of an access period scheduled by the corresponding network controller, and a start time and duration of the access period corresponding to the identifier of the access period, wherein the access period comprises a service period (SP) and a contention-based access period (CBAP);
determining, by the first network controller according to scheduling information of the first network controller and the scheduling information of the adjacent network controller, a status of time and frequency overlapping between a first SP and another access period, except the first SP, scheduled by the first network controller and the adjacent network controller;
setting, by the first network controller, guard period configuration information of the first SP according to a pre-acquired interfered status of the first SP and the status of time and frequency overlapping between the first SP and the other access period, except the first SP, scheduled by the first network controller and the adjacent network controller, wherein the guard period configuration information comprises first indication information or second indication information, wherein the first indication information is used to indicate that a guard period needs to be established for the first SP, and wherein the second indication information is used to indicate that the guard period is allowed to be established for the first SP; and
sending, by the first network controller, the guard period configuration information of the first SP to a source station and a destination station of the first SP, so that the source station and the destination station of the first SP determine, according to the guard period configuration information of the first SP, whether to establish the guard period for the first SP.

US Pat. No. 10,117,084

CONTEXT-DEPENDENT ALLOCATION OF SHARED RESOURCES IN A WIRELESS COMMUNICATION INTERFACE

Apple Inc., Cupertino, C...

1. A method implemented in a user device having a communication interface configured to concurrently receive and process global navigation satellite system (GNSS) signals and cellular voice signals, the method comprising:determining whether a cellular voice call is in progress;
in response to determining that a cellular voice call is in progress:
determining whether the cellular voice call is an emergency call; and
in response to determining that the cellular voice call is an emergency call:
identifying a GNSS scenario based on a current location estimation;
determining a current quality of service metric based on received GNSS signals;
determining a quality of service threshold based at least in part on the GNSS scenario;
determining whether the current quality of service metric exceeds the quality of service threshold;
if the quality of service metric exceeds the quality of service threshold, selecting a first operating state for the communication interface, wherein the first operating state prioritizes receiving and processing of cellular voice signals; and
if the quality of service metric does not exceed the quality of service threshold, selecting a second operating state for the communication interface, wherein the second operating state prioritizes receiving and processing of GNSS signals.

US Pat. No. 10,117,067

LOCATION-BASED SELECTION OF A SATELLITE TRANSMITTER OF A VEHICLE

iHeartCommunications, Inc...

1. A method comprising:at a hub station, receiving data from a satellite antenna controller coupled to a vehicle, the satellite antenna controller coupled to a first frequency band satellite transmitter and to a second frequency band satellite transmitter of the vehicle, wherein the data includes a location of the vehicle;
transmitting the data to a system of a regulatory authority of a jurisdiction; and
based on determining that the location is within a threshold distance of a boundary of the jurisdiction, sending at least one command to the satellite antenna controller based on a requirement of the jurisdiction, wherein the at least one command indicates a selection of the first frequency band satellite transmitter or the second frequency band satellite transmitter.

US Pat. No. 10,117,058

GENERATING A PRE-CACHING SCHEDULE BASED ON FORECASTED CONTENT REQUESTS

1. A method to be performed at a device, the method comprising:accessing information identifying a plurality of user devices within a particular coverage area of a wireless communication network;
accessing media consumption data indicating content requests corresponding to the plurality of user devices;
determining expected locations of the plurality of user devices based on the information;
determining forecasted content requests associated with the plurality of user devices based on the media consumption data, wherein determining a first forecast content request of the forecasted content requests includes determining, based on the media consumption data, that a first user device is expected to request particular media data at a first request time;
generating a pre-caching schedule of content based on the forecasted content requests and the expected locations;
determining that the pre-caching schedule indicates that the particular media data is to be provided via a multicast transmission to the first user device and to a second user device of the plurality of user devices;
sending an instruction from the device to the first user device, the instruction directing the first user device to store the particular media data; and
sending the particular media data via the multicast transmission to the first user device and to the second user device, the particular media data sent responsive to a request from the second user device.

US Pat. No. 10,117,039

AUDIO APPARATUS AND METHOD OF CONVERTING AUDIO SIGNAL THEREOF

SAMSUNG ELECTRONICS CO., ...

27. A method of converting an audio signal of an audio apparatus, the method comprising:determining an elevation component of a source by projecting a position of the source on a sound field of a two-dimensional (2D) plane onto a surface of a three-dimensional (3D) stereoscopic space, the source included in audio signals of a plurality of channels that form the sound field of the 2D plane; and
converting the audio signals of the plurality of channels into output audio signals of a plurality of channels based on the position and the elevation component of the source, wherein at least one channel among the output audio signals is an elevation channel.

US Pat. No. 10,117,038

GENERATING A SOUND LOCALIZATION POINT (SLP) WHERE BINAURAL SOUND EXTERNALLY LOCALIZES TO A PERSON DURING A TELEPHONE CALL

1. A method executed by a handheld portable electronic device (HPED) to generate a sound localization point (SLP) in empty space where binaural sound externally localizes to a person during a telephone call, the method comprising:determining, with the HPED, a location of the HPED with respect to a head of the person while HPED is within 1.5 meters from the head of the person;
generating, with the HPED, the SLP in empty space where the binaural sound will externally localize during the telephone call to the person in the empty space at the location where the HPED was located; and
convolving, with a processor in the HPED and during the telephone call between the person and another person and after the HPED is removed from the location where the SLP was generated, a voice of the another person so the voice of the another person externally localizes as the binaural sound to the person in the empty space at the location where the HPED was located to generate the SLP.

US Pat. No. 10,117,036

CALIBRATION METHOD AND CALIBRATION MODULE THEREOF FOR VIBRATION DEVICE

MediaTek Inc., Hsin-Chu ...

1. A calibration method for a vibration speaker, comprising:transmitting a plurality of vibration signals corresponding to a plurality of calibration frequencies to the vibration speaker and detecting a plurality of input currents or input power levels generated by an output stage of the vibration speaker corresponding to the plurality of calibration frequencies; and
determining a vibration point of a vibration unit of the vibration speaker according to the plurality of input currents or input power levels;
wherein the output stage is utilized for driving the vibration unit according to the plurality of vibration signals and comprises:
a first transistor, comprising a gate coupled to a first control voltage, a source coupled to a first voltage source, and a drain coupled to a first node that is coupled to the vibration unit;
a second transistor, comprising a gate coupled to a second control voltage, a source coupled to the first voltage source, and a drain coupled to a second node that is coupled to the vibration unit;
a third transistor, comprising a gate coupled to a third control voltage, a source coupled to a second voltage source, and a drain coupled to the first node; and
a fourth transistor, comprising a gate coupled to a fourth control voltage, a source coupled to the second voltage source, and a drain coupled to the second node.

US Pat. No. 10,116,843

ELECTRICAL BRACKET AND CIRCUIT CONDUCTING METHOD FOR CAMERA MODULE

Ningbo Sunny Opotech Co.,...

1. A camera module, comprising:an optical lens;
a photosensitive sensor which comprises a plurality of photosensitive sensor guides, wherein said optical lens is located along a photosensitive path of said photosensitive sensor;
a circuit board which comprises a plurality of circuit board guides;
an electrical bracket coupled on said circuit board;
a plurality of first connection units pre-formed on surfaces of said electrical bracket at predetermined locations, wherein when said photosensitive sensor is coupled at said electrical bracket, said photosensitive sensor guides are aligned with and electrically connected to said first connection units respectively to electrically connect said electrical bracket with said photosensitive sensor;
a plurality of second connection units pre-formed on said surfaces of said electrical bracket at predetermined locations, wherein when said electrical bracket is coupled on said circuit board, said circuit board guides are aligned with and electrically connected to said second connection units respectively to electrically connect said electrical bracket with said circuit board, such that said electrical bracket forms an electrical connection means for electrically connecting said photosensitive sensor with said circuit board; and
a driver, which comprises a plurality of driver guides, arranged for operatively coupling with said optical lens, wherein when said driver is coupled at said electrical bracket, said first connection units are aligned with and electrically connected to said driver guides respectively to electrically connect said electrical bracket with said driver, such that said electrical bracket not only forms an assembling means for connecting said driver with said optical lens but also forms said electrical connection means for electrically connecting said photosensitive sensor and said driver with said circuit board.

US Pat. No. 10,116,782

TELEPHONE DEVICE AND MOBILE-PHONE LINKING METHOD

PANASONIC INTELLECTUAL PR...

1. A telephone device, comprising:a landline telephone line interface unit;
a master-device control unit that controls the telephone device;
a short-distance wireless communication control unit that controls short-distance wireless communication of data with a mobile-phone;
an audio speaker; and
an audio processing unit, which, in operation, receives audio data from the mobile-phone using the short-distance wireless communication and causes the audio speaker to perform music playback by outputting the audio data from the mobile phone,
wherein, when the master-device control unit detects a caller operation of placing a call to a mobile-phone network by the telephone device during output of the audio data from the audio speaker, the master-device control unit notifies the short-distance wireless communication control unit of information on the caller operation of placing the call to the mobile phone network, and in response to the short-distance wireless communication control unit receiving the notification on the caller operation of placing the call to the mobile phone network, the short-distance wireless communication control unit starts processing that releases a radio resource for communicating the audio data, used for the music playback, from the mobile phone to the telephone device and sets, for the call, a radio resource for an audio path between the mobile phone and the telephone device.

US Pat. No. 10,116,731

METHOD AND SYSTEMS FOR PROVIDING DATA TO A REMOTE SITE

ONCAM GLOBAL, INC., Bill...

5. A method for providing requested data, the method comprising: sending, from a second server, to a first server a request for data; the second server not being a router; the request for data specifying a gateway; the request for data originating at a remote system; the request for data provided by the remote system to the second server; the second server providing the request for data directly to the first server; the request for data being a request for data from data-producing devices; the data-producing devices comprising at least one component selected from a camera, a binary switch, a multi-level switch, a binary sensor, thermostat controls, an access control device, a siren, chimes, a voice output device, a stepper motor controller, or a PWM speed controller; the gateway operatively connected over a network to the first server; the request for data comprising a predetermined port number at the second server; wherein the first server sends the request for data to the gateway and wherein the data is retrieved by the gateway; the gateway being operatively connected over the network to the second server; the gateway also being directly connected to the data-producing devices; and receiving at the second server and over the network, the data at the predetermined port number; the data being provided by the gateway; the second server providing the data, over the network, to the remote system; wherein the first server receives, from the gateway, component data characterizing a component operatively connected to the gateway; and wherein the first server obtains a virtual representation of said component; the virtual representation comprising a virtual control interface; the virtual control interface enabling providing commands/instructions to the component; wherein the second server comprises a data-rate-measuring component; and wherein the method further comprises: sending, over the network, an initiation signal, from the second server to the gateway, in order to initiate a data-rate-measuring test to measure data rates between the second server and the gateway; wherein, after initiation of the data-rate-measuring test, test data is provided by the gateway to the second server; determining, using the data-rate-measuring component, a data rate between the second server and the gateway; and providing, from the second server, the data rate to the gateway; wherein a data block size is calculated at the gateway in order to ensure a substantially predetermined block rate.

US Pat. No. 10,116,712

QUALITY OF EXPERIENCE BASED QUEUE MANAGEMENT FOR ROUTERS FOR REAL-TIME VIDEO APPLICATIONS

VID SCALE, INC, Wilmingt...

1. A node comprising a processor configured, at least in part, to:receive a first real-time video traffic flow, wherein a state variable is associated with the first real-time video traffic flow at the node, and wherein the first real-time video traffic flow comprises a plurality of packets and each packet comprises a lost packet indicator, wherein the lost packet indicators of the packets of the first real-time video traffic flow indicate whether the first real-time video traffic flow has experienced a packet loss;
receive a second real-time video traffic flow, wherein a state variable is associated with the second real-time video traffic flow at the node, and wherein the second real-time video traffic flow comprises a plurality of packets and each packet comprises a lost packet indicator, wherein the lost packet indicators of the packets of the second real-time video traffic flow indicate whether the second real-time video traffic flow has experienced a packet loss;
drop a first packet in the first real-time video traffic flow;
update the state variable associated with the first real-time video traffic flow at the node to indicate the dropped first packet; and
update the lost packet indicator for a second packet in the first real-time video traffic flow based on the updated state variable that indicates the dropped first packet.

US Pat. No. 10,116,611

PRIORITIZING MESSAGES WITHIN A MESSAGE NETWORK

Twitter, Inc., San Franc...

1. A computer-implemented method for ranking electronic messages for insertion into a message stream provided by a message sharing system, the method comprising:receiving a selection specifying a particular user in the message sharing system;
identifying, from the message sharing system, a plurality of posting users, wherein the particular user is subscribed to receive, in the message stream provided by the message sharing system, electronic messages broadcasted by respective posting users of the plurality of posting users;
retrieving a plurality of electronic messages broadcasted by the plurality of posting users;
for each electronic message of the plurality of electronic messages:
classifying the electronic message of the plurality of electronic messages based on one or more properties of content included in the electronic message,
computing a respective level of connectedness between the particular user and a respective posting user of the plurality of posting users who broadcasted the electronic message, and
computing, by one or more computers, a respective score for the electronic message, the score representing a likelihood that the particular user will interact with the electronic message based on the properties of content included in the electronic message and the level of connectedness between the particular user and the respective posting user of the plurality of posting users who broadcasted the electronic message;
ranking the plurality of electronic messages based on the computed scores to generate a ranked set of electronic messages; and
selecting, from the ranked set of electronic messages, one or more electronic messages for insertion into the message stream for the particular user.

US Pat. No. 10,116,540

SYSTEM, METHOD, AND COMPUTER PROGRAM FOR MANAGING DATA OBJECTS IN A MULTIPROCESSOR UNIT TELECOMMUNICATIONS NETWORK

AMDOCS DEVELOPMENT LIMITE...

1. A computer program product embodied on a non-transitory computer readable medium, comprising:computer code for identifying a plurality of data objects within a network;
computer code for assigning, within a responsibility map, each of the plurality of data objects to one of a plurality of processing modules;
computer code for distributing the responsibility map to each of the plurality of processing modules, where each of the plurality of processing modules use the responsibility map to determine the data objects assigned thereto and to process only events specific to the determined data objects;
computer code for monitoring the plurality of processing modules;
computer code for determining whether each of the plurality of processing modules is available to process the events specific to the data objects assigned thereto, based on the monitoring;
computer code for automatically reassigning, within the responsibility map, at least one first data object of the plurality of data objects that are assigned to a first processing module of the plurality of processing modules to a second processing module of the plurality of processing modules, in response to determining the first processing module of the plurality of processing modules is not available to process the events specific to the at least one first data object of the plurality of data objects assigned thereto and that the second processing module of the plurality of processing modules is available to process the events specific to the at least one first data object of the plurality of data objects; and
computer code, responsive to the automatic reassigning within the responsibility map, for distributing the responsibility map having the reassignment to each of the plurality of processing modules, where each of the plurality of processing modules use the responsibility map having the reassignment to determine the data objects assigned thereto and to process only events specific to the determined data objects;
storing, by a server, in an In-Memory Data Grid (IMDG):
the plurality of data objects, and
for each of the plurality of data objects, an indicator of an owner of the data object, the owner being a last one of the plurality of processing modules to perform a read operation on the data object;
wherein the second processing module, responsive to receiving the responsibility map having the reassignment:
identifies from the responsibility map the at least one first data object of the plurality of data objects that has been reassigned to the second processing module, and
automatically reads the at least one first data object of the plurality of data objects, to cause the indicator of the owner of the at least one first data object in the IMDG to be updated to be an identifier of the second processing module;
utilizing the IMDG to control, by the server, modifications to the data objects by the processing modules including, for each of the data objects, only permitting the owner of the data object, as indicated by the indicator of the owner stored by the IMDG for the data object, to modify the data object.

US Pat. No. 10,116,535

MONITORING INTERNET USAGE ON HOME NETWORKS OF PANELIST USERS USING A MEASUREMENT DEVICE

comScore, Inc., Westlake...

1. A computer-implemented method executed by one or more processors, the method comprising:identifying a home network including one or more devices and a gateway configured to receive network traffic from the devices and send the received network traffic to an external network;
configuring the home network to send network traffic from the devices to a measurement device connected to the gateway;
after configuring the home network, monitoring, at the measurement device, network traffic received from the devices on the home network;
evaluating, at the measurement device, one or more characteristics of the home network, wherein the one or more characteristics comprise at least one of: a quantity of devices; types of devices; types of network traffic sent by devices; usage patterns of devices; a quantity of devices with public IP addresses; an Internet Service Provider; and subnet masks of devices;
determining, based on the one or more characteristics of the home network, a network fingerprint of the home network;
comparing, at the measurement device, the network fingerprint to stored network fingerprints to aid in determining the type of the home network that the home network comprises; and
determining, based on the comparing, a type of the home network.

US Pat. No. 10,116,454

AUTHENTICATION SYSTEM AND AUTHENTICATION METHOD

PANASONIC INTELLECTUAL PR...

1. An authentication method in an authentication system including a server, a device, and a first controller that controls the device, the authentication method comprising:storing, at the device, a first certificate revocation list and device history information, the first certificate revocation list having first age-identifying information;
storing, at the server, a second certificate revocation list, the second certificate revocation list having second age-identifying information;
transmitting, from the device to the first controller, device history information with the first age-identifying information of the first certificate revocation list;
transmitting, from the first controller to the server, the device history information with the first age-identifying information of the first certificate revocation list and added authentication information;
comparing, at the server, the first age-identifying information of the first certificate revocation list to the second age-identifying information of the second certificate revocation list;
if the first age-identifying information is indicated to be older than the second age-identifying information, judging that the first controller is unauthorized; and
if the first age-identifying information is indicated to be same as or younger than the second age-identifying information, judging that the first controller is authorized and judging that the first controller is set to receive an updated certificate revocation list from the server,
wherein, when the first controller is judged to be unauthorized, the server no longer transmits the updated certificate revocation list to the first controller.

US Pat. No. 10,116,428

ECHO CANCELLATION FOR HIGH SPEED FULL DUPLEX DATA TRANSMISSIONS

Lattice Semiconductor Cor...

1. An apparatus comprising:a first set of differential nodes to receive a reception data and a transmission data;
a second set of differential nodes to receive the transmission data; and
a subtraction circuit to receive data from the first set of differential nodes and data from the second set of differential nodes, the subtraction circuit further comprising:
a plurality of capacitors to receive data from each of the first and second sets of differential nodes, wherein inputs of a first pair of the capacitors are coupled to the second set of differential nodes and inputs of a second pair of the capacitors are coupled to the first set of differential nodes; and
a termination circuit for providing DC termination voltage to subtract the data of the second set of differential nodes from the data of the first set of differential nodes to eliminate echo from the reception data received at the first set of differential nodes, wherein an output of a first capacitor from the first pair and an output of a first capacitor from the second pair are coupled to a first node of the termination circuit, and an output of a second capacitor from the first pair and an output of a second capacitor from the second pair are coupled to a second node of the termination circuit.

US Pat. No. 10,116,396

MILLIMETER-WAVE SOURCELESS RECEIVER

HUAWEI TECHNOLOGIES CANAD...

1. A receiver comprising:a planar antenna array including at least three antennas, each antenna being configured for simultaneously receiving a local oscillator (LO) signal from a near field region and a radio frequency (RF) signal from a far field region;
each antenna being coupled to a respective quasi-optical mixer, each quasi-optical mixer including only passive components and outputting a respective intermediate frequency (IF) signal;
at least two six-port demodulators, each six-port demodulator receiving a respective different pair of IF signals as input and outputting signals representing baseband power of the respective pair of IF signals, each six-port demodulator including only passive components; and
a processor coupled to receive output from the six-port demodulators, the processor being configured to calculate direction of arrival (DoA) for the LO signal and the RF signal using the output from the six-port demodulators.

US Pat. No. 10,116,377

DYNAMIC FORWARD ERROR CORRECTION BYPASS IN A DIGITAL COMMUNICATIONS SYSTEM

Google LLC, Mountain Vie...

1. A method of improving communications, comprising:receiving a first packet at a gateway communicatively coupled to an end terminal through an unmanned air vehicle (UAV), wherein a first wireless link communicatively couples the gateway to the UAV, and a second wireless link communicatively couples the UAV to the end terminal;
determining, with one or more processors, a signal quality on at least the first link between the gateway and the UAV in a first direction;
when the signal quality exceeds a first predetermined threshold:
encoding, at the gateway, the first received packet for processing by the end terminal;
tagging the first received packet with an indicator to bypass forward error correction (FEC) at the UAV;
monitoring, with the one or more processors at the gateway, the signal quality on at least the first link;
comparing the monitored signal quality to a second threshold lower than the first threshold; and
when the monitored signal quality falls below the second threshold lower, encoding, at the gateway, the first received packets for processing by the UAV.