US Pat. No. 10,111,414

FISHING LINE GUIDE, REEL SEAT AND FISHING ROD INCLUDING THE SAME

FUJI KOGYO CO., LTD., Sh...

1. A reel seat, comprising:an attachment portion having a tip end and a base end and contacting a fishing rod, a winding thread being wound around the attachment portion;
a support leg frame extending from the base end of the attachment portion and integrally formed with the attachment portion; and
a seat body extending from the base end of the attachment portion and composited with the support leg frame throughout at least an overall length of the support leg frame,
wherein the attachment portion and the support leg frame are made of a metallic material,
wherein the seat body is partially or wholly made of a plastic material, and
wherein a sectional area of at least a portion of the support leg frame gradually decreases toward a tip end of the support leg frame.

US Pat. No. 10,111,408

CINCHING DOG COLLAR AND LEASH

1. An integrated animal collar and double-strap lead device comprising:a collar to be removably placed around the neck of an animal,
the collar having a throat strap with a first end and a second end, with
said first end connected to a large eye of a first reducing loop, and
said second end of said throat strap threaded through a slide buckle and extended through a large eye of a second reducing loop,
the collar having an upper neck strap received against the back of the animal's neck opposite said throat strap, said upper neck strap having a first end and a second end,
said first end of said upper neck strap threaded through a small eye of said first reducing loop, and connected to a first ring,
said second end of said upper neck strap threaded through a small eye of said second reducing loop, and connected to a second ring; and
an elongated lead with a first strap and a second strap, said first strap having a first end and a second end and said second strap having a first end and a second end,
a handle grip with a first end and a second end, said handle grip said first end permanently connected to said first strap said second end, and said handle grip said second end permanently connected to said second strap said second end,
said first strap said first end threaded through a first lead slide buckle and connected to a first end of a first swivel snap,
said first swivel snap having a first end and a second end, said second strap said first end threaded through a second lead slide buckle and and connected to a first end of a second swivel snap,
said second swivel snap having a first end and a second end.

US Pat. No. 10,111,404

PET GROOMING TUNNEL

1. A pet grooming device comprising:a ring member that includes a plurality of brush bristles oriented inwardly;
wherein the ring member is supported in a vertical orientation and is configured to receive an animal there through such that said plurality of brush bristles is configured to brush a fur or hair of said animal;
wherein the ring member is further defined with an inner diameter, an outer diameter, and a width;
wherein the plurality of brush bristles form a truncated conical opening as the plurality of brush bristles extend from a first side to a second side forming the width of the ring member;
wherein the ring member is supported in a vertical orientation;
wherein the ring member is attached to a pair of support legs;
wherein the pair of support legs are each further defined as a “U”-shaped bracket that is inverted, and includes telescoping feet that extend downwardly from an opening provided on either side of the “U” shaped bracket;
wherein the inner diameter is configured to be sized to enable said animal to pass through the ring member;
wherein the ring member is further defined with an inner surface that is adorned with a plurality of brush bristles;
wherein the plurality of brush bristles are concentrically oriented, and extend from the inner surface of the ring member towards a central axis of the ring member;
wherein the plurality of brush bristles are concentrically aligned with respect to one another and the inner surface of the ring member;
wherein the plurality of brush bristles are affixed to and extend outwardly from the inner surface of the ring member;
wherein the plurality of brush bristles are further defined with a bristle length;
wherein the bristle length is less than the inner diameter;
wherein the plurality of brush bristles form a brush opening that is configured to enable the animal to enter through the ring member;
wherein the pair of support legs attach to opposing sides of the ring member;
wherein the ring member is further defined with an outer surface;
wherein the pair of support legs are affixed to the outer surface of the ring member;
wherein the pair of support legs are configured to interface with the ground surface;
wherein the “U”-shaped bracket includes a plurality of pin holes;
wherein the telescoping feet includes a spring-loaded button that interfaces with the plurality of pin holes in order to raise and lower the ring member with respect to the ground surface;
wherein the telescoping feet can adjust a relative location with respect to the “U” shaped bracket in order to adjust an elevation of the ring member with respect to the ground surface;
wherein the ground surface is outfitted with engagement pegs that secure the telescoping feet thereto;
wherein engagement holes are provided on the telescoping feet in order to interface with the engagement pegs.

US Pat. No. 10,111,403

DISPOSABLE KITTY LITTER BOX

1. A disposable kitty litter box comprising:a base portion;
a plurality of layer portions each including a plurality of apertures and detent/indent structures, each of the plurality of apertures and detent/indent structures having an oblong profile, wherein lengthwise portions of a given said detent/indent structure run on opposite sides of a corresponding said aperture longitudinally;
wherein, in an assembled configuration, the plurality of layer portions are arranged in a stack, the plurality of apertures of each layer portion of the plurality of layer portions are offset from each other to keep kitty litter from passing between the stacked layer portions, and indents of the detent/indent structures of a top layer portion of the layer portions engage with detents of a next, lower layer portion of the layer portions to thereby form a seal therebetween and prevent seepage of liquid through the apertures of the top layer portion; and
in each of the layer portions, in a widthwise direction of the apertures, the detent/indent structures are arranged with respect to the apertures in at least one sequence of: a first detent/indent structure, a first aperture, a second detent/indent structure, a flat surface, a third detent/indent structure, and a second aperture, the flat surface extending continuously between the second and third detent/indent structures and facing an aperture of a next layer portion in the stack.

US Pat. No. 10,111,401

SYSTEM AND METHOD FOR DETERMINING WHETHER TO OPERATE A ROBOT IN CONJUNCTION WITH A ROTARY PARLOR

Technologies Holdings Cor...

1. A system comprising: a three-dimensional camera; a processor communicatively coupled to the three-dimensional camera, the processor configured to: determine a first hind location of a first hind leg of a dairy livestock based at least in part on visual data captured by the three-dimensional camera, wherein the dairy livestock is positioned in a stall of a rotary milking platform; determine a second hind location of a second hind leg of the dairy livestock based at least in part on the visual data; determine a measurement, wherein the measurement is the distance between the first hind location and the second hind location; and determine whether the measurement exceeds a minimum threshold; and a robotic arm coupled to the three-dimensional camera and positioned on a linear track separate from and adjacent to a curved portion of the rotary milking platform, wherein the robotic arm and the three-dimensional camera move laterally along the track as the rotary milking platform rotates such that the robotic arm moves along the linear track at a rate corresponding to the rotational speed of the rotary milking platform and the processor determines whether the measurement between the first and second hind locations of the dairy livestock exceeds a minimum threshold while the rotary milking platform is in motion.

US Pat. No. 10,111,393

PLANT POTS WITH STABILIZING STAKES AND RELATED METHODS

1. A plant pot assembly comprising:a plant pot defining an interior volume having an upper pot edge including a mounting flange;
a plurality of peripheral stakes attached to the mounting flange and extending upwardly therefrom around the upper pot edge; and
a drainage plate configured to be positioned above a bottom surface of the plant pot; and
wherein at least one of the bottom surface and drainage plate comprises a plurality of ridges that enables the drainage plate to be held at a certain altitude above the bottom surface, creating a drainage chamber therebetween;
wherein each of the plurality of stakes has a vertical lower portion and at least one upper portion, and wherein each upper portion forms at least one specific angle with the vertical lower portion; andwherein the angle between the vertical lower portion and the at least one upper portion range from 5 degrees to 40 degrees.

US Pat. No. 10,111,391

AGRICULTURAL BALER WITH AUXILIARY POWER SYSTEM FOR POWERING VARIOUS FUNCTIONAL COMPONENTS ONBOARD THE BALER

CNH Industrial America LL...

1. An agricultural baler, comprising:a flywheel;
a driveline associated with the flywheel and couplable with a power take-off (PTO) of a traction unit;
a plunger reciprocally movable in a bale chamber during a compression cycle having a compression stroke and a return stroke;
at least one functional component onboard the baler configured for performing a function on the baler separate from the flywheel and plunger; and
an auxiliary power system coupled with the driveline, said auxiliary power system being configured for receiving power from the driveline, storing the power, and utilizing the stored power to power the at least one functional component.

US Pat. No. 10,111,390

AUXILIARY POWER SYSTEM FOR AN AGRICULTURAL BALER WITH FLYWHEEL START UP

CNH Industrial America LL...

1. An agricultural baler, comprising:a main bale chamber;
a plunger reciprocally movable within the main bale chamber during a compression stroke and a return stroke;
a flywheel associated with the plunger;
a driveline associated with the flywheel and couplable with a power take-off (PTO) of a traction unit;
an auxiliary power system (APS) coupled with the driveline and configured for receiving power from the driveline, storing the power, and transmitting the stored power back to the driveline; andan electrical processing circuit coupled with the APS, said electrical processing circuit being operable to control operation of the APS to rotate the flywheel upon start up of the baler.

US Pat. No. 10,111,389

NON-STOP BALING SYSTEM

1. A baling system, comprising:a work machine including a chassis and a drive system for driving the work machine in a direction of travel along a ground surface;
a baler coupled to the work machine, the baler including a crop pickup assembly and a housing for defining an internal chamber, where the crop pickup assembly is configured to collect crop in the chamber from an underlying windrow located on the ground surface in the direction of travel as the baler moves along the underlying windrow;
at least one sensor coupled to the baler, the sensor configured to detect an amount of crop collected in the chamber; and
a windrow diverter having a divert position and a bypass position, the windrow diverter disposed at a location forward of the crop pickup assembly relative to the direction of travel;
wherein, when the amount of crop detected by the sensor in the chamber exceeds a threshold amount, the baler operably executes a wrap or eject cycle and the sensor transmits a first signal for operably controlling the windrow diverter to its divert position;
wherein, in the divert position, the windrow diverter operably diverts the crop from the underlying windrow along the round surface to an adjacent ground surface in a direction away from the crop pickup assembly as the baler continuously moves in the direction of travel.

US Pat. No. 10,111,386

HARVESTER DELIVERY CONTROL SYSTEM

CNH Industrial America LL...

1. A system for distributing crop material, severed from a field on a cleaning sieve of an agricultural combine, during its forward motion, comprising:a threshing system;
a sieve positioned and configured for receiving crop material containing grain from the threshing system and allowing the grain and smaller elements of the crop material to pass through the sieve while guiding and propelling a flow of larger elements of the crop material past an edge of the sieve;
a crop material distributor disposed between the threshing system and the sieve, configured and operable for distributing the crop material from the threshing system rearwardly onto the sieve;
a sensor configured and operable in response to sensing information representative of a quantity of grain associated with the crop material distributor and a forward-rearward inclination angle associated with the crop material distributor relative to the forward motion of said agricultural combine and outputting signals representative thereof; and,
a controller in connection with the sensor operable for receiving signals outputted thereby, the controller outputting signals to the crop material distributor and the sieve for independent operable control of operating parameters associated with the crop material distributor and the sieve in response to receiving signals representative of a quantity of grain associated with the crop material distributor and said forward-rearward inclination angle associated with the crop material distributor, wherein the controller is configured to adjust the operating parameters of the crop material distributor to control crop material flow from the crop material distributor to the sieve wherein operable control of operating parameters associated with the crop material distributor and the sieve consists of at least one of controlling rotational speed of at least one of an auger, a conveyor belt, and a raddle chain that form a portion of the crop material distributor in response to the signals from the sensor, and a variance of reciprocating movement speed of at least one of the crop material distributor and the sieve, and a variance of a reciprocating movement of at least one of the crop material distributor and the sieve in a first direction, a variance of a reciprocating movement of at least one of the crop material distributor and the sieve in a second direction, and a combination thereof.

US Pat. No. 10,111,384

AGRICULTURAL CHOPPER WITH LINKED COUNTER KNIVES AND SHEAR BAR

CNH INDUSTRIAL AMERICA LL...

1. An agricultural harvester, comprising:a chassis;
a threshing and separating assembly carried by said chassis; and
a chopper assembly carried by said chassis that receives crop material from said threshing and separating assembly, said chopper assembly including:
at least one movable chopping knife;
a plurality of counter knives movable between a first knife position and a second knife position, said plurality of counter knives configured to cooperate with said at least one chopping knife to cut crop material when in said first knife position;
a shear bar movable between a first bar position and a second bar position; and
a linkage assembly connected to said plurality of counter knives and said shear bar such that said linkage assembly is selectively actuable to simultaneously move said plurality of counter knives between said first knife position and said second knife position and said shear bar between said first bar position and said second bar position,
wherein said linkage assembly includes a pivotable knife arm linked to said plurality of counter knives and a pivotable bar arm linked to said shear bar, wherein pivoting of said knife am moves said plurality of counter knives between said first knife position and said second knife position and pivoting of said bar arm moves said shear bar between said first bar position and wherein said linkage assembly further includes an engagement cam that is rotated by a shaft and that engages at least one surface of said bar arm.

US Pat. No. 10,111,381

WALK POWER MOWER WITH TRANSMISSION PROVIDING BOTH FORWARD AND REVERSE PROPULSION

THE TORO COMPANY, Bloomi...

1. A walk power equipment unit comprising:a housing supported upon the ground by at least a front wheel and a rear wheel, the housing adapted to traverse the ground in both a forward direction and an opposite, reverse direction;
a handle comprising a handle member extending upwardly and rearwardly from the housing, wherein the handle member includes: an upper end; and a lower end, the lower end attached to the housing;
a prime mover carried by the housing; and
a variable speed traction drive system carried by the housing, the traction drive system comprising:
a bidirectional transmission operatively connected to a drive wheel selected from the group comprising the front wheel and the rear wheel, the transmission operable to selectively rotate the drive wheel to propel the housing over the ground; and
a control system comprising a handle grip translatable along the handle member, wherein the handle grip activates the transmission to power the drive wheel for movement of the housing in the forward direction when the handle grip is translated downwardly along the handle member from a neutral position, and wherein the handle grip activates the transmission to power the drive wheel for movement of the housing in the reverse direction when the handle grip is translated upwardly along the handle member from the neutral position.

US Pat. No. 10,111,380

HEADER HEIGHT CONTROL SYSTEM WITH MULTIPLE HEIGHT SENSORS

CNH Industrial America LL...

1. A header system, comprising:a frame;
a cutter carried by said frame;
a cutter height sensor associated with said cutter and configured to output a cutter height signal;
a gauge wheel carried by said frame behind said cutter;
a wheel sensor associated with said gauge wheel and configured to output a wheel position signal; and
a controller electrically coupled to said cutter height sensor and said wheel sensor, said controller configured to:
receive said cutter height signal;
receive said wheel position signal;
compare said cutter height signal to said wheel position signal to determine that a terrain irregularity is present; and
activate at least one actuator of an actuator system to adjust said frame in response to said determining that said terrain irregularity is present.

US Pat. No. 10,111,377

SYSTEM FOR DRIVING A SEED METER VIA A FLEXIBLE SHAFT

CNH Industrial America LL...

1. A seed meter drive system, comprising:a flexible drive shaft;
a clutch that in operation receives a first rotational input from the flexible drive shaft, wherein the clutch comprises a toolless fastener that in operation selectively couples a housing of the clutch to a housing of a downstream component; and
a gearbox that in operation receives a second rotational input from the clutch and drives a seed meter in rotation while the housing of the clutch is coupled to the housing of the downstream component and the clutch is engaged.

US Pat. No. 10,111,375

SEED METER FOR PLANTING MULTIPLE TYPES OF SEED IN A SINGLE PLANTING PASS

CNH Industrial America LL...

1. A seed meter for planting multiple types of seed in a single planting pass during row-crop planting of an agricultural field, the seed meter comprising:a housing supported relative to a row unit of a planter, the housing having:
an intermediate portion arranged between a first side portion of the housing and a second side portion of the housing;
a first seed chamber defined in the intermediate portion of the housing and storing seeds of a first type; and
a second seed chamber defined in the intermediate portion of the housing and storing seeds of a second type; a first seed disk assembly arranged within the first side portion of the housing for rotatably conveying individual seeds of the first type from the first seed chamber through the housing and out of the seed meter for individually planting the seeds of the first type during row-crop planting of an agricultural field;
a second seed disk assembly arranged within the second side portion of the housing for rotatably conveying individual seeds of the second type from the second seed chamber through the housing and out of the seed meter for individually planting the seeds of the second type during row-crop planting of an agricultural field; and
a divider wall dividing the first and second side portions of the housing from each other.

US Pat. No. 10,111,373

AUTONOMOUS SYSTEMS, METHODS, AND APPARATUS FOR AG BASED OPERATIONS

Kinze Manufacturing, Inc....

1. A method of transporting a plurality of autonomous vehicles from a first location to a second location, the method comprising:providing a master unit;
connecting one or more autonomous vehicles to the master unit such that the master unit is configured to continuously communicate information to the vehicles;
wherein the one or more autonomous vehicles include information obtaining devices electrically connected to an intelligent control and an implement capable of performing one of a plurality of agricultural based operations selected from the group consisting of a. planting; b. tilling; c. baling; d. harvesting; e. spraying; f. transporting; and g. cultivating;
transporting the master unit in a leading path between the first location and the second location;
generating a following path for the one or more autonomous vehicles based on information related to the leading path of the master unit;
continuously communicating the following path to the one or more autonomous vehicles such that the autonomous vehicles travel in the following path of the leading path based upon said communicated information; and
automatically adjusting, based upon one or more regulations along the path, a physical aspect of the one or more autonomous vehicles during transport to comply with the one or more regulations, said physical aspect comprising a width of the vehicle or a height of the vehicle.

US Pat. No. 10,111,371

WEARING PART ARRANGEMENT FOR PLOUGH SHARE

KVERNELAND GROUP OPERATIO...

1. A plough comprising left- and right-facing plough bodies, each of the left- and right-facing plough bodies comprising:a mould board;
a ploughshare that forms a leading edge of a respective one of the left- and right-facing plough bodies, the leading edge configured to lie in a working position substantially parallel to a soil surface of an area being ploughed; and
a wearing-part arrangement for the leading edge provided on the ploughshare, the wearing-part arrangement comprising a plough point configured to be releasably attached to the ploughshare, the plough point having a pointed front portion,
wherein at least the front portion is mirror-symmetrical around a longitudinal axis of the plough point and has a first oblique face and a second oblique face diverging in a direction of a socket on the plough point and merging with a first side edge surface and a second side edge surface,
wherein the first oblique face is bounded by a first cutting edge, and the second oblique face is bounded by a second cutting edge,
wherein when the plough point is attached to the ploughshare, at least a rear portion of the second oblique face and the second side edge surface adjacent to the second oblique face project beyond a ploughshare side edge, and
wherein the plough point includes a transverse elevation projecting from an upper face thereof.
US Pat. No. 10,111,832

ORODISPERSIBLE TABLETS OBTAINED BY COMPRESSION MOLDING

ETHYPHARM, Saint-Cloud (...

1. A compression molding process for preparing an orodispersible tablet, comprising the steps of:preparing using a humidification method a wet mixture of excipients consisting of from 65 wt % to 90 wt % diluent based on a total weight of the wet mixture of excipients, a disintegrant, a sweetener, a binder, and less than 3 wt % of a humectant based on a total weight of the wet mixture of excipients, said excipients being in the form of grains, wherein the humectant is macrogol glyceride, and wherein the wet mixture of excipients has a residual humidity or water content of from 2% to 3%;
preparing coated microcrystals or microgranules of active principle;
mixing the coated microcrystals or microgranules of active principle with the wet mixture of excipients to obtain a mixture for compression; and
compressing the mixture for compression to obtain a tablet.
US Pat. No. 10,111,839

METHODS AND COMPOSITIONS PARTICULARLY FOR TREATMENT OF ATTENTION DEFICIT DISORDER

Purdue Pharma, Pickering...

when tested according to the USP paddle method, 100 rpm, at 37° C.; (i) starting with 900 ml simulated gastric fluid for 2 hours, (ii) followed by 900 ml phosphate buffer pH 6.0 for 4 hours, and (iii) for the 7th hour onwards, 900 mL of phosphate buffer pH 7.4; USP <711> Acceptance Table 2; andwherein the oral solid pharmaceutical composition provides, in a fed state, an in vivo methylphenidate Tmax0-4 of about 3 hours and a methylphenidate Tmax8-16 of about 13.5 hours.
US Pat. No. 10,111,840

USE OF CANNABINOIDS IN THE TREATMENT OF EPILEPSY

GW Pharma Limited, Visio...

1. A method of treating atonic seizures in a patient suffering from Dravet syndrome or Lennox-Gastaut syndrome, comprising administering cannabidiol (CBD) to the subject in need thereof, wherein the purity of the CBD is at least 98% (w/w) and comprises not more than 0.15% (w/w) ?9-tetrahydrocannabinol, and wherein the dose of the CBD is about 20 mg/kg/day.
US Pat. No. 10,111,842

EUTECTIC SOLVENTS AND USES THEREOF

University of Oslo, Oslo...

1. A method of killing or inhibiting the growth of a bacterial cell, fungal cell, or cancer cell, comprising:contacting said cell with a composition comprising a eutectic solvent and a photosensitizer selected from the group consisting of a porphyrin compround, a chlorin compound, a bacteriochlorin compound , a phthalocyanine compound, a texaphyrin comppund, a sapphyrin compound a porphycene compound, a curcuminoid compound, and a flavin compound.
US Pat. No. 10,112,868

METHOD FOR POST-CONSUMER WASTE SEGREGATION, COMMINUTION, AND CREATION OF CEMENTITIOUS AGGREGATE MATERIAL

1. A method for post-consumer waste segregation, comminution, and creation of a cementitious aggregate material comprising the steps of:shredding partially processed post-consumer waste to a reduced size said partially processed post-consumer waste comprising:
non-metallic waste;
plastic waste;
to ferrous waste;
zorba;
entering said shredded waste into a processing stream;
magnetically forcing ferrous waste from the processing stream;
comminuting partially processed post-consumer waste to a reduced, standardized particulate size of consistent bulk density;
adding silica to the processing stream and binding of the silica to plastic waste particles by action of heat effective to form an insulating cementitious aggregate, whereby bulk density of plastic waste particles is increased relative other, non-plastic waste in the processing stream and any static cling between plastic particles and other non-plastic waste particles is obviated;
subjecting the processing stream to eddy currents devised to forcibly eject zorba away from remaining non-metallic waste;
collecting non-metallic waste separated from recyclable metallic waste;
directing zorba for reclamation of recyclable metals; and
collecting the cementitious aggregate free of metallic waste;
wherein separation of plastic waste from ferrous waste and zorba is rendered effective to enable reclamation of ferrous and non-ferrous metals from the waste stream during creation of a cementitious aggregate segregable for use as a building material.
US Pat. No. 10,111,844

LYOPHILIZED MESNA COMPOSITIONS

AUXIN SURGERY SA, Louvai...

1. A method of performing surgery comprising administering a lyophilizate composition having improved stability and shelf-life at a cleavage plane of a patient on which the surgery is performed, the lyophilizate composition consisting of 30 to 100% of Mesna and 0 to 70% of additional ingredients selected from the group consisting of excipient, buffering agent, Mesna disulfide and other impurities, wherein a sum of the percentage of the Mesna disulfide and the other impurities is lower than 3%.
US Pat. No. 10,112,871

CARBONATE-BONDED CONSTRUCTION PRODUCTS FROM STEEL-MAKING RESIDUES AND METHOD FOR MAKING THE SAME

1. A method for making a construction block, comprisingproviding granular material and a binder consisting of steel slag;
combining the granular material, the binder with water to a first water-to-slag ratio;
molding the combined granular material, binder and water;
reducing the quantity of water in the molded granular material, binder and water to a second water-to-slag ratio that is lower than the first water-to-slag ratio;
curing said molded granular material, binder and water having said second water-to-slag ratio with carbon dioxide.
US Pat. No. 10,111,846

S ISOMERS OF ALPHA-METHYL-HYDROCINNAMIC ACID FOR THE TREATMENT OF BLOOD DISORDERS

1. A method for treating a subject, comprising administering to the subject an oral pharmaceutical formulation comprising:a. a pharmaceutically effective amount of an S isomer of ?-methyl-hydrocinnamic acid, or a pharmaceutically acceptable salt thereof; and
b. a pharmaceutically acceptable carrier or diluent,
wherein the oral pharmaceutical formulation comprises less than 6% of the R isomer of ?-methyl-hydrocinnamic acid and wherein the oral pharmaceutical composition is in solution or a dry solid,
wherein the oral pharmaceutical formulation is administered to the subject by oral administration, and
wherein the subject has been selected for administration of the oral pharmaceutical composition as one who will undergo a chemotherapeutic treatment or a radiation treatment or radiation exposure after the administration of the oral pharmaceutical formulation.
US Pat. No. 10,112,873

CERAMICS WITH ENGINEERED MICROSTRUCTURES VIA 3D PRINTING AND TEMPLATED GRAIN GROWTH

RAYTHEON COMPANY, Waltha...

1. A three-dimensional (3D) printing composition, comprising:ceramic filaments, each ceramic filament comprising an additive and having an extrusion direction, at least 50% of the additive of each ceramic filament being aligned with respect to the extrusion direction, and each additive having an aspect ratio of at least 2:1.
US Pat. No. 10,114,924

METHODS FOR PROCESSING OR ANALYZING SAMPLE OF THYROID TISSUE

Veracyte, Inc., South Sa...

1. A method for processing or analyzing a sample of thyroid tissue of a subject, comprising:(a) obtaining said sample of thyroid tissue of said subject, wherein said subject has or is suspected of having thyroid cancer, and wherein said sample of thyroid tissue comprises gene expression products;
(b) subjecting a first portion of said sample of thyroid tissue to cytological testing that indicates that said first portion of said sample of thyroid tissue is indeterminate;
(c) upon identifying said first portion of said sample of thyroid tissue as indeterminate, assaying by sequencing, array hybridization, or nucleic acid amplification, said gene expression products from a second portion of said sample of thyroid tissue, to yield a data set including data corresponding to gene expression product levels;
(d) in a programmed computer, inputting said data including said gene expression product levels from (c) to a trained algorithm to generate a classification of said sample of thyroid tissue as positive or negative for said thyroid cancer at an accuracy of at least 90%, wherein said trained algorithm is trained with a plurality of training samples, and wherein said sample of thyroid tissue is independent of said plurality of training samples; and
(e) electronically outputting a report that identifies said classification of said sample of thyroid tissue as positive or negative for said thyroid cancer.
US Pat. No. 10,111,849

USE OF MEDIUM CHAIN TRIGLYCERIDES FOR THE TREATMENT AND PREVENTION OF ALZHEIMER'S DISEASE AND OTHER DISEASES RESULTING FROM REDUCED NEURONAL METABOLISM II

Accera, Inc., Denver, CO...

1. A method of treating loss of cognitive function caused by Alzheimer's disease or Mild Cognitive Impairment in a patient that is ApoE4(?), the method comprising:orally administering a dosage unit of medium chain triglyceride to said patient in need thereof such that the blood level of D-beta-hydroxybutyrate in the patient is raised to about 0.1 to 50 mM causing hyperketonemia in the patient, wherein the patient has a diet wherein carbohydrate intake is not restricted, resulting in ketone bodies being utilized for energy in the brain to thereby treat loss of cognitive function,
wherein the dosage unit is given in a single dose.
US Pat. No. 10,111,850

ESTER AND CHOLINESTERASE INHIBITOR IN LONG-ACTING NERVE BLOCK

1. A pharmaceutical composition comprising about 10 mg to about 100 mg tetracaine or pharmaceutically acceptable salt thereof and about 100 ?g to about 1000 ?g physostigmine or pharmaceutically acceptable salt thereof.
US Pat. No. 10,112,878

MOLECULAR SIEVES MEDIATED UNSATURATED HYDROCARBON SEPARATION AND RELATED COMPOSITIONS, MATERIALS, METHODS AND SYSTEMS

CALIFORNIA INSTITUTE OF T...

1. A method to separate an eight-membered monocyclic unsaturated hydrocarbon at an initial concentration Ci, from a hydrocarbon mixture further comprising additional nonlinear unsaturated C8H2m hydrocarbons with 4?m?8, the method comprisingproviding a 10-ring pore molecular sieve having a sieving channel with a 10-ring sieving aperture with a minimum crystallographic free diameter greater than 3 ? and a ratio of the maximum crystallographic free diameter to the minimum crystallographic free diameter between 1 and 2,
the 10-ring pore molecular sieve having a T1/T2 ratio?20:1 wherein T1 is an element independently selected from Si and Ge or a combination thereof, and T2 is an element independently selected from Al, B and Ga or a combination thereof,
the 10-ring pore molecular sieve further having a counterion selected from NH4+, Li+, Na+, K+ and Ca++ or a combination thereof, and
contacting the hydrocarbon mixture with the 10-ring pore molecular sieve at a temperature of ?20° C. to 60° C. for a time and under conditions to obtain a sieved hydrocarbon mixture comprising the eight-membered monocyclic unsaturated hydrocarbon at a separation concentration Cs>Ci.
US Pat. No. 10,112,365

METHOD FOR PROVIDING A CARRIER MATERIAL

1. A method for providing a two dimensional carrier material for vinyl floor covering, roofing underlayment sheet or bitumen roofing membrane comprising a nonwoven layer of fibers and threads extending in the longitudinal direction of the carrier material, comprising:supplying a nonwoven layer of fibers,
supplying a scrim comprising warp threads and weft threads adjacent and co-planar to the nonwoven layer of fibers, the warp threads extending in the longitudinal direction of the carrier material and comprising high modulus yarns having a modulus of at least 1 GPa, and
thermally bonding the scrim to the nonwoven layer of fibers
wherein the weft threads of the scrim are predominantly made of a polymer having a melting temperature which is equal to or less than the lowest melting temperature of the fibers comprised in the nonwoven layer of fibers and which is less than the melting temperature of at least a part of the warp threads of the scrim, the weft threads comprising the polymer in an amount of at least 95 percent by weight, and
wherein the weft threads of the scrim are fully melted during thermal bonding of the scrim to the nonwoven layer of fibers such that the weft threads are no longer present as a continuous phase after thermal bonding.
US Pat. No. 10,113,135

PERFUMING METHOD

KAO CORPORATION, Tokyo (...

1. A perfuming method, comprising:applying a water-based product that comprises a perfume precursor to a fabric or a human body;
drying the water-based product; and
subsequently bringing the perfume precursor into contact with moisture in the air to perform hydrolysis, thereby releasing a perfume,
wherein the water-based product comprises a perfume precursor comprising an ester of i) at least one perfume selected from the group consisting of maltol, ethyl maltol, ethyl vanillin, and raspberry ketone, and ii) at least one aliphatic monocarboxylic acid or aliphatic dicarboxylic acid selected from the group consisting of lauric acid, myristic acid, palmitic acid, stearic acid, oleic acid, adipic acid, and sebacic acid.
US Pat. No. 10,113,137

FABRIC SOFTENER ACTIVE COMPOSITION

Evonik Degussa GmbH, Ess...

1. A fabric softener active composition, comprising:a) as component A, at least 50% by weight of a bis-(2-hydroxypropyl)-dimethylammonium methylsulphate fatty acid ester having a molar ratio of fatty acid moieties to amine moieties of from 1.5 to 1.99, an average chain length of the fatty acid moieties of from 16 to 18 carbon atoms and an iodine value of the fatty acid moieties, calculated for the free fatty acid, of from 0.5 to 50; and
b) as component B, a (2-hydroxypropyl)-(1-methyl-2-hydroxyethyl)-dimethylammonium methylsulphate fatty acid ester having the same fatty acid moieties as component A;wherein the molar ratio of component B to component A is from 0.05 to 0.20.
US Pat. No. 10,111,856

COMPOSITION FOR PREVENTING OR TREATING CLIMACTERIC SYMPTOMS COMPRISING SOYBEAN EXTRACT COMPRISING COUMESTROL AS AN ACTIVE INGREDIENT

AMOREPACIFIC CORPORATION,...

1. A method for preventing or treating a climacteric disease, wherein the method comprises administering an effective amount of a germinated and fermented bean extract comprising coumestrol to a subject in need thereof, wherein the method is for preventing or treating a climacteric disease,wherein the fermented bean extract is a fermented product by Aspergillus oryzae of the germinated bean,
wherein the climacteric disease is osteoporosis.
US Pat. No. 10,113,138

APE-FREE SURFACTANT COMPOSITIONS AND USE THEREOF IN TEXTILE APPLICATIONS

Dow Global Technologies L...

1. A process of removing wax or oil from a textile material, comprising contacting the textile material with a composition comprising:an alkyl alkoxylate sulfate of formula I:
R1O—(CH2CH(R2)—O)x—(CH2CH2O)y—SO3M  (I);
a nonionic alkyl alkoxylate of formula II:
R1O—(CH2CH(R2)—O)x—(CH2CH2O) y—H  (II); and
waterwherein R1 is linear or branched C4-C10 alkyl;R2 is CH3 or CH3CH2;
x is a real number from 1 to 11;
y is a real number from 1 to 20; and
M is an alkali metal or NH4, andwherein R1, R2, x, and y in formula I and formula II may be the same or different.
US Pat. No. 10,111,860

COMPOSITIONS AND METHODS FOR TREATING CONCUSSION

1. A method for treating concussion, the method comprising:administering a therapeutic dose of an active compound comprising one or more of: phenserine, a phenserine metabolite, a phenserine prodrug, or combinations thereof.
US Pat. No. 10,112,119

METHOD FOR MODIFYING LOCAL PROPERTIES OF MATERIALS

Disney Enterprises, Inc.,...

1. A method for altering at least one local property of a primary material, comprising:reducing an elasticity of the primary material, wherein the primary material is an artificial skin material;
while the elasticity of the primary material is reduced, creating a delivery aperture through a portion of the primary material; and
introducing through the delivery aperture a secondary material into the primary material.
US Pat. No. 10,115,965

POSITIVE ACTIVE MATERIAL FOR RECHARGEABLE LITHIUM BATTERY, METHOD OF PREPARING SAME, AND RECHARGEABLE LITHIUM BATTERY INCLUDING SAME

Samsung SDI Co., Ltd., Y...

1. A positive active material for a rechargeable lithium battery, comprisinga core comprising a compound capable of intercalating and deintercalating lithium, the compound capable of intercalating and deintercalating lithium being a nickel-based oxide; and
a lithium metal phosphate on the surface of the core, the lithium metal phosphate being included in an amount of about 0.01 parts by weight to about 20 parts by weight based on 100 parts by weight of the compound capable of intercalating and deintercalating lithium,
wherein the lithium metal phosphate is different from the compound capable of intercalating and deintercalating lithium and is represented by Chemical Formula 1:
Li1+(x+y)InxMyTi2-(x+y)(PO4)3  Chemical Formula 1
wherein, in Chemical Formula 1, M is Al, Y, Sc, Mg, V, Cr, Mn, Fe, Ga, Lu, Cr, La, Ge, or a combination thereof, 0 wherein the nickel-based oxide comprises a lithium nickel cobalt aluminum oxide, a lithium nickel cobalt manganese oxide, or a combination thereof.
US Pat. No. 10,113,148

METHOD FOR OBTAINING MONOCYTES OR NK CELLS

1. A method for obtaining monocytes or NK cells, comprising:(a) collecting a monocyte sample by separating the monocytes from peripheral blood by using an antibody specific for a surface marker of the monocytes, wherein the peripheral blood is obtained from a human;
(b) collecting, as an NK cell sample, cell populations remaining after the separation of the monocytes; and
(c) growing the monocytes or the NK cells by culturing at least one of the monocyte sample and the NK cell sample,
wherein in the step (c), at least the NK cells are grown by culturing the NK cell sample without carrying out further separation steps by use of a second medium containing an anti-CD56 antibody.
US Pat. No. 10,112,123

FRACTIONATOR FOR SEPARATING SOLUBILIZED RUBBER FROM A CO-SOLVENT BASED MISCELLA AND RELATED PROCESSES

Bridgestone Corporation, ...

1. A fractionator for separating solubilized rubber from a co-solvent based miscella, the fractionator comprising:a primary vessel comprising:
a feed inlet for feeding a co-solvent based miscella into the primary vessel, wherein the co-solvent based miscella separates to form (i) a non-polar solvent viscous rubber phase in a lower portion of the primary vessel and (ii) a polar solvent solubilized resin phase above the non-polar solvent viscous rubber phase;
a side outlet for removing the polar solvent solubilized resin phase from the primary vessel; and
a bottom outlet for removing the non-polar solvent viscous rubber phase from the primary vessel.
US Pat. No. 10,113,149

REPROGRAMMING OF HUMAN ENDOTHELIUM INTO HEMATOPOIETIC MULTI-LINEAGE PROGENITORS BY DEFINED FACTORS

CORNELL UNIVERSITY, Itha...

1. A method of generating human hematopoietic multi-lineage, progenitor cells (HMLPs) from human endothelial cells (ECs), comprising culturing human ECs expressing each of the transcription factors Finkel-Biskis-Dinkins murine osteosarcoma viral oncogene homolog B (FOSB), growth factor independent 1 transcription repressor (GFI1), Runt-related transcription factor 1 (RUNX1), spleen focus forming virus proviral integration oncogene (SPI1), in serum-free media with endothelial feeder cells, thereby generating HMLPs.
US Pat. No. 10,111,869

REDUCTION OF OPIOID BLOOD FLUCTUATIONS

ETHYPHARM, Saint-Cloud (...

1. A method of treatment of severe pain comprising administering orally to a patient in need thereof in a repeated manner twice-a-day a sustained-release matrix-type tablet releasing at least one opioid or one of its pharmaceutically acceptable salts, said matrix-type tablet comprising:a compression matrix consisting of granules of one opioid or one of its pharmaceutically acceptable salts and hydroxypropylmethylcellulose (HPMC); a mixture of microcrystalline cellulose and polyvinyl acetate/polyvinyl pyrrolidone (80:20); precipitated silica; and magnesium stearate;
a sub-coating consisting of a mixture of hydroxypropylmethylcellulose (HPMC), simethicone, micronized talc, and precipitated silica; and
a coating consisting of a mixture of an aqueous dispersion of ethylcellulose, dibutyl sebacate, talc, and precipitated silica;
wherein each administration being spaced apart by 8 to 14 hours, said method maintaining the steady-state opioid plasma concentration obtained in vivo with a reduced fluctuation at above 60% of the Cssmax value for at least 10 hours.
US Pat. No. 10,111,871

NANOPARTICLE DRUG DELIVERY SYSTEM AND METHOD OF TREATING CANCER AND NEUROTRAUMA

Northeastern University, ...

1. A nanoparticulate formulation of an inhibitor of a poly (ADP-ribose) polymerase (PARP) enzyme, the formulation comprising a suspension of lipid vesicles in an aqueous medium, wherein the lipid vesicles have a positive surface charge, have an average diameter in the range from about 50 nm to about 200 nm, comprise a PARP inhibitor selected from olaparib and BMN-673, and comprise a PEGylated lipid moiety, wherein the effective concentration of the PARP inhibitor within the lipid vesicles is in the range from about 400 ?M to about 20 mM for olaparib or in the range from about 50 nM to about 1 ?M for BMN-673.
US Pat. No. 10,113,154

METHOD FOR PRODUCING STEVIOL GLYCOSIDE

SUNTORY HOLDINGS LIMITED,...

1. A polynucleotide selected from:a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 1; and
a polynucleotide comprising a heterologous regulatory element operably linked to a polynucleotide sequence encoding a protein consisting of the amino acid sequence of SEQ ID NO: 2.
US Pat. No. 10,113,155

STEVIOL GLYCOSYLTRANSFERASE AND GENE ENCODING SAME

SUNTORY HOLDINGS LIMITED,...

1. A polynucleotide selected from:a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 1; and
a polynucleotide comprising a heterologous regulatory element operably linked to a polynucleotide sequence encoding a protein consisting of the amino acid sequence of SEQ ID NO: 2.
US Pat. No. 10,113,157

ALPHA-AMYLASE VARIANTS

1. A variant of a parent Termamyl-like alpha-amylase, comprising an alteration at one or more positions selected from the group of:W13, G48, T49, S50, Q51, A52, D53, V54, G57, G107, G108, A111, S168, M197, wherein (a) the alteration(s) are independently
(i) a deletion of the amino acid which occupies the position, or
(ii) a substitution of the amino acid which occupies the position with a different amino acid,
(b) the variant has alpha-amylase activity;
(c) each position corresponds to a position of the amino acid sequence of the parent Termamyl-like alpha-amylase having the amino acid sequence of SEQ ID NO: 4; and
(d) the variant has at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 41 or 42.
US Pat. No. 10,113,158

GLUCOAMYLASE VARIANTS AND POLYNUCLEOTIDES ENCODING SAME

1. A glucoamylase variant having improved thermostability, comprising a substitution at a position corresponding to position 4 of the polypeptide of SEQ ID NO: 3, wherein the variant has glucoamylase activity and wherein the variant has at least 90% sequence identity to the polypeptide of SEQ ID NO: 3.
US Pat. No. 10,113,671

PROCESS FOR THE PRODUCTION OF A PIPE LINED WITH AN INLINER

EVONIK DEGUSSA GmbH, Ess...

1. A process for producing a pipe, comprising:introducing a thermoplastic inliner into a carrier pipe, the carrier pipe comprising an interior surface that has a shape and an exterior surface;
heating the exterior surface of the carrier pipe from the outside of the carrier pipe to a heating temperature higher than a crystallite melting point (Tm) of a moulding composition of an exterior surface of the inliner;
transferring the heat from the interior surface of the carrier pipe to the exterior surface of the inliner;
expanding the inliner radially in the carrier pipe so that the heated exterior surface of the inliner assumes the shape of the interior surface of the carrier pipe;
water cooling the inliner, thereby obtaining pipe comprising the carrier pipe and the thermoplastic inliner;
wherein
an external diameter of the inliner is at most 25% greater than an internal diameter of the carrier pipe, and
the cross section of the inliner is reduced by from 3 to 30%
the interior surface of the carrier pipe is a metal selected from the group consisting of steel, zinc and an alloy comprising aluminium, iron or zinc, and
the cross section of the inliner is reduced through exposure to an exterior force prior to being introduced into the carrier pipe.
US Pat. No. 10,113,162

MODIFYING SOYBEAN OIL COMPOSITION THROUGH TARGETED KNOCKOUT OF THE FAD2-1A/1B GENES

CELLECTIS, Paris (FR)

1. A soybean plant, plant part, or plant cell comprising:(a) a deletion in each FAD2-1A allele, wherein said deletion in each FAD2-1A allele was induced by transcription activator-like (TAL) effector endonucleases targeted to SEQ ID NOS: 32 and 33, and
(b) a deletion in each FAD2-1B allele, wherein said deletion in each FAD2-1B allele is 23 bp in size, and wherein said deletion in each FAD2-1B allele was induced by TAL effector endonucleases targeted to SEQ ID NOS: 32 and 33,
wherein oil produced from said plant, plant part, or plant cell has increased oleic acid content and decreased linoleic acid content as compared to oil produced from a corresponding wild type soybean plant, plant part, or plant cell.
US Pat. No. 10,113,163

ADENOSINE NUCLEOBASE EDITORS AND USES THEREOF

President and Fellows of ...

1. An adenosine deaminase comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOs: 1, 8, 9, 371, 372, 373, 374, or 375 with the exception of one or more substitutions at positions selected from the group consisting of amino acid residues corresponding to positions 8, 17, 18, 23, 34, 36, 45, 48, 51, 56, 59, 84, 85, 94, 95, 102, 104, 106, 107, 108, 110, 118, 123, 127, 138, 142, 146, 147, 149, 151, 152, 153, 154, 155, 156, and 157 of the amino acid sequence of SEQ ID NO: 1, wherein said adenosine deaminase deaminates adenine in deoxyribonucleic acid (DNA).
US Pat. No. 10,113,165

MODULATION OF EXON RECOGNITION IN PRE-MRNA BY INTERFERING WITH THE SECONDARY RNA STRUCTURE

ACADEMISCH ZIEKENHUIS LEI...

1. A method for inducing the skipping of exon 53 of the human dystrophin pre-mRNA in a subject with Duchenne Muscular Dystrophy (DMD) or Becker Muscular Dystrophy (BMD), or a cell derived from the subject, said method comprising providing to said subject or said cell, an antisense oligonucleotide of 18 nucleotides consisting of the base sequence of the sequence CUGUUGCCUCCGGUUCUG (SEQ ID NO: 29), wherein said oligonucleotide induces exon 53 skipping in the human dystrophin pre-mRNA in the subject or a cell derived from the subject, said oligonucleotide comprising a modification selected from the group consisting of: 2?-O-methyl, 2?-O-methylphosphorothioate, a morpholine ring, a phosphorodiamidate linkage, a peptide nucleic acid and a locked nucleic acid.
US Pat. No. 10,111,889

USES OF GANAXOLONE

WISCONSIN ALUMNI RESEARCH...

1. A method of treating sleep disruptions due to absence epilepsy in a mammalian subject in need thereof, comprising administering ganaxolone to the mammalian subject in an amount of 0.2 to 2 mg/kg per dose, wherein the epilepsy is characterized by a deficit in tonic inhibition.
US Pat. No. 10,113,175

AP2 DOMAIN TRANSCRIPTION FACTOR ODP2 (OVULE DEVELOPMENT PROTEIN 2) AND METHODS OF USE

PIONEER HI-BRED INTERNATI...

1. A polynucleotide designed for expression in a plant selected from the group consisting of:(a) the polynucleotide encoding the amino acid sequence of SEQ ID NO:26;
(b) the polynucleotide encoding an amino acid sequence having at least 85% sequence identity to SEQ ID NO:26, wherein said polynucleotide encodes a polypeptide comprising two AP2 domains and that renders a plant cell embryogenic when expressed in the plant cell; and,
(c) the polynucleotide comprising a full length complement of the polynucleotide of (a)-(b);
wherein the polynucleotide is operably linked to a heterologous regulatory sequence.
US Pat. No. 10,112,150

POROUS GRAPHENE BASED COMPOSITE MEMBRANES FOR NANOFILTRATION, DESALINATION, AND PERVAPORATION

The Research Foundation f...

1. An article comprising:a nanofibrous scaffold;
at least a first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof on at least a portion of a surface of the nanofibrous scaffold;
an additive selected from the group consisting of cross-linking agents and particles on an outer surface of the at least first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof; and
at least a second layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof on at least a portion of the surface of the first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof, such that the additive is between the first and second layers of nanoporous graphene, nanoporous graphene oxide, or combinations thereof.
US Pat. No. 10,113,178

TRANSGENIC MAIZE EVENT MON 87419 AND METHODS OF USE THEREOF

Monsanto Technology LLC, ...

1. A recombinant DNA molecule comprising a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO:10.
US Pat. No. 10,112,923

1,2,4-TRIAZINE-4-AMINE DERIVATIVES

Heptares Therapeutics Lim...

1. A method of treatment of cancer, comprising administering an effective amount of 6-(2-chloro-6-methylpyridin-4-yl)-5-(4-fluorophenyl)-1,2,4-triazin-3-amine, or a pharmaceutically acceptable salt or solvate, to a patient in need of such treatment, wherein the cancer is selected from the group consisting of prostate cancer, rectal cancer, renal cancer, ovarian cancer, endometrial cancer, thyroid cancer, pancreatic cancer, breast cancer, colon cancer, bladder cancer, brain cancer, glia cancer, melanoma cancer, pineal gland cancer, and lung cancer.
US Pat. No. 10,112,154

POLYAMIDE-BASED WATER-TREATMENT SEPARATION MEMBRANE HAVING EXCELLENT DURABILITY, AND MANUFACTURING METHOD THEREFOR

LG CHEM, LTD., Seoul (KR...

1. A water treatment separation membrane comprising:a porous support;
a polyamide active layer formed on the porous support; and
a protective layer formed on the polyamide active layer, the protective layer comprising
polyvinyl pyrrolidone and a polymer including an amine group-containing compound, an epoxy group-containing compound and a fluoro-containing compound,
wherein a thickness of the protective layer is 0.5 nm to 1000 nm.
US Pat. No. 10,113,181

MANIPULATION OF DOMINANT MALE STERILITY

PIONEER HI-BRED INTERNATI...

1. A method of propagating wheat male sterile seeds, comprising:(a) emasculating a first wheat plant that is hemizygous for a GOF-MF (gain of function male fertility) gene which comprises a promoter operably linked to a polynucleotide encoding a male fertility polypeptide, and wherein the GOF-MF gene is linked to (1) a gene that disrupts the function and/or development of male-reproductive tissue and (2) a marker gene;
(b) pollinating the first wheat plant with pollen from a second wheat plant, wherein the second wheat plant is male fertile and comprises (1) a GOF-MF gene that when expressed in male tissue maintains fertility in said second plant, and (2) an exogenous LOF-mf (loss of function of male fertility) nucleic acid construct which comprises a promoter inverted repeat (pIR) sequence comprising at least a 20 nucleotide fragment that targets the promoter of the second plant's GOF-MF gene, wherein said GOF-MF gene is a wheat male fertility gene;
(c) harvesting seeds from the cross of part (b);
(d) selecting from among the harvested seeds of part (c) for those seeds comprising
(1) the GOF-MF gene linked to the gene that disrupts the function and/or development of male-reproductive tissue, and the marker gene; and
(2) the exogenous LOF-mf nucleic acid construct that targets the promoter of the second plant's GOF-MF gene,
wherein said seeds are hemizygous for the GOF-MF gene and the exogenous LOF-mf nucleic acid construct;
(e) planting the selected seeds of step (d) and allowing the plants grown from said seeds to self-pollinate, to produce progeny plants;
(f) screening the progeny plants produced by the selfed plants of step (e) and selecting those progeny plants homozygous for the exogenous LOF-mf nucleic acid construct;
(g) allowing the progeny plants selected in step (f) to self-pollinate to produce seeds;
(h) harvesting the seeds from step (g);
(i) planting the seeds harvested in step (h) that express the marker, and growing said seeds into plants;
(j) selecting the plants of step (i) that are
(1) hemizygous for the GOF-MF gene linked to the gene that disrupts the function and/or development of male-reproductive tissue, and the marker gene, and
(2) homozygous for the exogenous LOF-mf nucleic acid construct,
which selected plants can be used as maintainer plants to propagate a male-sterile inbred; and
(k) selecting the seeds from the plants of step (j) that do not express the marker, which seeds are homozygous for the exogenous LOF-mf nucleic acid construct, and which seeds produce male-sterile progeny.
US Pat. No. 10,113,182

SUBFAMILY E SIMIAN ADENOVIRUSES A1302, A1320, A1331 AND A1337 AND USES THEREOF

THE TRUSTEES OF THE UNIVE...

1. An adenovirus having a capsid comprising a hexon protein, a penton protein, and a fiber protein, wherein said hexon protein is the hexon protein of SAdV-A1302 with the amino acids 1 to 950 of SEQ ID NO: 9, said capsid encapsidating a heterologous nucleic acid comprising a gene operably linked to expression control sequences which direct at least one of transcription, translation, and expression of said gene in a host cell.
US Pat. No. 10,116,002

PRODUCTION METHOD OF SOLID ELECTROLYTE

IDEMITSU KOSAN CO., LTD.,...

1. A method of producing a sulfide-based solid electrolyte comprising:contacting an alkali metal sulfide with a sulfur compound without pulverizing in a mixed solvent of an aromatic hydrocarbon solvent and a polar aprotic solvent, wherein:
the polar aprotic solvent is at least one of an ether solvent and a nitrile solvent, and a volume ratio of the aromatic hydrocarbon solvent to the polar aprotic solvent (aromatic hydrocarbon solvent: polar aprotic solvent) is 95:5 to 5:95.
US Pat. No. 10,113,183

ADENO-ASSOCIATED VIRUS VECTORS FOR TREATMENT OF GLYCOGEN STORAGE DISEASE

The United States of Amer...

1. A recombinant nucleic acid molecule comprising a G6PC promoter/enhancer, a synthetic intron, and a G6PC coding region, wherein the nucleotide sequence of the recombinant nucleic acid molecule is at least 95% identical to nucleotides 182-4441 of SEQ ID NO: 1, and wherein the recombinant nucleic acid comprises at least one nucleotide substitution in the G6PC coding region that results in a coding change at residue 3, 54, 139, 196, 199, 242, 247, 292, 298, 301, 318, 324, 332, 347, 349, 350 or 353 of the human G6PC protein of SEQ ID NO: 4.
US Pat. No. 10,113,184

MICROBE TRANSFORMANT FOR WEIGHT LOSS AND LIPID REDUCTION, THE METHOD FOR CONSTRUCTING THE TRANSFORMANT, AND APPLICATION THEREOF

1. A transformant for weight loss and blood lipid reduction, wherein the transformant is obtained by replacing Lactococcus lactis (L. lactis) thyA gene with a codon-optimized human oxyntomodulin gene through homologous recombination.
US Pat. No. 10,116,004

ELECTROLYTE FOR LITHIUM BATTERY FOR SOLID STATE DRIVE BACKUP POWER AND LITHIUM BATTERY FOR SOLID STATE DRIVE BACKUP POWER INCLUDING THE SAME

Samsung SDI Co., Ltd., Y...

1. An electrolyte for a lithium battery for solid state drive backup power, the electrolyte comprising:propylene carbonate;
ethylene carbonate;
diethyl carbonate; and
LiBF4, wherein:
the propylene carbonate is present in an amount of about 20 parts by weight to about 50 parts by weight, the ethylene carbonate is present in an amount of about 40 parts by weight to about 90 parts by weight, and the diethyl carbonate is present in an amount of about 1 part by weight to 10 parts by weight, based on 100 parts by weight of the combined propylene carbonate, ethylene carbonate, and diethylene carbonate, and
the electrolyte contains the LiBF4 in a molar concentration of about 0.8 M to about 1.2 M.
US Pat. No. 10,111,905

ANTIBACTERIAL PHARMACEUTICAL PREPARATION

1. A method of treating a bacterial infection in a patient in need thereof, comprising the following steps:contacting a whole blood sample with a vessel or container, wherein the vessel or container contains macroscopic particles from glass, plastic, corundum and or quartz and wherein during incubation the whole blood sample is in contact with the macroscopic particles;
incubating said whole blood sample in contact with said vessel or container, which results in an antibacterial agent in the form of a pharmaceutical preparation being produced, wherein the pharmaceutical preparation comprises exosomes that have been generated during the period of said incubation;
and
administering an effective amount of the pharmaceutical preparation to said patient who is in need of for treatment for bacterial infection, thereby treating the bacterial infection, wherein the exosomes of the pharmaceutical preparation interact with the bacteria to inhibit bacterial growth; said bacterial infection is caused by one or more bacteria selected from Salmonella.
US Pat. No. 10,111,906

SERUM FRACTION OF PLATELET-RICH FIBRIN

Lacerta Technologies Inc....

1. A pharmaceutical preparation comprising a blood-derived serum product which is an isolated serum fraction of platelet rich fibrin (PRF) said blood-derived serum product being contained in an application device for administration of the serum fraction to an individual and being obtained by a method comprising the steps of:a. separating and removing the red blood cell fraction from a venous blood sample without the addition of an anticoagulant to provide a plasma;
b. clotting said plasma spontaneously by centrifugation carried out at 1000 to 5000 g to obtain a coagel of PRF and a supernatant, wherein in said method the centrifugation is carried out for 2 to 20 minutes;
c. pressing or squeezing the coagel to obtain a fluid fraction which comprises an activated platelet releasate from the coagel, wherein said isolated serum fraction of PRF contains the fluid fraction; and
d. providing the serum fraction in a pharmaceutical preparation which is contained in an application device for administration of the serum fraction to an individual, said serum fraction comprising a platelet releasate from activated platelets,wherein said isolated serum fraction of PRF comprises a reduced content of red blood cells, platelets or fibrinogen as compared to whole blood or a reduced content of fibrin as compared to said plasma, andwherein said serum fraction of PRF is depleted in PDGF-AB, PDGF-BB and TGF beta-1 as compared to said plasma or whole blood, and has a non-inflammatory blood factor profile, and a non-differentiating but cell proliferating profile on osteoblasts.
US Pat. No. 10,113,188

COMPOSITIONS AND METHODS FOR BIOLOGICAL PRODUCTION OF FATTY ACID DERIVATIVES

Calysta, Inc., Menlo Par...

1. A alpha-proteobacterial methanotroph, comprising a heterologous nucleic acid molecule encoding a fatty acid converting enzyme, wherein the alpha-proteobacterial methanotroph comprising the heterologous nucleic acid molecule encoding the fatty acid converting enzyme is capable of converting a C1 substrate into a C8-C24 fatty aldehyde, fatty alcohol, fatty ester wax, a hydroxy fatty acid, dicarboxylic acid, or a combination thereof, and wherein the encoded fatty acid converting enzyme comprises:(a) a fatty acyl-CoA reductase capable of forming a fatty alcohol; or
(b) a fatty acyl-CoA reductase capable of forming a fatty aldehyde; or
(c) a carboxylic acid reductase; and
(d) a thioesterase; and/or
(e) an acyl-CoA synthetase.
US Pat. No. 10,111,395

MELON PLANTS WITH ENHANCED FRUIT YIELDS

1. A Cucumis melo plant or a part thereof carrying a loss of function mutation in the MELO3 C009603 gene, wherein the plant bears more than 12 fruit, said fruit being seedless.
US Pat. No. 10,112,933

METHODS AND COMPOSITIONS FOR TREATMENT OF FIBROSIS

BAYLOR COLLEGE OF MEDICIN...

1. A method of treating an individual that has fibrosis, comprising the step of providing to the individual an effective amount of one or more compositions selected from the group consisting of N-(1?,2-dihydroxy-1,2?-binaphthalen-4?-yl)-4-methoxybenzenesulfonamide, N-(1?,2-dihydroxy-1,2?-binaphthalen-4?-yl)-4-methoxybenzenesulfonamide, N-(3,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(4,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(5,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(6,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(7,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(8,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, 4-Bromo-N-(1,6?-dihydroxy-[2,2?]binaphthalenyl-4-yl)-benzenesulfonamide, 4-Bromo-N-[4-hydroxy-3-(1H-[1,2,4]triazol-3-ylsulfanyl)-naphthalen-1-yl]-benzenesulfonamide, and a functional derivative thereof, wherein the fibrosis is not pulmonary fibrosis or myelofibrosis.
US Pat. No. 10,111,396

SOYBEAN VARIETY 5PZCY11

PIONEER HI-BRED INTERNATI...

1. A plant or a seed of soybean variety 5PZCY11, representative seed of the variety having been deposited under ATCC Accession Number PTA-125128.
US Pat. No. 10,111,908

SPINAL DISC REGENERATIVE COMPOSITION AND METHOD OF MANUFACTURE AND USE

Vivex Biomedical, Inc., ...

1. A composition consisting of:(a) a syringe or injectable device which is capable of being inserted into a damaged disc to be treated; and
(b) a hydrated composition comprising hypothermically dried micronized nucleus pulposus in a fluid, produced by a method consisting of:
(i) providing normal human cadaveric intervertebral discs;
(ii) separating the nucleus pulposus from the annulus fibrosus of the normal human cadaveric intervertebral disc;
(iii) drying the nucleus pulposus;
(iv) micronizing the dried nucleus pulposus by pulverizing in a cryomill at low temperature into particles sized less than 400 microns;
(v) hypothermically drying the nucleus pulposus, wherein said hypothermically drying occurs during step (iii), and/or between steps (iii) and (iv), and/or during step (iv), and/or between steps (iv) and step (vi); and then
(vi) mixing the hypothermically dried micronized nucleus pulposus with a fluid, thereby producing the hydrated composition;
wherein the (b) hydrated composition is contained within the (a) syringe or injectable device, and
wherein the (b) hydrated composition has a viscosity which permits it to flow through a cannula.
US Pat. No. 10,113,190

METHOD FOR PRODUCING L-LEUCINE, L-VALINE, L-ISOLEUCINE, ?-KETOISOVALERATE, ?-KETO-BETA-METHYLVALERATE, OR ?-KETOISOCAPROATE USING RECOMBINANT CORYNEBACTERIA THAT CONTAIN THE ILVBN OPERON WHICH CAN BE INDUCED BY PROPIONATE

Evonik Degussa GmbH, Ess...

1. A process for the production of an L-amino acid selected from the group consisting of L-leucine, L-valine and L-isoleucine or of an ?-keto acid selected from the group consisting of ?-ketoisovalerate, ?-keto-methylvalerate and ?-ketoisocaproate, said process comprising:a) fermenting microorganisms of the genus Corynebacterium, wherein:
i) said microorganisms comprise, in replicable form, a polynucleotide with operator activity, the sequence of which is at least 85% identical to the sequence of position 1 to 121 of SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:3 and to which the activator PrpR binds; and
ii) functionally downstream of the polynucleotide with operator activity, at the 3?-end, are a second polynucleotide having propionate- or 2-methylcitrate-inducible promoter activity; as well as genes ilvB and ilvN encoding for the subunits of an acetolactate synthase, and which regulates the transcription of the genes ilvBN as a function of the addition of the activator PrpR, in a medium;
b) during the fermenting of said microorganisms, there is a first phase (growth phase), which takes place without inducer, and a second phase during which propionate or 2-methylcitrate is added as an inducer, whereupon the desired L-amino acid or ?-keto acid is synthesized under conditions in which the desired L-amino acid or ?-keto acid is enriched in the medium and/or in the cells.
US Pat. No. 10,111,397

PLANTS AND SEEDS OF HYBRID CORN VARIETY CH249286

Monsanto Technology LLC, ...

1. A seed of hybrid corn variety CH249286, produced by crossing a first plant of variety CV345806 with a second plant of variety CV197629, wherein representative seed of said varieties CV345806 and CV197629 have been deposited under ATCC Accession numbers PTA-124515 and PTA-120299, respectively.
US Pat. No. 10,113,192

METHOD FOR PRODUCING FRUCTOSE

ANNIKKI GMBH, Graz (AT)

1. A method for producing D-fructose from D-glucose, comprising:a) enzymatically oxidizing D-glucose to D-glucosone in a reaction vessel, and
b) enzymatically reducing the D-glucosone to D-fructose in reaction vessel,
wherein a redox cofactor is used in step b) and the redox cofactor is recycled by a cofactor regeneration system comprising a redox enzyme
wherein both enzymatic reaction of steps a) and b) are carried out in the reaction vessel and without the D-glucosone being isolated.
US Pat. No. 10,111,399

SOYBEAN CULTIVAR S170021

M.S. Technologies, LLC, ...

1. A plant of soybean cultivar S170021, representative seed of said soybean cultivar having been deposited under ATCC Accession No. PTA-124449.
US Pat. No. 10,111,911

COMPOSITIONS COMPRISING UNSATURATED FATTY ACIDS AND NITRIC OXIDE RELEASING COMPOUNDS AND USE THEREOF FOR ENHANCING COGNITIVE AND RELATED FUNCTIONS

Nestec S.A., Vevey (CH)

1. A method for enhancing cognitive function in an animal, the method comprising:identifying an animal in which enhancement of cognitive function is desired; and
administering a composition comprising effective amounts of citrulline and one or more unsaturated fatty acids (UFA) comprising docosahexaenoic acid (DHA) on a regular basis, wherein the administration on a regular basis of the composition for a time period results in enhanced cognitive function in the animal compared with an equivalent animal not administered the composition for an equivalent time period, the composition is administered in a daily dose comprising 0.5 g to 1.0 g of the DHA per day and 2.0 g to 10.0 g of the citrulline per day.
US Pat. No. 10,113,193

METHOD FOR OPTIMIZING THE ASSEMBLY AND PRODUCTION OF HETERO-MULTIMERIC PROTEIN COMPLEXES

NovImmune SA, Geneva (CH...

1. A method to increase production yield of a protein complex that comprises more than one polypeptide, the method comprising:(a) providing more than one nucleic acid molecules encoding the polypeptides in the protein complex, wherein the protein complex is a multispecific antibody or a bispecific antibody;
(b) introducing the nucleic acid molecule(s) into a cell;
(c) culturing the cell under conditions that allow for the expression of polypeptides in the protein complex; and
(d) decreasing expression of at least one of the polypeptides in the protein complex by modifying transcription rate, by modifying translation rate, by modifying mRNA stability, by modifying mRNA secondary structure, or by modifying any combination of these factors,
wherein the production yield of the protein complex is increased compared to when the expression of at least one of the polypeptides is not decreased.
US Pat. No. 10,111,912

HERBAL FORMULATIONS

MONTERO GIDA SANAYI VE TI...

1. A formulation for treating or preventing a respiratory tract disease comprising effective amounts of Propolis extract, Ginseng root extract and Zingiber officinale extract, wherein:the percentage amount of the Propolis extract based on the total volume of the formulation, is between 0.02% and 30% (w/v);
the percentage amount of the Ginseng root extract based on the total volume of the formulation, is between 0.05% and 60% (w/v);
the percentage amount of the Zingiber officinale extract based on the total volume of the formulation, is less than 30% (w/v); and wherein the formulation further comprises Glycyrrhiza glabra extract.
US Pat. No. 10,116,014

METHOD FOR MANUFACTURING AN ENERGY STORE

ROBERT BOSCH GMBH, Stutt...

1. A method for manufacturing an electrochemical energy store, the method comprising:providing a temperature control plate made of plastic, the temperature control plate at least partially including a heat-conducting material, and at least one contact area of the temperature control plate being plastically deformable;
bringing the at least one contact area into a deformable state by applying to the at least one contact area a pressure of greater than 0.1 N/cm2 for a time period of less than one hour;
while the at least one contact area is in the deformable state, applying a housing of at least one cell to the at least one contact area, and deforming the at least one contact area by the applying of the housing of the at least one cell to the at least one contact area to adapt a shape of the at least one contact area to the housing of the at least one cell, the applying of the housing of the at least one cell to the at least one contact area being a pressure-based application of the housing of the at least one cell to the at least one contact area in which the housing of the at least one cell is pressed into a material of the at least one contact area to deform the at least one contact area to adapt the at least one contact area to the shape of the housing of the at least one cell; and
hardening at least the at least one contact area of the temperature control plate after the deforming to set the at least one contact area in the adapted shape.
US Pat. No. 10,111,913

METHOD OF REDUCING THE LIKELIHOOD OF SKIN CANCER IN AN INDIVIDUAL HUMAN BEING

1. A method of reducing the likelihood of skin cancer in an individual human being, said method comprising: administering a therapeutically effective amount of a bacterial formulation comprising Nitrosomonas eutropha adapted to produce p53 said bacterial formulation comprising a lotion, ointment or gel adapted to be rubbed onto a region of an individual's skin.
US Pat. No. 10,111,914

COMPOSITIONS AND METHODS COMPRISING BACTERIA FOR IMPROVING BEHAVIOR IN NEURODEVELOPMENTAL DISORDERS

California Institute of T...

1. A method for improving behavioral performance in a human subject, the method comprising:identifying a human subject who is at least 20 years old, having:
anxiety, autism spectrum disorder (ASD), or schizophrenia; and
an adult gut microbiota signature, said adult gut microbiota signature comprising at least 500 different species of microbes,
as a human subject in need of improving behavioral performance; and
administering to the human subject in need of improving behavioral performance an effective amount of one or more Bacteroides bacteria, thereby improving behavioral performance in the human subject.
US Pat. No. 10,113,196

PRENATAL PATERNITY TESTING USING MATERNAL BLOOD, FREE FLOATING FETAL DNA AND SNP GENOTYPING

Natera, Inc., San Carlos...

1. A method for establishing whether an alleged father is the biological father of a fetus that is gestating in a pregnant mother, the method comprising:obtaining genotypic measurements of single nucleotide polymorphism (SNP) alleles at a plurality of polymorphic loci on genetic material from the alleged father;
obtaining fetal and maternal genotypic measurements of SNP alleles at the plurality of polymorphic loci from genetic material isolated from a blood sample from the pregnant mother, wherein the blood sample comprises a mixture of free floating DNA of fetal origin and free floating DNA of maternal origin, wherein the obtaining of fetal and maternal genotypic measurements comprises amplifying the plurality of polymorphic loci from the free floating DNA of fetal origin and the free floating DNA of maternal origin together in a single reaction and measuring the genotypes of the SNP alleles in the amplified DNA by a technique selected from the group consisting of quantitative PCR, digital PCR, SNP microarrays, DNA microarrays, and sequencing;
determining a probability that the alleged father is the biological father of the fetus by calculating a test statistic for the alleged father and the fetus, wherein the test statistic for the alleged father and the fetus indicates a degree of genetic similarity between the alleged father and the fetus, and wherein the test statistic for the alleged father and the fetus is based on the genotypic measurements of SNP alleles made from genetic material from the alleged father and the genotypic measurements of SNP alleles made from genetic material isolated from the blood sample from the pregnant mother;
determining a distribution of test statistics for a plurality of unrelated individuals and the fetus, where each of the test statistics for the plurality of unrelated individuals and the fetus indicates a degree of genetic similarity between an individual unrelated to the fetus and the fetus, wherein the test statistic is based on genotypic measurements of SNP alleles made from genetic material from the unrelated individual and the genotypic measurements of SNP alleles made from genetic material isolated from the blood sample from the pregnant mother;
determining if the test statistic for the alleged father and the fetus belongs to the distribution of the test statistics for the plurality of unrelated individuals and the fetus; and
outputting that the alleged father is the biological father of the fetus if the test statistic for the alleged father and the fetus does not belong to the distribution of the test statistics for the plurality of unrelated individuals and the fetus.
US Pat. No. 10,111,916

COMPOSITIONS COMPRISING BACILLUS COAGULANS SPORES AND WHEY

Ganeden Biotech, Inc., M...

1. A composition which is in powdered or granular form, comprising Bacillus coagulans spores and a component obtained from the milk of a cow, sheep or goat, wherein the component is whey, and wherein said Bacillus coagulans is GBI-30, ATCC Designation Number PTA-6086.
US Pat. No. 10,113,198

GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID ARTHRITIS, METHODS OF DETECTION AND USES THEREOF

Celera Corporation, San ...

1. A diagnostic method for identifying a human for administration of a therapeutic agent to reduce their increased risk for RF-positive rheumatoid arthritis, the method comprising:a) testing nucleic acid from said human for a polymorphism in gene PTPN22 as represented by position 101 of SEQ ID NO:36673 or its complement by contacting said nucleic acid with an oligonucleotide that specifically hybridizes to T at said position 101 of SEQ ID NO:36673 or A at said complement, wherein the nucleotide sequence of said oligonucleotide consists of a segment of at least 12 contiguous nucleotides of SEQ ID NO:36673 or its complement and includes said position 101;
b) detecting the presence of said T or said A;
c) identifying said human for administration of a therapeutic agent to reduce their increased risk for RF-positive rheumatoid arthritis due to the presence of said T or said A; and
d) administering a therapeutic agent suitable for prevention or treatment of RF-positive rheumatoid arthritis to said human.
US Pat. No. 10,111,917

METHOD FOR PREPARING PURIFIED EXTRACTS OF HARPAGOPHYTUM PROCUMBENS

NATUREX, Avignon (FR)

1. A method for preparing an extract of Harpagophytum procumbens for consumption as a food product, wherein said extract is in liquid or dry form, and wherein the extract has a harpagoside titer from 5% to 50% w/w, said method comprising:i.) preparing a crude extract of Harpagophytum procumbens by extracting roots of Harpagophytum procumbens with water and/or ethanol to provide an aqueous crude extract and plant material;
ii.) optionally filtering the plant material from the aqueous crude extract and removing the plant material from the crude aqueous extract to produce a crude filtered aqueous extract; and
iii.) purifying the crude aqueous extract or the crude filtered aqueous extract by liquid-liquid extraction using an ester organic solvent, wherein the crude aqueous extract or the crude filtered aqueous extract is extracted with the ester organic solvent, and the ester organic solvent provides an ester organic phase containing the extract of Harpagophytum procumbens.
US Pat. No. 10,112,173

ZEOLITE-BASED ADSORBENTS BASED ON ZEOLITE X WITH A LOW BINDER CONTENT AND A LOW OUTER SURFACE AREA, PROCESS FOR PREPARING THEM AND USES THEREOF

Arkema France, Colombes ...

1. An adsorbent comprising a zeolite-based phase and a non-zeolite-based phase, wherein said adsorbent:has an outer surface area of less than or equal to 30 m2·g?1,
a pore diameter distribution, determined by mercury intrusion according to standard ASTM D 4284-83 and expressed by the volume distribution dV/d log DHg, wherein DHg is the apparent pore diameter and V is the pore volume, the mode of which is between 100 nm and 250 nm, limits inclusive,
and the zeolite-based phase comprises at least one zeolite of FAU structure of X type.
US Pat. No. 10,112,176

SURFACE-MODIFIED SUPER ABSORBENT RESIN AND METHOD FOR PREPARING SAME

LG Chem, Ltd., (KR)

1. A surface-modified superabsorbent polymer, having a surface modified with a water-soluble polyvalent cationic salt and a polycarbonic acid-based copolymer.
US Pat. No. 10,111,922

PREPARATION METHOD OF TEA WATER, AND TEA WATER OBTAINED THEREBY

AMOREPACIFIC CORPORATION,...

1. A method for preparing aged tea water, comprising:deactivating enzymes of raw tea leaves by subjecting the raw tea leaves to steaming, and extracting juice therefrom to obtain tea juice, wherein the raw tea leaves are non-processed tea leaves;
removing ions from the tea juice to obtain tea water; and
aging the tea water at 0-120° C. for 12-24 hours,
wherein the aged tea water comprises; linalool in an amount of 5 ?g/mL or less; hexanol in an amount of 0.2 ?g/mL or less; and/or z-3-hexenol an amount of 0.2 ?g/mL or less.
US Pat. No. 10,111,923

COMPOSITIONS COMPRISING CYCLOCARYA PALIURUS EXTRACT AND PREPARATION METHOD AND USES THEREOF

INFINITUS (CHINA) COMPANY...

1. A method for preparing an herbal extract composition comprising an extract of Cyclocarya paliurus, Puerariae lobatae Radix and Polygonati odorati Rhizoma, wherein the method comprises:i) providing a mixture of Cyclocarya paliurus leaves, Puerariae lobatae Radix and Polygonati odorati Rhizoma, wherein said mixture comprises about 30-40% (w) Cyclocarya paliurus leaves, about 30-40% (w) Puerariae Radix and about 20-30% (w) Polygonati odorati Rhizoma;
ii) extracting said mixture with water to obtain an aqueous extract;
iii) concentrating the aqueous extract to obtain a concentrated mixture;
iv) obtaining a liquid portion of said concentrated mixture; and
v) drying said liquid portion to produce an herbal extract composition.
US Pat. No. 10,112,180

CERIA-ZIRCONIA COMPOSITE OXIDE, METHOD FOR PRODUCING THE SAME, AND CATALYST FOR PURIFYING EXHAUST GAS USING THE CERIA-ZIRCONIA COMPOSITE OXIDE

TOYOTA JIDOSHA KABUSHIKI ...

1. A ceria-zirconia composite oxide containing a composite oxide of ceria and zirconia, comprisinglanthanum, wherein
a ratio of a total content of lanthanum to a total content of cerium and zirconium in the ceria-zirconia composite oxide is 0.25 atomic % to 2.5 atomic %,
a content of lanthanum present in near-surface regions accounts for 90 atomic % or more of the total content of lanthanum, the near-surface regions being at a distance of less than 50 nm from surfaces of primary particles of the ceria-zirconia composite oxide,
a content ratio of cerium to zirconium in the ceria-zirconia composite oxide is in a range from 43:57 to 48:52 by molar ratio,
an average particle size of the primary particles of the ceria-zirconia composite oxide is 2.2 ?m to 4.5 ?m, and
an intensity ratio I(14/29) of a diffraction line at 2?=14.5° to a diffraction line at 2?=29° and an intensity ratio I(28/29) of a diffraction line at 2?=28.5° to the diffraction line at 2?=29° respectively satisfy the following conditions:
I(14/29)?0.02; and
I(28/29)?0.08,
wherein the intensity ratio I(14/29) and the intensity ratio I(28/29) are calculated from an X-ray diffraction pattern of the ceria-zirconia composite oxide, the X-ray diffraction pattern being obtained by an X-ray diffraction measurement using CuK? after heating the ceria-zirconia composite oxide under a temperature condition of 1100° C. in air for 5 hours.
US Pat. No. 10,113,206

METHODS, COMPOSITIONS, AND KITS FOR DETERMINING HUMAN IMMUNODEFICIENCY VIRUS (HIV)

Grifols Therapeutics Inc....

1. A method for amplifying an HIV-1 group M, HIV-1 group O, and HIV-2 target sequence, the method comprising:performing a single multiplex real time PCR with the HIV-1 group M, HIV-1 group O, and HIV-2 target sequences as templates, wherein performing comprises providing the PCR with forward primer and reverse primer pairs, wherein the forward primer and the reverse primer pairs consist of, respectively, the sequences as set forth in SEQ ID NO:1 and SEQ ID NO:2; SEQ ID NO:3 and SEQ ID NO:4; and SEQ ID NO:5 and SEQ ID NO:6.
US Pat. No. 10,112,182

CATALYTIC ADSORBENT FOR THE CAPTURE OF ARSENIC AND THE SELECTIVE HYDRODESULFURIZATION OF GASOLINES

IFP ENERGIES NOUVELLES, ...

1. A catalytic adsorbent comprising at least cobalt and molybdenum deposited on a porous substrate in which the content of cobalt, expressed in terms of CoO oxide, is between 20 and 25% by weight relative to the total weight of said adsorbent, and the content of molybdenum, expressed in terms of MoO3 oxide, is between 3 and 30% by weight relative to the total weight of said adsorbent and in which the Co/Mo molar ratio is between 1 and 6, and wherein the cobalt and molybdenum are in part in sulfur form, the content and ratios of Co and Mo being determined before adding sulfur to put them part in sulfur form.
US Pat. No. 10,113,208

COMBINATORIAL METABOLIC ENGINEERING OF SACCHAROMYCES CEREVISIAE FOR TERMINAL ALKENE PRODUCTION

National University of Si...

1. A modified Saccharomyces cerevisiae yeast wherein the modification comprises:insertion of at least one heterologous fatty acid decarboxylase gene encoding a fatty acid decarboxylase that synthesizes terminal alkenes selected from 1-undecene, 1-tridecene, 1-pentadecene, 1-heptadecene or 1-nonadecene,
deletion of fatty acyl-Coenzyme A synthetases, FAA1 and FAA4,
overexpression of porphobilinogen deaminase, HEM3, and
triple-deletion of catalase T, CTT1, catalase A CTA1 and cytochrome c peroxidase, CCP1.
US Pat. No. 10,111,928

PULSED INTRODUCTION OF LOW-DOSE RANKL AS A THERAPY FOR OSTEOGENESIS IMPERFECTA

Saint Louis University, ...

1. A method for treating osteogenesis imperfecta in a patient, the method comprising:providing said patient a RANK agonist being of:
sufficient amount to induce osteoclasts of said patient to produce FoxP3+ CD8 T-cells (TcREG); and
insufficient amount to activate enough of said osteoclasts to create new bone loss in said patient;
repeating said providing according to a fixed schedule so as to provide said RANK agonist to said patient at pulsed intervals, said patient having as a result of said fixed schedule increased bone mass compared to a patient not on said fixed schedule.
US Pat. No. 10,112,184

ALUMINOSILICATE AEI ZEOLITE PREPARATION

Johnson Matthey Public Li...

andb. reacting the reaction mixture at an elevated temperature for a period of time sufficient to form zeolite crystals having an AEI framework and a silica-to-alumina ratio (SAR) of about 10 to about 30, wherein the reacting step, prior to removal of SDAs from the zeolite crystals, has a relative yield based on the weight of the AEI to the weight of the reaction mixture of ?about 5%.
US Pat. No. 10,111,420

WETTING COMPOSITION

RJ ROBERTS CONSULTING PTY...

1. A method for wetting a low energy surface with an aqueous liquid, the method comprising the steps of:adding a wetting composition to the aqueous liquid to lower the surface tension of the liquid and thereby increase the ability of the aqueous liquid to wet the low energy surface; and
contacting the low energy surface with the liquid comprising the wetting composition;
wherein the wetting composition comprises:
from about 50 wt % to 70 wt % of a C5 to C12 alcohol; and
greater than or equal to about 30 wt % of a surfactant capable of forming micelles, the surfactant being selected from one or more anionic, cationic, and non-ionic surfactants;
wherein the C5 to C12 alcohol and the surfactant together make up 90 wt % or more of the wetting composition; and
wherein the amount of wetting composition added to the aqueous liquid is from about 0.1 to 5 vol %.
US Pat. No. 10,112,188

PROCESS FOR MANUFACTURE OF A ZEOLITE BASED CATALYST FOR THE CONVERSION OF METHANOL TO OLEFINS

CLARIANT PRODUKTE (DEUTSC...

1. A process for manufacturing of a zeolite based catalyst comprising the following steps:(a) adding an aluminum oxide and an acid to a zeolite powder of pentasil type, wherein the zeolite powder has an Si/Al atomic ratio of about 50 to about 250 and is of the H form,
(b) forming, drying and calcining, without treatment with steam, the mixture obtained in step (a) to obtain formed material,
(c) impregnating the formed material of step (b) with a phosphorus compound to obtain a phosphorus containing product, and
(d) calcining the phosphorus containing product from step (c) at a temperature in the range of from 150° C. to 800° C., to obtain a phosphorus containing catalyst
wherein the amounts of the aluminum oxide added in step (a), and of the phosphorus compound added in step (c) are chosen such that the AI:P atomic ratio in the phosphorus containing catalyst obtained in step (d) is 2.5 or more.
US Pat. No. 10,112,189

TRANS-METALLATED MOF CATALYST

King Fahd University of P...

1. A transmetallated metal organic framework catalyst, comprising:zinc (II) ions;
second metal ions selected from the group consisting of cobalt (II) ions, iron (II) ions, copper (II) ions and mixtures thereof; and
benzene-1,3,5-tricarboxylic acid ligands;
wherein the benzene-1,3,5-tricarboxylic acid ligands comprise carboxylate groups, each carboxylate group forming a coordinative bond to the zinc (II) ions or the second metal ions to form a coordination network in the form of porous polyhedral crystals that are isostructural to an HKUST-1 metal organic framework,
wherein the metal organic framework catalyst does not comprise a coordinated solvent and a ratio of the Zn (II) ions to the second metal ions is in the range of 1.0 to 3.0.
US Pat. No. 10,111,422

COMPOSITION AND METHOD FOR RETENTION OF SOLVATED COMPOUNDS AND IONS

ECO VERDE TECHNOLOGIES, I...

1. A method of controlled release of one or more compounds, the method comprisinga. forming a controlled release composition by reacting a reactive composition comprising
i. an ether adduct having the structure X—O—Y, wherein X is the residue of a polyhydroxylated aromatic compound free of methylol moieties, O is oxygen, and Y is a group comprising from about 10 to 1000 ethylene oxide and propylene oxide repeat units arranged in a block conformation; and
ii. a phenolic aldehyde prepolymer, an aldehyde, or a combination thereof;
b. curing the reactive composition to form a cured composition;
c. loading the composition with one or more compounds, and
d. placing the loaded composition in a release environment.
US Pat. No. 10,111,934

IGF-1 PROTEINS AND THERAPEUTIC USES THEREOF

THE TRUSTEES OF THE UNIVE...

1. A pharmaceutical composition comprising a pharmaceutically acceptable carrier and a mutant pro-IGF-I protein, wherein the mutant pro-IGF-I protein comprises an amino acid sequence set forth in SEQ ID NO: 5, wherein the amino acid sequence comprises a combination of mutation K68G, a mutation at amino acid residue R71, and a mutation at amino acid residue R77.
US Pat. No. 10,111,935

AGENT FOR CAPTURING TUMOR CELLS AND METHODS OF USE THEREOF

1. A method of manufacturing an agent for modulating metastatic tumor cell dissemination, the method comprising the steps of:preparing a suspended solution of a cryogenically ground ECM protein;
coating a polycarbonate polyurethane matrix by saturation within the solution of the cryogenically-ground ECM protein; and
drying the ECM protein within the polycarbonate polyurethane matrix to form the agent for modulating metastatic tumor cell dissemination.
US Pat. No. 10,113,217

PLATINUM THERMOCOUPLE WIRE

FURUYA METAL CO., LTD., ...

1. A platinum thermocouple wire being used in a negative electrode of a platinum-based thermocouple, whereina nitrogen mass concentration is 10 to 100 ppm, and
when structure observation of a cross section of the wire in a longitudinal direction is performed, a structure is observed in which there is a plurality of crystal grains, which have an aspect ratio {(length of major axis)/(length of minor axis perpendicular to major axis)} of 5 or more and elongate in the longitudinal direction of the wire, in a wire thickness direction.
US Pat. No. 10,111,425

DISINFECTANT FORMULATION

1. An aqueous disinfectant formulation consisting of:a) from about 0.05% to about 25% weight of at least one antimicrobial isolated or synthetic phenolic compound of natural origin selected from the group consisting of thymol and carvacrol;
b) from about 0.1% to about 15% weight of an anionic, a cationic, an amphoteric, an non-ionic surfactant, or combinations thereof, in an amount sufficient to form a solution or dispersion of said phenolic compound in an aqueous carrier;
c) from about 0.1% to about 40% weight of a solvent;
d) from about 0.01% to about 10% weight of a sequestering agent selected from the group consisting of ethylene diamine tetraacetic acid (EDTA) sodium salt, sodium gluconate, citric acid, trisodium NTA, trisodium ethylene disuccinate, and sodium choleate;
e) from about 0.01% to about 5% weight of a pH adjusting agent; and
f) sufficient water to make 100 weight percent.
US Pat. No. 10,112,963

SUBSTITUTED BISPHENYL BUTANOIC PHOSPHONIC ACID DERIVATIVES AS NEP INHIBITORS

Novartis AG, Basel (CH)

1. A compound selected from the group consisting of:(3-(((R)-1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-((S)-1-(((cyclohexyloxy)carbonyl)oxy)ethoxy)-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid;
(3-(((2R)-1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-(1-(((cyclohexyloxy)carbonyl)oxy)ethoxy)-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid; and
(R)-(3-((1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-ethoxy-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid; or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,113,219

NANO-PEARLITE RAIL AND PROCESS FOR MANUFACTURING SAME

Yanshan University, Qinh...

1. A nano-pearlite rail, which is a steel rail having an internal microstructure of 100% pearlite with an average interlamellar spacing of pearlite of 55-70 nm, and containing 0.83 to 0.93 of C, 0.05 to 0.10 of Mn, a certain content of Al and Si, 1.0 to 1.5 of Cr, 0.1 to 0.3 of Co, 0.35 to 0.55 of Zr, 0.02 to 0.06 of Mg, 0.01 to 0.05 of Cu, less than 0.025 of S, less than 0.025 of P, and reminder of Fe, wherein the content of Al is 8 to 12 times the content of Mn and the collective content of Al and Si is 1, wherein all the amounts are expressed in wt. %.
US Pat. No. 10,113,220

HIGH STRENGTH, HOT DIPPED GALVANIZED STEEL SHEET EXCELLENT IN SHAPEABILITY AND METHOD OF PRODUCTION OF SAME

1. A high strength hot dipped galvanized steel sheet comprising, as ingredients of the steel, by mass %,C: 0.05 to 0.1%,
Si: 0.1 to 1.0%,
Mn: 2.0% to 2.5%,
Al: 0.02 to 0.1%,
Ti: 0.01 to 0.05%,
Cr: 0.1 to 1.0%,
Sn: 0.0010 to 0.1%, and
a balance of Fe and unavoidable impurities,
as the unavoidable impurities,
P: 0.03% or less,
S: 0.01% or less,
Nb: 0.001% or less,
V: 0.001% or less,
W: 0.001% or less,
Mo: 0.001% or less,
Zr: 0.001% or less,
B: 0.0001% or less,
having a microstructure containing, by area %, 70-90% of ferrite and the balance being comprised of a low-temperature transformation phase containing martensite,
having an average grain size of the low temperature transformed phase of 0.1 to 1 ?m,
having a ratio of average nano hardnesses of the ferrite phase and the low temperature transformed phase of 1.5 to 3.0, and
having a nano hardness of the low temperature transformed phase at 80% or more of the measurement points of 1 to 5 times the average nano hardness of the ferrite phase.
US Pat. No. 10,111,427

FORMULATION FOR IMPROVING THE YIELD AND QUALITY OF FIBER IN COTTON PLANTS

1. A plant growth stimulating formulation, suitable for improving fiber yield and quality of the plant, comprising a solution of Anacardic acid or its other derivatives at a concentration ranging from 2-20?M, along with Phytohormone ingredients 1-Naphthaleneacetic acid (1-NAA), and Gibberellic Acid; wherein the presence of anacardic acid or its other derivatives in the formulation in combination with the phytohormone ingredients improves the fiber yield and quality of the plant.
US Pat. No. 10,111,940

PROSTATE CANCER VACCINE

Wisconsin Alumni Research...

1. A method for inducing an immune reaction to androgen receptor in a mammal having prostate cancer, comprising administering to the mammal an effective amount of a polypeptide selected from the group consisting of (i) a mammalian androgen receptor (e.g., a human androgen receptor), (ii) a fragment of the androgen receptor that comprises the ligand-binding domain, (iii) a fragment of the ligand-binding domain defined by SEQ ID NO:9, (iv) a fragment of the ligand-binding domain defined by SEQ ID NO:10, (v) a fragment of the ligand-binding domain defined by SEQ ID NO:11, and (vi) a fragment of the ligand-binding domain defined by SEQ ID NO:12, whereby the mammal develops immune reaction against androgen receptor.
US Pat. No. 10,111,942

TARGETS OF ACINETOBACTER BAUMANNII

1. An immunogenic composition comprising:an isolated polypeptide encoded by a recombinant nucleic acid molecule comprising a polynucleotide having the nucleic acid sequence of:
SEQ ID NO: 3; and,
an immuno-effective amount of an adjuvant;
wherein the composition is effective in generating an immune response against Acinetobacter baumannii in a subject in need thereof.
US Pat. No. 10,111,431

APPLICATION OF BIOFILM FORMATION INHIBITING COMPOUNDS ENHANCES CONTROL OF CITRUS CANKER

University of Florida Res...

1. A method of reducing population of microbe on an object, the method comprising: applying to the object a biofilm reducing agent, or a metal antimicrobial agent and a biofilm reducing agent, in amount and for time sufficient to reduce the microbial population, wherein the microbial population comprises Xanthomonas citri subsp. citri and the biofilm reducing agent comprises D-leucine, D-Serine, or 3-idolylacetonitrile.
US Pat. No. 10,111,943

ALPHAVIRUS REPLICON PARTICLES MATCHED TO PROTEIN ANTIGENS AS IMMUNOLOGICAL ADJUVANTS

ALPHAVAX, INC., Research...

1. A vaccine composition comprising (a) purified protein and (b) alphavirus replicon particles expressing said protein, wherein the protein is an influenza virus hemagglutinin protein and wherein the alphavirus is Venezuelan Equine Encephalitis (VEE) Virus.
US Pat. No. 10,111,944

INFLUENZA VIRUS VACCINES AND USES THEREOF

1. An influenza hemagglutinin stem domain polypeptide comprising the amino acid sequence:DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLENGGGGKYVCSAKLRMVTGLRNX1PS X2QSQGLFGAIAGX3X4EGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNK VNSVIEKX5NTQX6TAX7GKEX8NKX9ERRMKQIEDKIEEIESKIWCYNAELLVLLENERTL DFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNREKIDG (SEQ ID NO: 146),
wherein X1 is K, X2 is K, X3 is F, X4 is T, X5 is M, X6 is Y, X7 is I, X8 is Y, and X9 is S.
US Pat. No. 10,112,971

PROTEIN PURIFICATION IN THE PRESENCE OF NONIONIC ORGANIC POLYMERS AND ELECTROPOSITIVE SURFACES

AGENCY FOR SCIENCE, TECHN...

1. A method of purifying an antibody from a preparation comprising:(a) providing the preparation comprising an antibody;
(b) adding allantoin to the preparation to a supersaturating concentration, wherein after adding the allantoin, the preparation is supersaturated with allantoin;
(c) removing solids from the preparation;
(d) contacting the preparation with polyethylene glycol (PEG) having a molecular weight of 2,000 to 12,000 Daltons and a salt, wherein (i) a concentration of the PEG is sufficient to precipitate the antibody or cause its accretion on a first surface, or maintain it in a precipitated state or accreted on the first surface, and (ii) the salt concentration is sufficient to produce a conductivity between 50 mS/cm and 150 mS/cm; and
(e) contacting the preparation with at least one electropositive surface whereby the antibody does not adsorb to the at least one electropositive surface, wherein the contacting does not prevent adsorption of acidic contaminants to the at least one electropositive surface.
US Pat. No. 10,111,946

POXVIRAL VECTORS FOR LOW ANTIBODY RESPONSE AFTER A FIRST PRIMING IMMUNIZATION

1. An early/late hybrid promoter comprising (a) a late element driving late expression of an antigenic determinant and (b) at least two Pr7.5 early elements (Pr7.5E) driving early expression of the antigenic determinant, wherein the late element is linked to the at least two early elements, and wherein RNA levels from the late element in a recombinant modified vaccinia Ankara (MVA) virus are at least 1.5 fold greater than RNA levels produced by the SEQ ID NO: 11 promoter in a recombinant MVA virus in HeLa cells.
US Pat. No. 10,112,972

PROCESS FOR PRODUCTION OF FIBRINOGEN AND FIBRINOGEN PRODUCED THEREBY

OCTAPHARMA AG, Lachen (C...

1. A process for purifying fibrinogen from a fibrinogen containing source, the process comprising precipitating fibrinogen with a precipitating agent from the fibrinogen containing source in the presence of one or more chelating agent(s) to form a fibrinogen paste, removing the supernatant from the fibrinogen paste, extracting fibrinogen from the fibrinogen paste in an aqueous medium void of the chelating agent(s) for a suitable extraction time thereby forming a liquid fraction containing fibrinogen and an undissolved residue, and separating the undissolved residue from the liquid fraction containing fibrinogen, whereinaddition of one or more protease inhibitor(s) is omitted in all steps of the process,
the fibrinogen is precipitated in a temperature range of from 4.1° C. to 40° C., and
the one or more protease inhibitor(s) is selected from the group consisting of C1-protease inhibitors, trypsin inhibitors, thrombin inhibitors, antithrombin-III (AT-III), heparin-cofactor-II, aprotinin, pepstatin, leupeptin and epsilon-aminocaproic acid.
US Pat. No. 10,111,949

COMPOSITIONS AND METHODS FOR SELF-ADJUVANTING VACCINES AGAINST MICROBES AND TUMORS

The Regents of the Univer...

1. An isolated protein comprising a multimerizing domain from the N-terminal fragment of Latent Membrane Protein 1 (LMP1) operatively joined to a cytoplasmic signaling domain of a heterologous receptor such that the protein assembles into a complex of three or more protein moieties; wherein the LMP1 multimerizing domain is translated from nucleic acids that do not contain introns.
US Pat. No. 10,111,438

COMPOSITIONS AND METHODS FOR IMPROVING FRUIT PRODUCTION

NEWLEAF SYMBIOTICS, INC.,...

1. A method for improving fruit production, said method comprising:(a) applying a composition comprising Methylobacterium and an agriculturally acceptable adjuvant, excipient, or combination thereof to a fruit bearing plant, wherein said Methylobacterium is NLS0037 (NRRL B-50941), NLS0038 (NRRL B-50942), NLS0042 (NRRL B-50932), NLS0062 (NRRL B-50937), and wherein said fruit bearing plant is an apple, pear, grape, citrus, melon, pepper, berry, kiwi, mango, or banana plant, and,
(b) harvesting fruit from said plant, wherein said plant exhibits faster fruit set, increased fruit set, earlier fruit maturation, and/or more uniform fruit maturation compared to an untreated control plant, thereby obtaining improved fruit production.
US Pat. No. 10,111,439

NON-AQUEOUS, NON-OIL BACILLUS AMYLOLIQUEFACIENS COMPOSITIONS

VALENT BIOSCIENCES LLC, ...

1. A non-aqueous, non-oil liquid composition comprising live Bacillus amyloliquefaciens, a liquid carrier selected from the group consisting of a polyethylene glycol, glycerol, ethylene glycol, dipropylene glycol, propylene carbonate and mixtures thereof, a vinylpyrrolidone polymer and a nonionic block copolymer.
US Pat. No. 10,111,440

NON-AQUEOUS, NON-OIL LIVE MICROBIAL COMPOSITIONS

VALENT BIOSCIENCES LLC, ...

1. A non-aqueous, non-oil liquid composition comprising live microbial organisms, a liquid carrier selected from the group consisting of a polyethylene glycol, glycerol, ethylene glycol, dipropylene glycol, propylene carbonate and mixtures thereof, a vinylpyrrolidone polymer and a nonionic block copolymer.
US Pat. No. 10,111,952

SILICON DIOXIDE NANOPARTICLES AND THE USE THEREOF FOR VACCINATION

MERCK PATENT GmbH, Darms...

1. A method for providing an adjuvant immune response, comprising administering nanoparticles of silicon dioxide to a patient in need thereof, wherein the nanoparticles have a size of at least 5 nm up to 150 nm.
US Pat. No. 10,112,208

GLASS ARTICLES WITH NANOPARTICLE REGIONS

1. A glass article, comprising:a glass substrate having a first surface, a second surface, and an edge;
a first nanoparticle region located within the substrate comprising first nanoparticles which are completely surrounded by the substrate; and
a second nanoparticle region located adjacent at least one of the first surface and the second surface, wherein the second nanoparticle region comprises second nanoparticles, wherein at least some of the second nanoparticles are completely surrounded by the substrate.
US Pat. No. 10,112,978

PEPTIDE AND USE THEREOF

Osaka University, Suita ...

1. A composition containing (a) a peptide of 20 or less amino acids comprising the amino acid sequence LHRLKRLRKRLK (SEQ ID NO: 9) and (b) at least one antigen that is different from the peptide.
US Pat. No. 10,114,004

SINGLE CELL ANALYSIS USING SECONDARY ION MASS SPECTROMETRY

The Board of Trustees of ...

1. A method of analyzing a cell, comprising:obtaining a cell on a substrate, wherein the cell is labeled with a plurality of mass tags; measuring, using mass spectrometry, an abundance of each of the plurality of mass tags at a plurality of sites for each of a plurality of depths within the cell, thereby generating a set of data, wherein the abundance of each of the plurality of mass tags at a plurality of sites for each of a plurality of depths within the cell is measured using secondary ion mass spectrometry (SIMS).
US Pat. No. 10,111,953

METHODS FOR REDUCING REMNANT CHOLESTEROL AND OTHER LIPOPROTEIN FRACTIONS BY ADMINISTERING AN INHIBITOR OF PROPROTEIN CONVERTASE SUBTILISIN KEXIN-9 (PCSK9)

Regeneron Pharmaceuticals...

1. A method for reducing in a patient the serum concentration of IDL-C; the method comprising selecting a patient with elevated serum IDL-C, and administering to the patient a pharmaceutical composition comprising a PCSK9 inhibitor;wherein the patient is otherwise healthy except for exhibiting elevated serum IDL-C; and
wherein the PCSK9 inhibitor is an antibody or antigen-binding fragment of an antibody that specifically binds PCSK9 and comprises the heavy and light chain CDRs of a HCVR/LCVR amino acid sequence pair selected from the group consisting of SEQ ID Nos: 90/92 and 218/226.
US Pat. No. 10,112,979

INFLUENZA VACCINATION

Seqirus UK Limited, Berk...

1. A method of immunizing a patient against an influenza virus comprising steps of:(a) selecting a patient that is immunologically naïve to the influenza virus; and
(b) administering an immunological composition comprising an antigen of the influenza virus to the patient; wherein
the immunological composition is delivered to the patient's Langerhans cells by microporation using microneedles made from at least one biocompatible polymer, which open pores in the patient's stratum corneum, wherein the microneedles ranges in length from 25 ?m to 1 mm. and wherein the influenza virus antigen is in the form of an inactivated virus or a virosome or wherein the influenza virus antigen is produced by a recombinant or synthetic system that does not involve growth of influenza viruses.
US Pat. No. 10,111,954

COMBINATION THERAPY FOR INDUCING IMMUNE RESPONSE TO DISEASE

IBC Pharmaceuticals, Inc....

1. A method of treating a Trop-2+ cancer comprising:a) administering to a human subject with a Trop-2+ cancer a trivalent T-cell redirecting complex comprising a bispecific antibody, wherein the bispecific antibody comprises (i) an anti-CD3 antibody moiety conjugated to an AD (anchoring domain) moiety from an AKAP protein, wherein the amino acid sequence of the AD moiety is SEQ ID NO:4 and (ii) an anti-Trop-2 antibody moiety conjugated to a DDD (dimerization and docking domain) moiety with an amino acid sequence of residues 1-44 of human protein kinase A (PKA) regulatory subunit RII?, wherein two copies of the DDD moiety form a dimer that binds to one copy of the AD moiety to form a complex; and
b) administering to the subject a checkpoint inhibitor antibody selected from the group consisting of pembrolizumab (MK-3475), nivolumab (BMS-936558), and pidilizumab (CT-011).
US Pat. No. 10,112,980

MUTATED IMMUNOGLOBULIN-BINDING POLYPEPTIDES

1. A separation matrix, comprising a plurality of polypeptides or multimers of the polypeptides coupled to a solid support, wherein the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 6-10, 12, 13, or a combination thereof.
US Pat. No. 10,112,982

DETECTION OF ANTI-NEUROCHONDRIN AUTOANTIBODY IN PATIENTS WITH CEREBELLAR ATAXIA OR CEREBELLITIS

EUROIMMUN MEDIZINISCHE LA...

1. A method of detecting an autoantibody to Neurochondrin in a subject, the method comprising:contacting a bodily fluid sample isolated from a subject having cerebellar ataxia or cerebellitis with a polypeptide comprising Neurochondrin, wherein the polypeptide comprising Neurochondrin is recombinant and/or isolated, and binds specifically to autoantibodies binding to Neurochondrin, and
detecting the presence or absence of the autoantibody to Neurochondrin in a complex with the polypeptide.
US Pat. No. 10,114,264

DEVICE FOR REGULATING THE PASSAGE OF ENERGY

Merck Patent GmbH, Darms...

1. A device for regulating the passage of light through a light-transmitting area, said device comprising:one or more glass layers and at least one switching layer which comprises a liquid-crystalline medium comprising at least one dichroic dye,
wherein said switching layer has a bright state ?v bright and a dark state ?v dark, and
wherein said switching layer has a degree of anisotropy R of at least 0.65 and a degree of light transmission in the bright state ?v bright in accordance with Standard EN410 of 40% to 90%,
wherein said device is a component of a window,
wherein said switching layer comprises three or more different dichroic dyes, and
wherein the liquid-crystalline medium has a clearing point in the temperature range from 70° C. to 170° C.
US Pat. No. 10,112,983

NEUREGULIN VARIANTS AND METHODS OF SCREENING AND USING THEREOF

1. A polypeptide variant of neuregulin-1 ? comprising amino acid sequence shown in SEQ ID NO:1, wherein the polypeptide variant comprises a different amino acid than that in SEQ ID NO:1, wherein the polypeptide variant has an enhanced binding affinity to ErbB3 compared to polypeptide of SEQ ID NO:1, and whereinat residue 25 said different amino acid is A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y; or
at residue 35 said different amino acid is A, C, D, E, F, G, H, I, L, N, M, P, Q, R, S, T, V, W, or Y; or
at residue 46 said different amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, or Y.
US Pat. No. 10,114,009

METHODS OF DETECTING T1R HETERO-OLIGOMERIC TASTE RECEPTOR EXPRESSION TO IDENTIFY CELLS THAT ARE POTENTIALLY SENSITIVE TO SWEET TASTANTS

Senomyx, Inc., San Diego...

1. An in vitro method of detecting a human or monkey cell that is potentially sensitive to sweet tastants, the method comprising: (a) detecting the expression of a T1R2 polypeptide at least 90% identical to the polypeptide of SEQ ID NO: 6 and (b) further detecting expression of a T1R3 polypeptide at least 90% identical to the polypeptide of SEQ ID NO: 7; and (c) based on the results of (a) and (b), identifying a cell that expresses said T1R2 and T1R3 polypeptides (“detected cell”) which, therefore, is potentially sensitive to sweet tastants (“detected cell”).
US Pat. No. 10,111,446

FATTY ACID VINYL ESTER COPOLYMERS WITH WAX QUALITIES

Wacker Chemie AG, Munich...

1. A method for preparing fatty acid vinyl ester copolymers by free-radical initiated polymerization ofa) one or more vinyl esters of carboxylic acids having 16 to 22 carbon atoms and
b) one or more vinyl esters of carboxylic acids having 2 to 15 carbon atoms,
wherein the one or more vinyl esters a) and the one or more vinyl esters b) are metered in during the polymerization, and
during the polymerization either a metered addition rate of vinyl ester a) or a metered addition rate of vinyl ester b) is reduced and the metered addition rate of the other of the two vinyl esters a) or b) is increased.
US Pat. No. 10,111,958

ANTI-CD40 ANTIBODY FORMULATION

Novartis AG, Basel (CH)

1. An aqueous pharmaceutical composition, wherein the composition has a pH of 6.0 and comprises(i) an anti-CD40 antibody wherein the antibody has a concentration of 150 mg/ml, and wherein said anti-CD40 antibody includes heavy chain CDR1, CDR2 and CDR3 of SEQ ID NOs 3, 4 and 5 respectively, and light chain CDR1, CDR2 and CDR3 of SEQ ID NOs: 6, 7 and 8,
(ii) 270 mM sucrose as a stabiliser,
(iii) 30 mM histidine as a buffering agent, and
(iv) 0.06% polysorbate 20 as a surfactant.
US Pat. No. 10,114,010

BIOMIMETIC INTERFACE DEVICE AND METHODS OF USING THE SAME

1. A method of using a physiologically-relevant apparatus, the method comprising the steps of:providing an apparatus including at least one cassette; wherein each cassette includes a spun elastomer scaffold located within a channel separating two chambers, the spun elastomer scaffold, channel and chambers are sealed within the cassette; wherein each chamber in each cassette includes a port and nozzle configured to connect each chamber to tubing; wherein the tubing is connected to a pump; wherein the pump is configured to flow fluid in a circuit through the tubing and each cassette seeding a spun elastomer scaffold in the apparatus with a biological sample; and at least one reservoir connected to the tubing;
configuring the apparatus pump to create a specified flow rate and pressure;
adding an analyte to a reservoir;
flowing a fluid through the apparatus for a specified period of time; and
measuring the analyte;
wherein the spun elastomer scaffold is self-riveted to the chambers.
US Pat. No. 10,114,266

ELECTROACTIVE OPTICAL DEVICE

PPG Industries Ohio, Inc....

1. An electroactive optical device comprising:(a) an optical substrate having two opposing surfaces;
(b) at least two electrodes spaced one from the other and disposed on the surface of the substrate;
(c) at least one electroactive material layer in contact with the at least two electrodes (b) and the surface of the substrate (a) wherein the electroactive material layer comprises at least one electrochromic-dichroic material which is a single compound which is both electrochromic and dichroic in response to an applied voltage, and
wherein the electroactive optical device has variable light transmittance in response to the magnitude of an applied electrical voltage.
US Pat. No. 10,111,959

ANTIMICROBIAL GELS

1. An antimicrobial dressing comprising an antimicrobial gel comprising at least two polysiloxanes, wherein the antimicrobial gel is formed by creating at least one covalent bond between at least one alkenyl and/or alkynyl moiety of a first polysiloxane and at least one Si—H moiety of a second polysiloxane, the antimicrobial gel further comprises at least one hydrosilylation catalyst, at least one silver salt, and at least one hydrophilic component, wherein the at least one hydrophilic component makes the antimicrobial gel swell at least 5% (wt/wt) after 24 hours in a water solution containing 8.298 g/L of sodium chloride and 0.368 g/L of calcium chloride dihydrate, as measured by the free swell absorption method, wherein the antimicrobial gel is on a substrate, wherein the substrate comprises a foam comprising polyurethane, wherein the antimicrobial gel is characterized in having an accumulated silver release of at least 0.3% of the total silver content in the initial antimicrobial composition after 24 hours.
US Pat. No. 10,114,011

ANTIGEN PRESENTING CELL ASSAY

1. A method, comprising:(i) contacting a first portion of a biological sample comprising antigen presenting cells (APCs) obtained from a subject in need of or having received an organ transplant from a donor, with a donor antigen from the donor in vitro under conditions sufficient to induce uptake of the donor antigen;
(ii) contacting a second portion of the biological sample comprising APCs obtained from the subject in need of or having received an organ transplant with a third-party antigen in vitro under conditions sufficient to induce uptake of the third-party antigen; and
(iii) measuring amount of uptake of the donor antigen in the first portion of the biological sample and measuring amount of uptake of the third-party antigen in the second portion of the biological sample, wherein the APCs are dendritic cells or macrophages, wherein the method determines the ratio of uptake of the donor antigen in the first sample and the uptake of the third party antigen by the APCs in the second sample.
US Pat. No. 10,112,986

ANTI-GLUCOSAMINIDASE PASSIVE IMMUNIZATION FOR STAPHYLOCOCCUS AUREUS INFECTIONS

University of Rochester, ...

1. A method of introducing an orthopedic implant into a patient comprising:administering to a patient in need of an orthopedic implant an effective amount of an antibody or an antigen-binding portion of an antibody that binds specifically to a Staphylococcus aureus glucosaminidase and comprises the complementarity determining region sequences of the VH domain of SEQ ID NO:2 and the VL domain of SEQ ID NO:3; and
introducing the orthopedic implant into the patient.
US Pat. No. 10,114,012

METHODS AND ASSAYS FOR DETECTING AND QUANTIFYING PURE SUBPOPULATIONS OF WHITE BLOOD CELLS IN IMMUNE SYSTEM DISORDERS

THE BOARD OF TRUSTEES OF ...

1. A method for determining a subject's susceptibility to an allergic reaction, the method comprising:(a) stimulating a whole blood sample from the subject with an allergen, wherein the whole blood sample comprises a basophil cell population;
(b) labeling the whole blood sample with anti-CD203c and a differential label for phosphatase and tensin homolog (PTEN); and
(c) measuring a level of expression of CD203c and PTEN using flow cytometry and comparing the level of expression to a control sample, wherein a higher level of expression of CD203c and PTEN in the basophil cell population compared to the control sample is indicative of increased susceptibility to an allergic reaction to the allergen in the subject.
US Pat. No. 10,111,961

SELF-ASSOCIATING MICROPARTICLES AND NANOPARTICLES CONSISTING OF PROTEINS

CENTRE NATIONAL DE LA REC...

1. An inclusion complex formed by the interaction betweenat least one protein selected from the group consisting of elastin, collagen, gliadin, gelatin, keratin, legumin, vicilin, casein, fibrinonectin and fibrillin, said protein substituted by hydrophobic groups covalently bound to said protein, and
at least one ?-cyclodextrin (CD) in the form of a monomer,the protein and the cyclodextrin being non-covalently bound, wherein the hydrophobic groups by which said protein is substituted are alkyl groups, linear or branched.
US Pat. No. 10,114,013

METHOD FOR DETECTION OF COENZYME Q10

Berg, LLC, Framingham, M...

1. A method for determining the amount of coenzyme Q10 (CoQ10) or reduced form of coenzyme Q10 (CoQ10H2) in a sample, the method comprising analyzing the sample using LC/MS/MS using oxidized deuterated coenzyme Q10 (CoQ10-d6) and/or reduced deuterated coenzyme Q10 (CoQ10H2-d6) as an internal standard, wherein the method comprises the steps of:a1) adding a known amount of deuterated coenzyme Q10 (CoQ10-d6) to the sample,
b1) detecting CoQ10 and CoQ10-d6 by mass spectrometry, and
c1) determining the amount of detected CoQ10 by comparing it to the known amount of detected CoQ10-d6; or
a2) adding a known amount of reduced deuterated coenzyme Q10 (CoQ10H2-d6) to the sample,
b2) detecting CoQ10H2 and CoQ10H2-d6 by mass spectrometry, and
c2) determining the amount of detected CoQ10H2 by comparing it to the known amount of detected CoQ10H2-d6; or
a3) adding a known amount of CoQ10-d6 and CoQ10H2d6 to the sample,
b3) detecting CoQ10, CoQ10H2, CoQ10-d6 and CoQ10H2-d6 by mass spectrometry,
c3) determining the amount of detected CoQ10 by comparing it to the known amount of detected CoQ10H2-d6, and
d3) determining the amount of detected CoQ10H2 by comparing it to the known amount of detected CoQ10H2-d6.
US Pat. No. 10,111,450

PROCESS FOR MAKING A MULTIPHASE JELLIFIED BEVERAGE COMPOSITION

Nestec S.A., Vevey (CH)

1. A process comprising the steps of, in order:providing a water, juice, and/or milk-based jellified product comprising at least two separate homogeneous gel masses, each of the separate homogeneous gel masses comprising carrageenan and galactomannan, wherein adjacent separate gel masses have different gel strengths between 10 and 400 g; and
manually shaking the product for a period of time sufficient to break the weakest gel mass into particles to form a jellified ready-to-drink beverage.
US Pat. No. 10,111,451

FOOD, BEVERAGE OR PHARMACEUTICAL COMPOSITION CONTAINING FERMENTED EASTERN PRICKLY PEAR AND A PREPARATION METHOD THEREFOR

1. A method of treating acne or atopic dermatitis in a human in need thereof consisting essentially of administering to the human in need thereof a therapeutically effective amount of Eastern Prickly Pear which has been fermented with nuruk or Aspergillis oryzae to effectively treat the acne or atopic dermatitis in the human in need thereof.
US Pat. No. 10,112,989

POLYPEPTIDES AND POLYPEPTIDE CONSTRUCTS COMPRISING SINGLE DOMAIN ANTIBODIES DIRECTED AGAINST VON WILLEBRAND FACTOR

Ablynx, N.V., Ghent-Zwij...

1. A method for the treatment and/or alleviation of disorders relating to platelet-mediated aggregation, comprising administering to a subject in need of such treatment an effective amount of a polypeptide construct comprising at least one single domain antibody that specifically binds vWF,wherein the at least one single domain antibody has complementarity determining regions (CDRs) and framework regions (FRs), and,
wherein the at least one single domain antibody comprises:
a sequence represented by any one of SEQ ID NOs: 1 to 7, 23 to 31, and 62 to 65, or
an homologous sequence of any one of SEQ ID NOs: 1 to 7, 23 to 31, and 62 to 65, wherein the FRs have a sequence identity of more than 85% with the FRs of the parent sequence; or
an homologous sequence of any one of SEQ ID NOs: 1 to 7, 23 to 31, and 62 to 65, wherein the FRs have up to 10 amino acid substitutions compared to the FRs of the parent sequence, and,
wherein said polypeptide or polypeptide construct is able to inhibit at least 50% of platelet aggregation at high shear (1600 s?1) at a concentration of between 0.08 and 0.3 ?g/ml.
US Pat. No. 10,111,965

CELL PENETRATING PEPTIDES FOR INTRACELLULAR DELIVERY OF MOLECULES

Aadigen, LLC, Pacific Pa...

1. A complex comprising:a) a cell-penetrating peptide characterized in that it comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-4; and
b) a cargo selected from the group consisting of peptides, proteins, peptide analogs, uncharged oligonucleotides, PNAs and small hydrophobic molecules.
US Pat. No. 10,112,991

HUMANIZED ANTIBODIES SPECIFIC TO THE PROTOFIBRILLAR FORM OF THE BETA-AMYLOID PEPTIDE

SANOFI, Paris (FR)

1. A polynucleotide encoding for a polypeptide having at least 95% identity with SEQ ID NO: 26; ora polynucleotide encoding for a polypeptide having at least 90% identity with SEQ ID NO: 28; or
a polynucleotide comprising at least 99% identity with SEQ ID NO: 3; or
a polynucleotide comprising at least 95% identity with SEQ ID NO: 5 or 27; or
a polynucleotide comprising at least 90% identity with SEQ ID NO: 25.
US Pat. No. 10,111,454

RANGE OF ASEPTICALLY PRODUCED INFANT FOODS HAVING LOW CONCENTRATIONS OF UNDESIRED BY-PRODUCTS AND METHODS FOR MAKING SAME

Nestec, S.A., Vevey (CH)...

1. A method of producing a heat processed, aseptically packaged infant food product from a plurality of ingredients, the method comprising the steps of:precooking the plurality of ingredients separately;
mixing the precooked ingredients;
subjecting the mixed, precooked ingredients to ultra-high-temperature (UHT) sterilization;
aseptically packaging the UHT-treated infant food product within a packaging container following UHT sterilization; and
wherein the heat processed, aseptically packaged infant food product has reduced levels of furan produced during processing when compared to similar products processed using conventional retorting under sterilization conditions, as indicated by less than about 5 micrograms furan per kg food product.
US Pat. No. 10,114,018

IL-2 PEPTIDE DERIVATIVES, AND USES THEREOF FOR THE DIAGNOSIS AND TREATMENT OF AN AUTOIMMUNE DISEASE


US Pat. No. 10,111,967

COMPLEXES OF RNA AND CATIONIC PEPTIDES FOR TRANSFECTION AND FOR IMMUNOSTIMULATION

1. A method of inducing or enhancing an innate immune response in a subject in need thereof, comprising administering to the subject a complexed ribonucleic acid (RNA) comprising at least one RNA molecule complexed with one or more oligopeptides, wherein the at least one RNA molecule is not covalently bound to the one or more oligopeptides, wherein the nitrogen/phosphate ratio (N/P-ratio) of the RNA to the one or more oligopeptides is in the range of 0.75-25, and wherein the oligopeptide is 8 to 15 amino acids in length and comprises the following formula:(Arg)l;(Lys)m;(His )n;(Orn)o;(Xaa)x  (formula I)whereinl+m+n+o+x=8-15, and
l, m, n or o independently of each other is any number selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15, provided that the overall content of Arg, Lys, His and Orn represents at least 50% of all amino acids of the oligopeptide; and
Xaa is any amino acid selected from native or non-native amino acids except Arg, Lys, His or Orn; and
x is any number selected from 0, 1, 2, 3, 4, 5, 6, 7, or 8, provided, that the overall content of Xaa does not exceed 50% of all amino acids of the oligopeptide.
US Pat. No. 10,114,019

BACTERIAL CHALLENGE MODEL IN CATTLE USING A TRANS- AND INTRA-DERMAL ROUTE TO INFECT PERIPHERAL LYMPH NODES

TEXAS TECH UNIVERSITY SYS...

1. A method of observing and evaluating bacterial infections within the lymph nodes of animals presented for harvest comprising:inoculating intradermally with a device capable of inoculating concurrently at multiple sites an animal with a known amount of a bacterial pathogen, wherein the multiple inoculation sites comprise lymph node drainage areas, wherein the bacterial pathogen that is a live bacterial pathogen selected from Salmonella, Listeria, Shigella, Fransicella, Clostridum, Staphylococcus, Streptococcus, or Bacillus; and
at one or more time points obtaining one or more lymph node biopsies are aseptically harvested to determine the extent of the bacterial pathogen in the lymph nodes.
US Pat. No. 10,111,456

METHODS AND COMPOSITIONS FOR IDENTIFYING NBB1 MUTATIONS

22nd Century Limited, LLC...

1. A primer or probe pair capable of amplifying or detecting a nucleic acid molecule as set forth in SEQ ID NO: 3.
US Pat. No. 10,111,968

NUCLEIC ACID COMPRISING OR CODING FOR A HISTONE STEM-LOOP AND A POLY(A) SEQUENCE OR A POLYADENYLATION SIGNAL FOR INCREASING THE EXPRESSION OF AN ENCODED THERAPEUTIC PROTEIN

1. A method of expressing a therapeutic protein in a mammalian subject comprising administering to the subject an effective amount of mRNA comprising:a) a polypeptide coding region, encoding said therapeutic protein;
b) at least one histone stem-loop, and
c) a poly(A) sequence,wherein said mRNA does not include a histone downstream element (HDE) and the mRNA increases the expression of the therapeutic protein in said subject.
US Pat. No. 10,112,995

HUMAN ANTI-IFN-? ANTIBODIES

ImmunoQure AG, Martinsre...

1. A human monoclonal anti-interferon-alpha (IFN-?) antibody or an IFN-? binding fragment thereof, wherein the antibody or antigen-binding fragment thereof comprises in its variable regions the complementarily determining regions (CDRs) VH CDRs: amino acids 31-35 of SEQ ID NO:18 and amino acids 50-66 of SEQ ID NO: 18 and amino acids 99-115 of SEQ ID NO: 18; and VL CDRs: amino acids 24-35 of SEQ ID NO:20 and amino acids 51-57 of SEC) ID NO:20 and amino acids 90-100 of SEC) ID NO:20 and wherein the antibody has the following properties: (i) binds to human IFN-? subtypes IFN?I/13 (IFN?Ib), IFN?2, IFN?4, IFN?5, IFN?6, IFN?7, IFN?8, IFN?10, IFN?14 IFN?16, IFN?17 and IFN?21; and (ii) does not bind to IFN-?, wherein the IFN-? antibody or IFN-? binding fragment thereof is labeled with a detectable label selected from the group consisting of an enzyme, a radioisotope, a fluorophore, a peptide and a heavy metal, or attached to a drug.
US Pat. No. 10,114,021

BIOMARKER FOR DIAGNOSIS, PREDICTION AND/OR PROGNOSIS OF ACUTE HEART FAILURE AND USES THEREOF

MYCARTIS NV, Ghent (BE)

1. A method for determining quantity of Quiescin Q6 in a sample from a subject, wherein the subject presents with dyspnea has a medical history of heart failure, or has a prophylactic or therapeutic treatment of acute heart failure (AHF), the method comprising the steps:(i) obtaining a sample from the subject; and
(ii) determining the quantity of Quiescin Q6 by contacting the sample with one or more binding agents capable of specifically binding to Quiescin Q6.
US Pat. No. 10,111,970

CONTRAST AGENTS FOR MAGNETIC RESONANCE IMAGING

Duke University, Durham,...

1. A method of enhancing a magnetic resonance imaging (MRI) image of a body or body region such as an organ or organ region in a subject, comprising:parenterally administering a composition consisting essentially of sodium ascorbate, meglumine ascorbate, or a mixture thereof to said subject in an MRI image-enhancing amount,
wherein said sodium ascorbate, meglumine ascorbate, or mixture thereof is administered in an amount of from 0.02 grams per kilogram subject body weight, up 40 grams per kilogram subject body weight; and then
generating, by MRI of the subject, an image of said body or body region,
whereby said composition enhances the MRI image.
US Pat. No. 10,112,996

FUNCTION MODIFYING NAV1.7 ANTIBODIES

UCB Biopharma SPRL, Brus...

1. An anti-Nav1.7 antibody or binding fragment thereof which after binding the Nav1.7 ion channel is functionally modifying thereto, such that the activity of the ion channel is reduced, wherein the antibody or fragment thereof binds to an E1 or E3 extracellular region of the Nav1.7 ion channel.
US Pat. No. 10,112,997

TIGHT-BINDING AGENTS AND USES THEREOF

ONCOMED PHARMACEUTICALS, ...

1. An isolated antibody that specifically binds the extracellular domain of TIGIT, which comprises:(a) a heavy chain CDR1 comprising GSSLSSSYMS (SEQ II) NO:7), a heavy chain CDR2 comprising IIGSNGNTYYANWAKG (SEQ ID NO:8), and a heavy chain CDR3 comprising GGYRTSGMDP (SEQ ID NO:9), and a light chain CDR1 comprising QASQSISSYLNW (SEQ ID NO:10), a light chain CDR2 comprising DALKLAS (SEQ ID NO:11), and a light chain CDR3 comprising QQEHSVGNVDN (SEQ ID NO:12);
(b) a heavy chain CDR1 comprising GFSLSSSYMS (SEQ ID NO:13), a heavy chain CDR2 comprising IIGSNGNTYYANWAKG (SEQ ID NO:8), and a heavy chain CDR3 comprising GGYRTSGMDP (SEQ NO:9); and a light chain CDR1 comprising QASQNIYSDLAW (SEQ ID NO:81), a light chain CDR2 comprising RASTLAS (SEQ ID NO:15), and a light chain CDR3 comprising QQEHLVAWIYN (SEQ ID NO:16); or
(c) a heavy chain CDR1 comprising TSDYAWN (SEQ ID NO:57), a heavy chain CDR2 comprising YISYSGSTSYNPSLRS (SEQ ID NO:58), and a heavy chain CDR3 comprising ARRQVGLGFAY (SEQ ID NO:59), and a light chain CDR1 comprising KASQDVSTAVA (SEQ ID NO:60), a light chain CDR2 comprising SASYRYT (SEQ ID NO:61), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:62).
US Pat. No. 10,114,280

TITANIA-DOPED QUARTZ GLASS AND MAKING METHOD

SHIN-ETSU CHEMICAL CO., L...

1. A titania-doped quartz glass having a surface where EUV light is reflected, wherein an angle (?) included between a straight line connecting an origin (O) at the center of the reflecting surface and a birefringence measurement point (A) and a fast axis of birefringence at the measurement point (A) has an average value of more than 45 degrees, and wherein the fast axes of birefringence in the EUV light reflecting surface are distributed in a concentric fashion.
US Pat. No. 10,112,229

APPARATUS AND METHOD FOR FORMING THREE-SHEET PANELS

The Boeing Company, Chic...

1. A method for forming a panel comprising a first face sheet, a second face sheet and a core sheet between said first face sheet and said second face sheet, said method comprising:entrapping a precursor panel within a forming cavity of a molding tool, said precursor panel comprising said first face sheet, said core sheet welded to said first face sheet and said second face sheet welded to said core sheet, and at least one caul plate being positioned within said forming cavity adjacent to said precursor panel;
heating said precursor panel to a superplastic temperature;
pressurizing a first pressure zone located between said molding tool and said caul plate to press caul plate against said precursor panel; and
pressurizing a panel volume defined between said first face sheet and said second face sheet of said precursor panel.
US Pat. No. 10,114,281

MASK BLANK, PHASE SHIFT MASK, AND METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE

HOYA CORPORATION, Shinju...

1. A mask blank including a phase shift film on a transparent substrate, in which:the phase shift film has a function to transmit an exposure light of an ArF excimer laser at a transmittance of 2% or more and a function to generate a phase difference of 150 degrees or more and 180 degrees or less between the exposure light that transmitted through the phase shift film and the exposure light that transmitted through air for a same distance as a thickness of the phase shift film,
the phase shift film has a structure where a lower layer and an upper layer are stacked from a side of the transparent substrate,
the lower layer is formed from a material consisting of silicon, or a material consisting of silicon and one or more elements selected from nonmetallic elements other than oxygen and semimetal elements,
the upper layer, excluding a surface layer portion thereof, is formed from a material consisting of silicon and nitrogen, or a material consisting of silicon, nitrogen and one or more elements selected from nonmetallic elements excluding oxygen and semimetal elements,
the lower layer has refractive index n of less than 1.8 and extinction coefficient k of 2.0 or more,
the upper layer has refractive index n of 2.3 or more and extinction coefficient k of 1.0 or less, and
the upper layer has more thickness than the lower layer.
US Pat. No. 10,113,000

COMBINATION THERAPIES FOR B-CELL LYMPHOMAS COMPRISING ADMINISTRATION OF ANTI-CD20 ANTIBODY

Biogen Inc., Cambridge, ...

1. A method for treating low grade or follicular non-Hodgkin's lymphoma (NHL) comprising administering to a patient 375 mg/m2 of rituximab during a cyclophosphamide, doxorubicin, vincristine, and prednisone (CHOP) chemotherapeutic regimen, wherein the CHOP chemotherapy and rituximab are administered to the patient on Day 1 of each CHOP chemotherapy cycle.
US Pat. No. 10,114,028

BIOMARKERS FOR PNEUMONIA AND ACUTE DECOMPENSATED HEART FAILURE

Upstream Medical Technolo...

1. A method of monitoring a subject having both pneumonia and acute decompensated heart failure, comprising(a) performing an immunoassay to determine a level of a ghrelin signal peptide (GHRsp) fragment by contacting a body fluid sample obtained from the subject with an antibody or antigen-binding antibody fragment thereof that binds a ghrelin signal peptide fragment that is (a) GHRsp (1-9) (SEQ ID NO:3); or (b) GHRsp (1-10) (SEQ ID NO:4) and detecting ghrelin signal peptide fragment bound to the antibody or antigen-binding antibody fragment thereof;
(b) comparing the level of the ghrelin signal peptide fragment determined by the immunoassay with a level of the ghrelin signal peptide fragment in a reference body fluid sample obtained from the same subject at an earlier time, which reference body fluid sample contained a level of ghrelin signal peptide fragment that was above a threshold level of the ghrelin signal peptide fragment that distinguishes a population of subjects having both pneumonia and acute decompensated heart failure from a population of subjects not having both pneumonia and acute decompensated heart failure, wherein a level of ghrelin signal peptide fragment that is above the threshold level indicates the subject has both pneumonia and acute decompensated heart failure; and,
(c) setting a treatment regimen or adjusting a treatment regimen for the subject based upon said comparing of the level of the ghrelin signal peptide fragment in the body fluid sample with the reference body fluid sample.
US Pat. No. 10,111,980

DRY COMPOSITION COMPRISING AN EXTRUSION ENHANCER

1. A method of preparing a dry composition suitable for use in haemostasis and wound healing comprising sequentiallya) providing a cross-linked biocompatible polymer in powder form, one or more polyols, an extrusion enhancer selected from albumin, phosphatidylcholine, phosphatidylserine, lecithin or soy bean oil, and an aqueous medium,
b) mixing the biocompatible polymer, the one or more polyols, the extrusion enhancer and the aqueous medium to obtain a paste, and
c) freeze-drying the paste,
wherein the dry composition comprises from about 10% w/w to about 60% w/w of one or more polyols selected from sugar alcohols and sugars, and
wherein upon addition of an aqueous medium, the dry composition reconstitutes to form a paste without mechanical mixing.
US Pat. No. 10,111,983

COLLAGEN MATRIX

Warsaw Orthopedic, Inc., ...

1. A method for making a biodegradable collagen matrix, the method comprising: adding a dried mixture of a bioactive agent and bone powder, calcium phosphate, hydroxyapatite, DBM or a mixture thereof to an acidic collagen slurry to form a collagen matrix of macroscopic collagen fibers wherein the bioactive agent is bound to the macroscopic collagen fibers;raising a pH of the collagen slurry to the pH of 8-9;
adding an osteoclastogenesis inhibitor to the collagen matrix;
adding an osteoinductive additive comprising particulate demineralized bone matrix comprising bone chips to the collagen matrix; and
disposing the collagen matrix into a containment device comprising a biodegradable porous polymer mesh bag,
wherein the bioactive agent is water soluble.
US Pat. No. 10,114,291

GRAFTING AGENT FOR FORMING SPACER LAYER

TAIWAN SEMICONDUCTOR MANU...

1. A method comprising:forming a first layer over a substrate;
forming a patterned photoresist layer over the first layer, wherein the photoresist includes a floating additive that has an uneven distribution within the photoresist layer;
applying a solution over the patterned photoresist layer to form a conformal layer over the pattern photoresist layer, wherein the conformal layer further includes a first portion over a top surface of the patterned photoresist layer and second portion extending along sidewalls of the patterned photoresist layer;
selectively removing the first portion of the conformal layer formed over the top surface of the patterned photoresist layer; and
selectively removing the patterned photoresist layer thereby leaving the second portion of the conformal layer.
US Pat. No. 10,111,984

POLYSACCHARIDE AND PROTEIN-POLYSACCHARIDE CROSS-LINKED HYDROGELS FOR SOFT TISSUE AUGMENTATION

Allergan, Inc., Irvine, ...

1. An injectable dermal filler, comprising:a hydrogel comprising a hyaluronic acid polymer crosslinked with collagen via a zero-length crosslinking agent;
wherein said hydrogel is prepared by:
(a) reacting said hyaluronic acid polymer with said collagen via said zero-length cross-linking agent, thereby providing a crosslinked hyaluronic acid/collagen-based composition; and
(b) sterilizing the crosslinked hyaluronic acid/collagen-based composition via irradiation with ultraviolet light or a combination of ultraviolet and visible light.
US Pat. No. 10,114,292

PATTERN FORMING METHOD, RESIST PATTERN, AND METHOD FOR MANUFACTURING ELECTRONIC DEVICE

FUJIFILM Corporation, To...

1. A pattern forming method comprising:a step a of coating an active-light-sensitive or radiation-sensitive resin composition onto a substrate to form a resist film;
a step b of coating a composition for forming an upper layer film onto the resist film, followed by carrying out heating to 100° C. or higher, to form the upper layer film on the resist film;
a step c of exposing the resist film having the upper layer film formed thereon; and
a step d of developing the exposed resist film using a developer including an organic solvent to form a pattern,
wherein the active-light-sensitive or radiation-sensitive resin composition contains a hydrophobic resin (D), and
the hydrophobic resin (D) has at least two of a fluorine atom, a silicon atom, and a CH3 partial structure which is contained in a side chain moiety of the hydrophobic resin (D).
US Pat. No. 10,113,011

PROCESS FOR RECOVERING RUBBER FROM NATURAL RUBBER LATEX

Bridgestone Corporation, ...

1. A process for recovering rubber from an aqueous non-Hevea natural rubber latex that contains natural rubber, water, non-rubber extractables including resin, and one or more additives, and is essentially free of lignocellulosic plant material, comprising the steps of:freezing the latex, whereby at least 75% of the natural rubber coagulates and a mixture containing coagulated natural rubber, water, and extractables is formed;
thawing the mixture;
collecting the coagulated natural rubber;
contacting the coagulated natural rubber with an extraction solution comprising at least one organic polar solvent in order to preferentially solvate the extractables; and
drying the coagulated natural rubber to create a resultant natural rubber wherein the resultant natural rubber has an amount of acetone extractables of 5% by weight or less.
US Pat. No. 10,113,269

DISPERSION FOR PRODUCING ABRASION-RESISTANT SURFACES

Kronoplus Technical AG, ...

1. A dispersion for manufacturing of a paper impregnated with a resin, comprising the following components in weight percent:30 to 75% water;
10 to 65% corundum particles with a particle size of F400 to F2000;
0.05 to 5% anionic dispersing agents;
0.05 to 5% of sodium polyacrylate;
0.1 to 5% nonionic tensides; and
0.01 to 2% thickening agents.
US Pat. No. 10,113,014

METHOD FOR PRODUCING SOLID CATALYST COMPONENT CONTAINING VANADIUM COMPOUND FOR OLEFIN POLYMERIZATION, OLEFIN POLYMERIZATION CATALYST, AND METHOD FOR PRODUCING OLEFIN POLYMER

TOHO TITANIUM CO., LTD., ...

1. A method for producing a solid catalyst component for olefin polymerization comprising bringing a vanadium compound into contact with a solid component that comprises magnesium, a halogen, titanium, and an internal electron donor compound.
US Pat. No. 10,113,270

PROCESS FOR THE MANUFACTURE OF PAPER AND PAPERBOARD

BASF SE, Ludwigshafen (D...

1. A process of making paper or paperboard, comprising subjecting a cellulosic thin stock to one or more shear stages and then draining through a moving screen to form a sheet which is dried,wherein the process employs a retention system which is applied to the thin stock, the retention system comprising as components
i) a blend of different cationic polymers, and
ii) a microparticulate material, which microparticulate material is selected from colloidal silica and bentonite,
in which the blend of cationic polymers comprises:
a) from 50 ppm to 3000 ppm dose rate of a cationic polymer having a charge density of from 1 to 2 mEq per gram and a molar mass of from greater than 700,000 Da to 3 million Da, which cationic polymer is selected from polymers comprising vinyl amine units, and
b) from 50 ppm to 1000 ppm dose rate of a cationic polymer haying a charge density of below 3 mEq per grain and an intrinsic viscosity of at least 10 dl/g, which cationic polymer is a cationic polyacrylamide comprising acrylamide and from 5 to 10 mole % of at least one water-soluble cationic ethylenically unsaturated monomer,
wherein i) the blend of cationic polymers is dosed into the thin stock prior to the final shearing stage and ii) the microparticulate material is dosed into the thin stock after the final shearing stage, and
wherein the ppm dose rate is based on the active weight of the cationic polymer relative to a dry weight of the cellulosic thin stock suspension,
wherein one of the components of the retention system is dosed into the thin stock after the final shearing stage and the other is dosed into the thin stock before the final shearing stage.
US Pat. No. 10,113,016

LOW DENSITY POLYOLEFIN RESINS WITH LOW MOLECULAR WEIGHT AND HIGH MOLECULAR WEIGHT COMPONENTS, AND FILMS MADE THEREFROM

Chevron Phillips Chemical...

1. An olefin polymerization process, the process comprising contacting a catalyst composition with an olefin monomer and an optional olefin comonomer in a polymerization reactor system under polymerization conditions to produce an olefin polymer comprising a higher molecular weight component and a lower molecular weight component, wherein:the olefin polymer is characterized by a ratio of the Mp of the higher molecular weight component to the Mp of the lower molecular weight component in a range from about 5:1 to about 100:1;
the catalyst composition comprises:
catalyst component I comprising a two carbon bridged metallocene compound containing two cyclopentadienyl groups, two indenyl groups, or a cyclopentadienyl and indenyl group;
catalyst component II comprising a single atom bridged metallocene compound containing a fluorenyl group;
an activator; and
optionally, a co-catalyst; and
a weight percentage of catalyst component I is in a range from about 25 to about 98%, based on the total weight of catalyst component I and catalyst component II.
US Pat. No. 10,115,836

LEAD-BISMUTH-TELLURIUM-SILICATE INORGANIC REACTION SYSTEM HAVING IMPROVED ADHESION PROPERTIES

Heraeus Precious Metals N...

1. An electroconductive paste comprising:metallic particles;
at least one inorganic reaction system comprising a lead-bismuth-tellurium-silicate composition of Formula (I):
Pba—Bib—Tec—Sig-Md-Oe,  (I)
wherein
the sum of a, b, c, d and g is 1,
0 0.2 0?c?0.5,
0 0 a:b is between about 0.1:99.9 to about 5:95,
b:c is between about 50:50 to 99:1,
a:c is between about 1:99 to about 10:90,
b:g is between about 50:50 to about 98:2,
M is one or more elements selected from the group consisting of boron, aluminum, gallium, germanium, tin, phosphorus, antimony, niobium, tantalum, vanadium, titanium, molybdenum, tungsten, chromium, silver, halides, chalcogenides, alkaline metals, alkaline earth metals, and rare earth metals, and
e is a number sufficient to balance the charge of the Pb, Bi, Te, Si, and M components; and
an organic vehicle.
US Pat. No. 10,114,304

TONER BINDER, AND TONER

SANYO CHEMICAL INDUSTRIES...

1. A toner binder comprising:a crystalline resin (A); and
an amorphous resin (B) that is a polyester resin or its modified resin, the polyester resin being obtained by reaction of an alcohol component (X) and a carboxylic acid component (Y) as raw materials,
wherein the amorphous resin (B) is a combination of two resins having different softening points (Tm's), wherein one of the two resins is a resin having a Tm of 80° C. to 110° C. and the other is a resin having a Tm of 110° C. to 170° C.,
wherein a temperature (Tp) of a top of an endothermic peak derived from the crystalline resin (A) as measured by a differential scanning calorimeter (DSC) is in the range of 40° C. to 100° C., and endothermic peak areas S1 and S2 during heating satisfy the following equation:
(S2/S1)×100?35  (1)
wherein S1 is an area of the endothermic peak derived from the crystalline resin (A) in the first heating process, and S2 is an area of the endothermic peak derived from the crystalline resin (A) in the second heating process, when the toner binder is heated, cooled, and heated.
US Pat. No. 10,112,254

METHOD FOR MAKING CLAD METAL PIPE

Huntington Alloys Corpora...

1. A method of producing a nickel alloy clad steel pipe comprising:providing a hollow cylinder of nickel alloy cladding material and a hollow cylinder of steel;
placing the hollow cylinder of the nickel alloy cladding material concentrically inside the hollow cylinder of steel to form a composite billet;
heating the composite billet to an extrusion temperature of 1121-1260° C.; and
extruding the heated composite billet into an extrudate,
wherein the nickel alloy cladding material: comprises 6.0 to 12.0 wt. % molybdenum, 19.0 to 27.0 wt. % chromium, 1.0 wt. % maximum tungsten, 0.6 wt. % maximum aluminum, 0.6 wt. % maximum titanium, 0.001 to 0.05 wt. % carbon, 0.001 to 0.035 wt. % nitrogen, 0.001 to 0.3 wt. % silicon, 1.0 wt. % maximum niobium, 2.5 wt. % maximum iron, 0.5 wt. % maximum manganese, 0.015 wt. % maximum phosphorous, 0.015 wt. % maximum sulfur, 1.0 wt. % maximum cobalt, and the balance nickel and incidental impurities.
US Pat. No. 10,113,024

ARYLCYCLOBUTENES

Dow Global Technologies L...

1. A polymer comprising as polymerized units one or more arylcyclobutene first monomers and one or more second monomers having two or more dienophilic moieties and one or more acid moieties chosen from carboxylic acid, protected carboxylic acid, and sulfonic acid; wherein the protected carboxylic acid is an ester having a quaternary carbon bonded directly to the alkoxy oxygen of the ester group; and wherein the one or more second monomers are free of benzocyclobutene moieties.