US Pat. No. 10,113,135

PERFUMING METHOD

KAO CORPORATION, Tokyo (...

1. A perfuming method, comprising:applying a water-based product that comprises a perfume precursor to a fabric or a human body;
drying the water-based product; and
subsequently bringing the perfume precursor into contact with moisture in the air to perform hydrolysis, thereby releasing a perfume,
wherein the water-based product comprises a perfume precursor comprising an ester of i) at least one perfume selected from the group consisting of maltol, ethyl maltol, ethyl vanillin, and raspberry ketone, and ii) at least one aliphatic monocarboxylic acid or aliphatic dicarboxylic acid selected from the group consisting of lauric acid, myristic acid, palmitic acid, stearic acid, oleic acid, adipic acid, and sebacic acid.
US Pat. No. 10,113,137

FABRIC SOFTENER ACTIVE COMPOSITION

Evonik Degussa GmbH, Ess...

1. A fabric softener active composition, comprising:a) as component A, at least 50% by weight of a bis-(2-hydroxypropyl)-dimethylammonium methylsulphate fatty acid ester having a molar ratio of fatty acid moieties to amine moieties of from 1.5 to 1.99, an average chain length of the fatty acid moieties of from 16 to 18 carbon atoms and an iodine value of the fatty acid moieties, calculated for the free fatty acid, of from 0.5 to 50; and
b) as component B, a (2-hydroxypropyl)-(1-methyl-2-hydroxyethyl)-dimethylammonium methylsulphate fatty acid ester having the same fatty acid moieties as component A;wherein the molar ratio of component B to component A is from 0.05 to 0.20.
US Pat. No. 10,111,856

COMPOSITION FOR PREVENTING OR TREATING CLIMACTERIC SYMPTOMS COMPRISING SOYBEAN EXTRACT COMPRISING COUMESTROL AS AN ACTIVE INGREDIENT

AMOREPACIFIC CORPORATION,...

1. A method for preventing or treating a climacteric disease, wherein the method comprises administering an effective amount of a germinated and fermented bean extract comprising coumestrol to a subject in need thereof, wherein the method is for preventing or treating a climacteric disease,wherein the fermented bean extract is a fermented product by Aspergillus oryzae of the germinated bean,
wherein the climacteric disease is osteoporosis.
US Pat. No. 10,113,138

APE-FREE SURFACTANT COMPOSITIONS AND USE THEREOF IN TEXTILE APPLICATIONS

Dow Global Technologies L...

1. A process of removing wax or oil from a textile material, comprising contacting the textile material with a composition comprising:an alkyl alkoxylate sulfate of formula I:
R1O—(CH2CH(R2)—O)x—(CH2CH2O)y—SO3M  (I);
a nonionic alkyl alkoxylate of formula II:
R1O—(CH2CH(R2)—O)x—(CH2CH2O) y—H  (II); and
waterwherein R1 is linear or branched C4-C10 alkyl;R2 is CH3 or CH3CH2;
x is a real number from 1 to 11;
y is a real number from 1 to 20; and
M is an alkali metal or NH4, andwherein R1, R2, x, and y in formula I and formula II may be the same or different.
US Pat. No. 10,112,369

TRANSPARENT MULTILAYER FILM CONTAINING POLY(METH)ACRYLIMIDE-BASED RESIN LAYER, AND METHOD FOR PRODUCING SAID TRANSPARENT MULTILAYER FILM

RIKEN TECHNOS CORPORATION...

1. A transparent multilayer film, comprising:a first poly(meth)acrylimide resin layer (?1);
an aromatic polycarbonate resin layer ((?); and
a second poly(meth)acrylimide resin layer (?2), the layers being laminated directly in this order,
wherein the transparent multilayer film satisfies the following requirements (i), (ii) and (iii):
(i) a total light transmittance of higher than 90%;
(ii) (ii) a haze of 2.0% or lower; and
(iii) a retardation of 50 nm or lower.
US Pat. No. 10,112,883

PRODUCTION OF PRODUCTS FROM NATURAL RESOURCES

Saudi Basic Industries Co...

1. A method of producing acrylic acid and acetic acid comprising the steps of:a) providing a feedstream comprising syngas;
b) a step consisting of contacting the feedstream with a first catalyst to produce a first product stream comprising C2-C3 olefins and/or C2-C3 paraffins; and
c) contacting the first product stream with oxygen gas and a second catalyst, thereby producing a second product stream comprising acrylic acid and acetic acid,
wherein there is no step for separating the components of the first product stream before the first product stream is contacted with the second catalyst,
wherein the first catalyst is a catalyst composition comprising cobalt; manganese; hydrophilic silica; and at least one element comprising lanthanum, phosphorus, Fe, Zr, or Zn, wherein the relative molar ratios of the elements comprised in said composition are represented by the formula
Coa1Mnb1Siz1Xy1M1d1Of1,
wherein a1 is 1;
wherein b1 is from 0.8 to 1.2;
wherein Si is in the form of a hydrophilic silica;
wherein z1 is from 0.1 to 1;
wherein X is La, P, Fe, Zr, or Zn, or a mixture thereof;
wherein y1 is greater than 0 to 0.005;
wherein M1 is one or more elements selected from the group consisting of alkali metal, alkaline earth metal and transition metal,
wherein d1 is 0 to 0.005; and
wherein f1 is a number determined by the valence requirements of elements of the other elements present in the catalyst.
US Pat. No. 10,113,139

SOLID FABRIC CONDITIONER COMPOSITION AND METHOD OF USE

Ecolab USA Inc., Saint P...

1. A solid fabric softening composition comprising:(a) from about 5 wt. % to about 10 wt. % of one or more surfactants;
(b) from about 5 wt. % to about 20 wt. % of a polyethylene glycol with a molecular weight of 4000 (PEG-4000) or 8000 (PEG-8000) and about 19 wt. % to about 30 wt. % of urea as solidification agents; and
(c) from about 30 wt. % to about 45 wt. % of a quaternary ammonium component and about 5 wt. % to about 10 wt. % of an amino-functional silicone compound,
wherein the surfactants are a C10-C16 alcohol ethoxylate or mixtures thereof;
wherein the ester quaternary ammonium component is methyl bis[ethyl (tallowate)]-2-hydroxyethyl ammonium; and
wherein a ratio of the ester quaternary ammonium component to amino-functional silicone compound is between about 3:1 to about 9:1.
US Pat. No. 10,113,395

ORGANOPHILIC NANOPARTICLES IN DIRECT EMULSION SYSTEMS AND METHODS FOR THEIR USE AS WELLBORE DRILLING FLUIDS

M-I L.L.C., Houston, TX ...

14. A direct emulsion fluid comprising:an aqueous continuous phase;
an oleaginous discontinuous phase;
a phospholipid surfactant stabilizing the oleaginous discontinuous phase within the aqueous continuous phase; and
a viscosifier.
US Pat. No. 10,113,396

FRACTURING FLUIDS AND METHODS OF TREATING HYDROCARBON FORMATIONS

BAKER HUGHES, A GE COMPAN...

1. A method of fracturing a subterranean formation penetrated by a well, the method comprising:forming a fracturing composition comprising
a carrier fluid,
a proppant,
a superabsorbent polymer comprising a repeating unit derived from an acrylate, an acrylic acid or a salt thereof, an acrylamide, a vinylpyrrolidone, a vinyl ester, a vinyl alcohol, a 2-acrylamide-2-methylpropanesulfonic acid, a derivative thereof, or a combination thereof, the superabsorbent polymer having crosslinks derived from ethyleneglycol diacrylate, polyethyleneglycol diacrylate, trimethylopropane trimethacrylate, ethoxylated trimethylol triacrylate, ethoxylated pentaerythritol tetracrylate, or a combination comprising at least one of the foregoing,
a breaker effective to break the superabsorbent polymer at a temperature of greater than about 250° F. in the absence of any activators, the breaker comprising a bromate breaker,
an encapsulated activator comprising an activator encapsulated within an encapsulant, the activator comprising sorbic acid and being effective to activate the breaker so that the breaker or a derivative thereof breaks the superabsorbent at a temperature of less than about 200° F.;
pumping the hydraulic fracturing composition into the subterranean formation to create or enlarge a fracture;
allowing the activator to diffuse out of the encapsulant; and
breaking the superabsorbent polymer using the breaker,
wherein the fracturing composition is free of a crosslinking agent.
US Pat. No. 10,112,885

PROCESS AND SYSTEM FOR PRODUCING ACRYLIC ACID

Arkema Inc., King of Pru...

1. A process for the recovery of (meth)acrylic acid using coupled distillation columns comprising a dehydration column that is coupled to a finishing column such that a tails stream from the dehydration column is fed directly or indirectly into a top of the finishing column while an overhead stream of the finishing column is fed directly or indirectly into a base of the dehydration column, the process comprising:A. dehydrating a gaseous reaction mixture comprising (meth)acrylic acid in said dehydration column to produce a dehydration column overhead stream and a dehydration column bottoms stream, wherein the dehydrating step is carried out without using azeotropic solvent;
B. passing at least a portion of the dehydration column bottoms stream to the upper half of said finishing column;
C. subjecting the portion of the bottoms stream passed to the finishing column to distillation at less than atmospheric pressure within the finishing column to produce at least a finishing column overhead stream and a finishing column bottoms stream;
D. at least partially condensing the finishing column overhead stream using an overhead aspirating direct contact (ADC) condenser system to form a finishing column overhead condensate, and passing at least a portion of the finishing column overhead condensate to the dehydration column, wherein said ADC condenser system at least partially condenses the finishing column overhead stream and comprises at least one liquid jet eductor supplied with condensate from the finishing column overhead stream to generate a vacuum; at least one liquid-vapor separatory vessel; and at least one condensate cooler;
E. collecting (meth)acrylic acid from the finishing column; wherein said (meth)acrylic acid collected is technical grade containing at least 98.5% by weight (meth)acrylic acid, less than 0.5% water, and less than 0.4% acetic acid, and without producing a wastewater stream.
US Pat. No. 10,111,860

COMPOSITIONS AND METHODS FOR TREATING CONCUSSION

1. A method for treating concussion, the method comprising:administering a therapeutic dose of an active compound comprising one or more of: phenserine, a phenserine metabolite, a phenserine prodrug, or combinations thereof.
US Pat. No. 10,112,888

NITROXIDE HYDROXYLAMINE AND PHENYLENEDIAMINE COMBINATIONS AS POLYMERIZATION INHIBITORS FOR ETHYLENICALLY UNSATURATED MONOMER PROCESSES

ECOLAB USA INC., St. Pau...

1. A method of inhibiting polymerization of isoprene comprising:providing a fluid comprising the isoprene;
adding an effective amount of a polymerization inhibitor composition to the fluid, wherein the polymerization inhibitor composition comprises an effective amount of 4-hydroxy-2,2,6,6-tetramethyl piperidinol and an effective amount of N,N?-di-1,4-dimethylpentyl-1,4-phenylenediamine; and
inhibiting polymerization of the isoprene.
US Pat. No. 10,112,119

METHOD FOR MODIFYING LOCAL PROPERTIES OF MATERIALS

Disney Enterprises, Inc.,...

1. A method for altering at least one local property of a primary material, comprising:reducing an elasticity of the primary material, wherein the primary material is an artificial skin material;
while the elasticity of the primary material is reduced, creating a delivery aperture through a portion of the primary material; and
introducing through the delivery aperture a secondary material into the primary material.
US Pat. No. 10,115,965

POSITIVE ACTIVE MATERIAL FOR RECHARGEABLE LITHIUM BATTERY, METHOD OF PREPARING SAME, AND RECHARGEABLE LITHIUM BATTERY INCLUDING SAME

Samsung SDI Co., Ltd., Y...

1. A positive active material for a rechargeable lithium battery, comprisinga core comprising a compound capable of intercalating and deintercalating lithium, the compound capable of intercalating and deintercalating lithium being a nickel-based oxide; and
a lithium metal phosphate on the surface of the core, the lithium metal phosphate being included in an amount of about 0.01 parts by weight to about 20 parts by weight based on 100 parts by weight of the compound capable of intercalating and deintercalating lithium,
wherein the lithium metal phosphate is different from the compound capable of intercalating and deintercalating lithium and is represented by Chemical Formula 1:
Li1+(x+y)InxMyTi2-(x+y)(PO4)3  Chemical Formula 1
wherein, in Chemical Formula 1, M is Al, Y, Sc, Mg, V, Cr, Mn, Fe, Ga, Lu, Cr, La, Ge, or a combination thereof, 0 wherein the nickel-based oxide comprises a lithium nickel cobalt aluminum oxide, a lithium nickel cobalt manganese oxide, or a combination thereof.
US Pat. No. 10,111,865

METHODS OF SEDATION DURING CRITICAL CARE TREATMENT

OVID THERAPEUTICS INC., ...

1. A method of sedating a patient undergoing critical care treatment comprising administering to the patient an effective amount of a pharmaceutical composition of gaboxadol or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,113,147

METHOD FOR PRODUCING MEGAKARYOCYTES, PLATELETS AND/OR THROMBOPOIETIN USING MESENCHYMAL CELLS

AdipoSeeds, Inc., Tokyo ...

1. A method for producing a megakaryocyte and/or platelet, comprising culturing a mesenchymal cell in a mesenchymal cell culturing basic medium containing an iron ion and an iron transporter so that the mesenchymal cell differentiates into a megakaryocyte and/or platelet, and collecting the megakaryocyte and/or platelet from a culture,wherein the mesenchymal cell is a CD31 negative and CD71 positive mesenchymal cell and wherein the medium does not contain exogenous thrombopoietin.
US Pat. No. 10,112,892

PROCESS FOR PREPARING POLYISOCYANATES

Covestro Deutschland AG, ...

1. A continuous process for liquid phase preparation of a polyisocyanate by reaction of a corresponding polyamine with phosgene, with a corresponding carbamoyl chloride and a corresponding amine hydrochloride occurring as intermediates, comprising:(i) mixing a phosgene-containing stream, a polyamine-containing stream and a stream containing carbamoyl chloride and amine hydrochloride in a mixing device to obtain a mixed stream, where phosgene is used in a stoichiometric excess of from >0% to 50% of theory, based on the amine groups of the polyamine present in the polyamine-containing stream;
(ii) conveying the mixed stream obtained in step (i) through a reactor in which an absolute pressure of from 20 bar to 60 bar and a temperature of from 80° C. to 200° C., prevail, thereby forming a stream containing carbamoyl chloride and amine hydrochloride;
(iii) optionally discharging a gaseous purge stream from the stream containing carbamoyl chloride and amine hydrochloride which is formed in step (ii), giving a stream which contains carbamoyl chloride and amine hydrochloride and has been depleted in gaseous components, and
(iv) dividing the stream containing carbamoyl chloride obtained in step (ii) or the stream contains carbamoyl chloride and amine hydrochloride and has been depleted in gaseous components obtained in step (iii) into two substreams, where
(a) one substream is used as the stream containing carbamoyl chloride and amine hydrochloride in step (i) and
(b) the other substream converted into the desired polyisocyanate.
US Pat. No. 10,113,148

METHOD FOR OBTAINING MONOCYTES OR NK CELLS

1. A method for obtaining monocytes or NK cells, comprising:(a) collecting a monocyte sample by separating the monocytes from peripheral blood by using an antibody specific for a surface marker of the monocytes, wherein the peripheral blood is obtained from a human;
(b) collecting, as an NK cell sample, cell populations remaining after the separation of the monocytes; and
(c) growing the monocytes or the NK cells by culturing at least one of the monocyte sample and the NK cell sample,
wherein in the step (c), at least the NK cells are grown by culturing the NK cell sample without carrying out further separation steps by use of a second medium containing an anti-CD56 antibody.
US Pat. No. 10,112,123

FRACTIONATOR FOR SEPARATING SOLUBILIZED RUBBER FROM A CO-SOLVENT BASED MISCELLA AND RELATED PROCESSES

Bridgestone Corporation, ...

1. A fractionator for separating solubilized rubber from a co-solvent based miscella, the fractionator comprising:a primary vessel comprising:
a feed inlet for feeding a co-solvent based miscella into the primary vessel, wherein the co-solvent based miscella separates to form (i) a non-polar solvent viscous rubber phase in a lower portion of the primary vessel and (ii) a polar solvent solubilized resin phase above the non-polar solvent viscous rubber phase;
a side outlet for removing the polar solvent solubilized resin phase from the primary vessel; and
a bottom outlet for removing the non-polar solvent viscous rubber phase from the primary vessel.
US Pat. No. 10,113,149

REPROGRAMMING OF HUMAN ENDOTHELIUM INTO HEMATOPOIETIC MULTI-LINEAGE PROGENITORS BY DEFINED FACTORS

CORNELL UNIVERSITY, Itha...

1. A method of generating human hematopoietic multi-lineage, progenitor cells (HMLPs) from human endothelial cells (ECs), comprising culturing human ECs expressing each of the transcription factors Finkel-Biskis-Dinkins murine osteosarcoma viral oncogene homolog B (FOSB), growth factor independent 1 transcription repressor (GFI1), Runt-related transcription factor 1 (RUNX1), spleen focus forming virus proviral integration oncogene (SPI1), in serum-free media with endothelial feeder cells, thereby generating HMLPs.
US Pat. No. 10,113,405

METHOD AND MATERIALS FOR HYDRAULIC FRACTURING WITH DELAYED CROSSLINKING OF GELLING AGENTS

Independence Oilfield Che...

1. A method of generating a fracture network within a subterranean formation penetrated by a wellbore, the subterranean formation having a permeability less than 10 mD, the method comprising:(A) pumping into the wellbore under shear an aqueous well treatment fluid comprising a crosslinking agent and a water-soluble gellant and delaying crosslinking between the crosslinking agent and the water-soluble gellant during pumping, wherein:
(a) the aqueous well treatment fluid when pumped into the wellbore has a viscosity less than 20 cP at 40 sec?1;
(b) the aqueous well treatment fluid comprises a non-aqueous slurry and the water-soluble gellant, wherein the non-aqueous slurry comprises (i) a non-aqueous liquid immiscible in water; (ii) an oil-wetting surface active material; and (iii) the crosslinking agent;
(c) the amount of the water-soluble gellant in the aqueous well treatment fluid is from about 6 to about 15 lb/1000 gal water; and
(d) the aqueous well treatment fluid increases in viscosity by forming a crosslinked gel from the water-soluble gellant and the crosslinking agent; and
(B) reducing the viscosity of the aqueous well treatment fluid by thermally thinning the aqueous well treatment fluid under in-situ conditions and generating a fracture network within the formation from the thermally thinned aqueous well treatment fluid.
US Pat. No. 10,111,869

REDUCTION OF OPIOID BLOOD FLUCTUATIONS

ETHYPHARM, Saint-Cloud (...

1. A method of treatment of severe pain comprising administering orally to a patient in need thereof in a repeated manner twice-a-day a sustained-release matrix-type tablet releasing at least one opioid or one of its pharmaceutically acceptable salts, said matrix-type tablet comprising:a compression matrix consisting of granules of one opioid or one of its pharmaceutically acceptable salts and hydroxypropylmethylcellulose (HPMC); a mixture of microcrystalline cellulose and polyvinyl acetate/polyvinyl pyrrolidone (80:20); precipitated silica; and magnesium stearate;
a sub-coating consisting of a mixture of hydroxypropylmethylcellulose (HPMC), simethicone, micronized talc, and precipitated silica; and
a coating consisting of a mixture of an aqueous dispersion of ethylcellulose, dibutyl sebacate, talc, and precipitated silica;
wherein each administration being spaced apart by 8 to 14 hours, said method maintaining the steady-state opioid plasma concentration obtained in vivo with a reduced fluctuation at above 60% of the Cssmax value for at least 10 hours.
US Pat. No. 10,111,870

METHOD FOR INDUCING A SUSTAINED IMMUNE RESPONSE

1. A method for treating or preventing viral infections chosen from the group consisting of molluscum contagiosum infection, HTLV infection, HTLV-1 infection, hepatitis-A, HCV, HBV, HIV/AIDS infection, human papilloma virus infection, viral dysentery, flu, measles, rubella, chickenpox, mumps, polio, rabies, mononucleosis, ebola, respiratory syncytial virus, dengue fever, yellow fever, lassa fever, arena virus, bunyavirus, filovirus, flavivirus, hantavirus, rotavirus, viral meningitis, west Nile fever, arbovirus, parainfluenza, smallpox, Epstein-Barr virus, dengue hemorrhagic fever, cytomegalovirus, infant cytomegalic virus, progressive multifocal leukoencephalopathy, viral gastroenteritis, a hepatitis, meningitis, encephalitis, shingles, encephalitis, california serogroup viral, St. Louis encephalitis, rift valley fever, hand, foot, and mouth disease, hendra virus, enteroviruses, astrovirus, adenoviruses, Japanese encephalitis, lymphocytic choriomeningitis, roseola infantum, sandfly fever, SARS, warts, cat scratch disease, slap-cheek syndrome, orf, pityriasis rosea and lyssavirus in a mammal comprising administering to a patient in need thereof an immediate release pharmaceutical composition comprising between about 0.01 mg and about 10.0 mg of naltrexone or a pharmaceutically acceptable salt thereof wherein said immediate release pharmaceutical composition is to be administered alone or in combination with one or more antiviral agents.
US Pat. No. 10,111,871

NANOPARTICLE DRUG DELIVERY SYSTEM AND METHOD OF TREATING CANCER AND NEUROTRAUMA

Northeastern University, ...

1. A nanoparticulate formulation of an inhibitor of a poly (ADP-ribose) polymerase (PARP) enzyme, the formulation comprising a suspension of lipid vesicles in an aqueous medium, wherein the lipid vesicles have a positive surface charge, have an average diameter in the range from about 50 nm to about 200 nm, comprise a PARP inhibitor selected from olaparib and BMN-673, and comprise a PEGylated lipid moiety, wherein the effective concentration of the PARP inhibitor within the lipid vesicles is in the range from about 400 ?M to about 20 mM for olaparib or in the range from about 50 nM to about 1 ?M for BMN-673.
US Pat. No. 10,113,154

METHOD FOR PRODUCING STEVIOL GLYCOSIDE

SUNTORY HOLDINGS LIMITED,...

1. A polynucleotide selected from:a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 1; and
a polynucleotide comprising a heterologous regulatory element operably linked to a polynucleotide sequence encoding a protein consisting of the amino acid sequence of SEQ ID NO: 2.
US Pat. No. 10,113,155

STEVIOL GLYCOSYLTRANSFERASE AND GENE ENCODING SAME

SUNTORY HOLDINGS LIMITED,...

1. A polynucleotide selected from:a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 1; and
a polynucleotide comprising a heterologous regulatory element operably linked to a polynucleotide sequence encoding a protein consisting of the amino acid sequence of SEQ ID NO: 2.
US Pat. No. 10,113,157

ALPHA-AMYLASE VARIANTS

1. A variant of a parent Termamyl-like alpha-amylase, comprising an alteration at one or more positions selected from the group of:W13, G48, T49, S50, Q51, A52, D53, V54, G57, G107, G108, A111, S168, M197, wherein (a) the alteration(s) are independently
(i) a deletion of the amino acid which occupies the position, or
(ii) a substitution of the amino acid which occupies the position with a different amino acid,
(b) the variant has alpha-amylase activity;
(c) each position corresponds to a position of the amino acid sequence of the parent Termamyl-like alpha-amylase having the amino acid sequence of SEQ ID NO: 4; and
(d) the variant has at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 41 or 42.
US Pat. No. 10,113,158

GLUCOAMYLASE VARIANTS AND POLYNUCLEOTIDES ENCODING SAME

1. A glucoamylase variant having improved thermostability, comprising a substitution at a position corresponding to position 4 of the polypeptide of SEQ ID NO: 3, wherein the variant has glucoamylase activity and wherein the variant has at least 90% sequence identity to the polypeptide of SEQ ID NO: 3.
US Pat. No. 10,111,621

DISPOSABLE PRINTED CONDUCTIVE LEAD ELEMENTS FOR MEDICAL APPLICATIONS

Nikohed USA Inc., Hatbor...

1. A conductive lead for connecting a medical sensor to a machine, said conductive lead comprising:a dielectric flexible substrate extending a first length between a first end and a second end;
a first contact pad printed on said dielectric flexible substrate proximate said first end;
a second contact pad printed on said dielectric flexible substrate proximate said second end;
a connection line that extends said first length to create a single electrical pathway from said first contact pad to said second contact pad, wherein said first contact pad, said second contact pad and said connection line are all printed from a common conductive ink;
peel-away protective covers that cover said first contact pad and said second contact pad; and
an insulation layer applied over said peel-way protective covers and said connection line, wherein said peel-way protective covers and said connection line are interposed between said flexible substrate and said insulation layer, wherein said first contact pad and said second contact pad can be exposed by removal of said peel-away protective covers.
US Pat. No. 10,111,877

MODULATORS OF ANDROGEN SYNTHESIS

Tangent Reprofiling Limit...

1. A pharmaceutical composition comprising 0.1 mg to 20 mg of risperidone, 0.1 mg to 20 mg of a 9Z,11E conjugated Linoleic Acid, pharmaceutically-acceptable carriers and/or pharmaceutically-acceptable components, wherein there is a synergistic effect between the therapeutically effective amount of the risperidone and the therapeutically effective amount of a 9Z,11E conjugated Linoleic Acid; and wherein there is an inhibition in tumor growth in a cancer selected from the group consisting of pancreatic, prostate and lung cancer upon the administration of the pharmaceutical composition.
US Pat. No. 10,113,671

PROCESS FOR THE PRODUCTION OF A PIPE LINED WITH AN INLINER

EVONIK DEGUSSA GmbH, Ess...

1. A process for producing a pipe, comprising:introducing a thermoplastic inliner into a carrier pipe, the carrier pipe comprising an interior surface that has a shape and an exterior surface;
heating the exterior surface of the carrier pipe from the outside of the carrier pipe to a heating temperature higher than a crystallite melting point (Tm) of a moulding composition of an exterior surface of the inliner;
transferring the heat from the interior surface of the carrier pipe to the exterior surface of the inliner;
expanding the inliner radially in the carrier pipe so that the heated exterior surface of the inliner assumes the shape of the interior surface of the carrier pipe;
water cooling the inliner, thereby obtaining pipe comprising the carrier pipe and the thermoplastic inliner;
wherein
an external diameter of the inliner is at most 25% greater than an internal diameter of the carrier pipe, and
the cross section of the inliner is reduced by from 3 to 30%
the interior surface of the carrier pipe is a metal selected from the group consisting of steel, zinc and an alloy comprising aluminium, iron or zinc, and
the cross section of the inliner is reduced through exposure to an exterior force prior to being introduced into the carrier pipe.
US Pat. No. 10,113,162

MODIFYING SOYBEAN OIL COMPOSITION THROUGH TARGETED KNOCKOUT OF THE FAD2-1A/1B GENES

CELLECTIS, Paris (FR)

1. A soybean plant, plant part, or plant cell comprising:(a) a deletion in each FAD2-1A allele, wherein said deletion in each FAD2-1A allele was induced by transcription activator-like (TAL) effector endonucleases targeted to SEQ ID NOS: 32 and 33, and
(b) a deletion in each FAD2-1B allele, wherein said deletion in each FAD2-1B allele is 23 bp in size, and wherein said deletion in each FAD2-1B allele was induced by TAL effector endonucleases targeted to SEQ ID NOS: 32 and 33,
wherein oil produced from said plant, plant part, or plant cell has increased oleic acid content and decreased linoleic acid content as compared to oil produced from a corresponding wild type soybean plant, plant part, or plant cell.
US Pat. No. 10,113,163

ADENOSINE NUCLEOBASE EDITORS AND USES THEREOF

President and Fellows of ...

1. An adenosine deaminase comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOs: 1, 8, 9, 371, 372, 373, 374, or 375 with the exception of one or more substitutions at positions selected from the group consisting of amino acid residues corresponding to positions 8, 17, 18, 23, 34, 36, 45, 48, 51, 56, 59, 84, 85, 94, 95, 102, 104, 106, 107, 108, 110, 118, 123, 127, 138, 142, 146, 147, 149, 151, 152, 153, 154, 155, 156, and 157 of the amino acid sequence of SEQ ID NO: 1, wherein said adenosine deaminase deaminates adenine in deoxyribonucleic acid (DNA).
US Pat. No. 10,112,909

MORPHIC FORMS OF HEXADECYLOXYPROPYL-PHOSPHONATE ESTERS AND METHODS OF SYNTHESIS THEREOF

Chimerix, Inc., Durham, ...

1. A method of treating a viral infection in a subject in need thereof, the method comprising administering to the subject in need thereof a therapeutically effective amount of morphic Form II of phosphonic acid, [[(S)-2-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1-(hydroxymethyl) ethoxy]methyl]mono[3-(hexadecyloxy)propyl] ester.
US Pat. No. 10,113,165

MODULATION OF EXON RECOGNITION IN PRE-MRNA BY INTERFERING WITH THE SECONDARY RNA STRUCTURE

ACADEMISCH ZIEKENHUIS LEI...

1. A method for inducing the skipping of exon 53 of the human dystrophin pre-mRNA in a subject with Duchenne Muscular Dystrophy (DMD) or Becker Muscular Dystrophy (BMD), or a cell derived from the subject, said method comprising providing to said subject or said cell, an antisense oligonucleotide of 18 nucleotides consisting of the base sequence of the sequence CUGUUGCCUCCGGUUCUG (SEQ ID NO: 29), wherein said oligonucleotide induces exon 53 skipping in the human dystrophin pre-mRNA in the subject or a cell derived from the subject, said oligonucleotide comprising a modification selected from the group consisting of: 2?-O-methyl, 2?-O-methylphosphorothioate, a morpholine ring, a phosphorodiamidate linkage, a peptide nucleic acid and a locked nucleic acid.
US Pat. No. 10,113,168

RIBOZYME WITH TRNA SYNTHETASE ACTIVITY AND METHODS OF MANUFACTURING AND USING THE SAME

Purdue Reasearch Foundati...

1. An artificial ribozyme comprising:a T-box element comprising a 3?-terminus and a riboswitch element having a specifier loop for binding a cognate tRNA substrate with specificity; and
a flexizyme comprising SEQ ID NO: 2, which defines at least an active site for binding an unnatural amino acid, an acceptor end for base pairing to a terminus of a tRNA substrate, a nucleotide linker, and a P1 stem linked to the 3?-terminus of the T-box element,
wherein when the T-box element recognizes and preferentially binds the cognate tRNA substrate, the flexizyme can bind and aminoacylate the cognate tRNA substrate bound by the T-box element, and the active site of the flexizyme is not specific to a targeted unnatural amino acid.
US Pat. No. 10,111,887

MULTIPHASIC CONTRACEPTIVE REGIMEN FOR ORAL COMBINATION DRUG FORMULATION OF PROGESTIN AND ESTROGEN

Arstat, Inc., Flemington...

1. A method of contraception in a female, comprising:administering to the female daily, during a time period of 21 successive days, an oral combination drug formulation of a progestin and an estrogen,
wherein the oral combination drug formulation is administered in a biphasic dosing regimen comprising two phases, wherein the duration of one phase is 14 days and the duration of another phase is 7 days, wherein doses of each of the progestin and estrogen in the second phase of the regimen increase by a predefined dose increment as compared to the corresponding doses of the progestin and estrogen administered during the first phase of the regimen,
wherein the ratio of a daily dose of progestin to a daily dose of estrogen is maintained at a constant level during the entire dosing period, wherein the progestin in the oral combination drug formulation is norethindrone acetate, wherein the norethindrone acetate dose in the first phase is 1000 mcg, wherein the norethindrone acetate dose in the second phase is 1500 mcg,
wherein the estrogen in the oral combination drug formulation is ethinyl estradiol (EE), wherein the EE dose in the first phase is 20 mcg, wherein the EE dose in the second phase is 30 mcg and wherein the biphasic dosing regimen is followed by a time period of 7 days without progestin and estrogen administration.
US Pat. No. 10,111,888

INTRANASAL 0.15% AND 0.24% TESTOSTERONE GEL FORMULATIONS AND USE THEREOF FOR TREATING ANORGASMIA OR HYPOACTIVE SEXUAL DESIRE DISORDER

ACERUS BIOPHARMA INC., O...

1. A method of treating a female for anorgasmia, said method comprising:(a) depositing an intranasal testosterone gel in an amount of between about 50 microliters and 150 microliters in each nasal cavity of each nostril of the female onto a mucosal membrane on an outer external nasal wall, opposite the nasal septum, preferably at about the middle to about the upper section of the outer external nasal wall and just under the cartilage section of the outer external nasal wall, to nasally deliver to the subject the intranasal testosterone gel to effectively treat the anorgasmia, wherein the testosterone gel comprises:
(i) about 0.15% testosterone by weight of the intranasal testosterone gel, wherein the testosterone has a particle size of greater than 10 ?m to prevent the testosterone particles from entering the respiratory tract following said nasal deposition; and
(ii) a pharmaceutically acceptable vehicle; and
(b) squeezing or rubbing the exterior of the nose of the female following said nasal deposition to contact the nasally deposited intranasal testosterone gel with the nasal septum mucosal membrane within the nasal cavity, so that at least a portion of the deposited intranasal testosterone gel remains in contact with the mucosal membranes on the outer nasal wall and the nasal septum within the nasal cavity for sustained release of the testosterone from the intranasal testosterone gel over dose life.
US Pat. No. 10,111,889

USES OF GANAXOLONE

WISCONSIN ALUMNI RESEARCH...

1. A method of treating sleep disruptions due to absence epilepsy in a mammalian subject in need thereof, comprising administering ganaxolone to the mammalian subject in an amount of 0.2 to 2 mg/kg per dose, wherein the epilepsy is characterized by a deficit in tonic inhibition.
US Pat. No. 10,112,916

HMF PRODUCTION FROM GLUCOSE IN IONIC LIQUID MEDIA

The Regents of the Univer...

1. A method of processing glucose, the method comprising:enzymatically converting glucose to fructose to yield a reaction mixture comprising the glucose and the fructose; and
after the enzymatic conversion, converting up to all of the fructose in the reaction mixture to 5-hydroxymethyl furfural by introducing a choline-containing ionic liquid to the reaction mixture.
US Pat. No. 10,113,173

PROMOTER EXHIBITING HIGH EXPRESSION ACTIVITY IN MORTIERELLA MICROORGANISMS

SUNTORY HOLDINGS LIMITED,...

1. A vector comprising a polynucleotide selected from:(a) a polynucleotide which contains any one nucleotide sequence selected from SEQ ID NO: 10, SEQ ID NO:11 and SEQ ID NO: 12; or
(b) a polynucleotide which has a nucleotide sequence sharing an identity of 90% or more with any one nucleotide sequence selected from SEQ ID NO: 10, SEQ ID NO:11 and SEQ ID NO: 12 and which shows promoter activity in cells of microorganisms belonging to the genus Mortierella.
US Pat. No. 10,113,175

AP2 DOMAIN TRANSCRIPTION FACTOR ODP2 (OVULE DEVELOPMENT PROTEIN 2) AND METHODS OF USE

PIONEER HI-BRED INTERNATI...

1. A polynucleotide designed for expression in a plant selected from the group consisting of:(a) the polynucleotide encoding the amino acid sequence of SEQ ID NO:26;
(b) the polynucleotide encoding an amino acid sequence having at least 85% sequence identity to SEQ ID NO:26, wherein said polynucleotide encodes a polypeptide comprising two AP2 domains and that renders a plant cell embryogenic when expressed in the plant cell; and,
(c) the polynucleotide comprising a full length complement of the polynucleotide of (a)-(b);
wherein the polynucleotide is operably linked to a heterologous regulatory sequence.
US Pat. No. 10,112,150

POROUS GRAPHENE BASED COMPOSITE MEMBRANES FOR NANOFILTRATION, DESALINATION, AND PERVAPORATION

The Research Foundation f...

1. An article comprising:a nanofibrous scaffold;
at least a first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof on at least a portion of a surface of the nanofibrous scaffold;
an additive selected from the group consisting of cross-linking agents and particles on an outer surface of the at least first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof; and
at least a second layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof on at least a portion of the surface of the first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof, such that the additive is between the first and second layers of nanoporous graphene, nanoporous graphene oxide, or combinations thereof.
US Pat. No. 10,113,176

ISOLATED POLYNUCLEOTIDES AND POLYPEPTIDES, AND METHODS OF USING SAME FOR INCREASING NITROGEN USE EFFICIENCY, YIELD, GROWTH RATE, VIGOR, BIOMASS, OIL CONTENT, AND/OR ABIOTIC STRESS TOLERANCE

Evogene Ltd., Rehovot (I...

1. A method of increasing nitrogen use efficiency, yield, biomass, growth rate, and/or abiotic stress tolerance of a plant as compared to a wild type plant of the same species which is grown under the same growth conditions, comprising expressing within the plant an exogenous polynucleotide comprising a nucleic acid sequence encoding the polypeptide set forth by SEQ ID NO: 672, thereby increasing the nitrogen use efficiency, yield, biomass, growth rate, and/or abiotic stress tolerance of the plant as compared to the wild type plant of the same species which is grown under the same growth conditions.
US Pat. No. 10,111,895

ANDROGEN EFFECTORS

Suzanne J. Paxton-Pierson...

1. A novel androgen effector method for treating diseases, these diseases selected from the list consisting of low androgenicity, low ergogenisis, male andropause, male climacteric, low anabolism, low metabolism, low catabolism, low libido in males, low muscle tone, low muscle development, erectile dysfunction, low facial hair, low libido in females and female menopause, the method consisting essentially of administering to a human or mammal subject in need thereof, a therapeutic composition or formulation consisting essentially of a therapeutically effective amount of the testosterone mimetic androgen receptor agonist protogracillin as an active principle, plus one or more excipients, said formulation optionally being combined with one or more agents selected from the list consisting of alpha-linolenic acid, alpha terpineol, 5-alpha reductase inhibitors, androstenedione, Angelica Tenuissima, arachidonic acid, artocarpin, beta-sitosterol, biochanin-A, boron, Castanea sativa, Cichorium intybus, coconut medium chain fatty acids, Cyperus rotundus, daidzein, dehydroepiandrosterone, dioscin, Dioscorea collettii, Dioscorea deltoidea, Dioscorea pseudojaponica, Dioscorea septemloba, Dioscorea zingiberensis, dutasteride, epicatechin, epigallocatechin, escins, estrogens, fenugreek, finasteride, flutamide, gamma linolenic acid (GLA), genistein, glabradin, glabrene, gracillin, icariin, leucoanthocyanidin, licochalcone A, linoleic acid, licorice, myristoleic acid, Nelumbo nucifera, octacosanol, oleic acid, Paeonia suffruticosa, palm fruit kernel, palmitic acid, palmitoleic acid, Panax japonicas, papaverine, Paris polyphylla, perennisosides, Perilla sikokiana, PDE5 inhibitors, phentolamine, phenoxybenzamine, phytosterols, Primula root, progesterone, prostaglandin E2, protodioscin, pumpkin seed extract, Pygium africanum, Quaiilla bark, Saponaria officinalis, S. Flavescens, secoisolariciresinol, Senega root, Serenoa repens, sildenafil, solasodine, stearic acid, testosterone, testosterone receptor agonists, unsaturated fatty acids vasoactive intestinal polypeptide or VIP, and Yucca via an effective dosage form in a pharmaceutically acceptable vehicle; wherein protogracillin is a direct androgen mimetic, xenoandrogen, or agonist of androgen receptor to provide androgenic effect, and whereby androgen receptor stimulation is increased by protogracillin.
US Pat. No. 10,111,896

COMPOSITION COMPRISING A COMBINATION OF DNA METHYLATION INHIBITOR AND A VITAMIN D RECEPTOR AGONIST FOR THE TREATMENT OF DRUG RESISTANT CANCER OR FOR THE PREVENTION OF TUMOR RELAPSE

Institut National de la S...

1. A method of restoring or enhancing sensitivity to a chemotherapeutic agent in a patient suffering from hematopoietic malignancy, comprising simultaneously or sequentially administering to the patient a combination of:i. a DNA methylation inhibitor; and
ii. inecalcitol in an amount sufficient to restore or enhance sensitivity to the chemotherapeutic agent,
wherein said hematopoietic malignancy is acute myeloid leukemia,
wherein said acute myeloid leukemia is AML with normal karyotype with mutations in a gene selected from the group consisting of: FLT3, NPM1, KIT, CEBPA and MLL,
wherein said acute myeloid leukemia expresses mutated FLT3-ITD.
US Pat. No. 10,113,178

TRANSGENIC MAIZE EVENT MON 87419 AND METHODS OF USE THEREOF

Monsanto Technology LLC, ...

1. A recombinant DNA molecule comprising a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO:10.
US Pat. No. 10,112,923

1,2,4-TRIAZINE-4-AMINE DERIVATIVES

Heptares Therapeutics Lim...

1. A method of treatment of cancer, comprising administering an effective amount of 6-(2-chloro-6-methylpyridin-4-yl)-5-(4-fluorophenyl)-1,2,4-triazin-3-amine, or a pharmaceutically acceptable salt or solvate, to a patient in need of such treatment, wherein the cancer is selected from the group consisting of prostate cancer, rectal cancer, renal cancer, ovarian cancer, endometrial cancer, thyroid cancer, pancreatic cancer, breast cancer, colon cancer, bladder cancer, brain cancer, glia cancer, melanoma cancer, pineal gland cancer, and lung cancer.
US Pat. No. 10,113,179

COMPOSITIONS AND METHODS FOR MODIFYING GENOMES

BENSON HILL BIOSYSTEMS, I...

1. A method of modifying a nucleotide sequence at a target site in the genome of a eukaryotic cell, said method comprising:introducing into said eukaryotic cell
(i) a DNA-targeting RNA, or a DNA polynucleotide encoding a DNA-targeting RNA, wherein the DNA-targeting RNA comprises: (a) a first segment comprising a nucleotide sequence that is complementary to a targeted sequence in the genome of said eukaryotic cell; and (b) a second segment that interacts with a Cpf1 polypeptide; and
(ii) a Cpf1 polypeptide, or a polynucleotide encoding a Cpf1 polypeptide, wherein the Cpf1 polypeptide comprises: (a) an RNA-binding portion that interacts with the DNA-targeting RNA; and (b) an activity portion that exhibits site-directed enzymatic activity,wherein said Cpf1 polypeptide has at least 95% identity with a sequence selected from the group consisting of: SEQ ID NOs: 125, 133, 138, 142, 143, and 173, and has Cpf1 nuclease activity, wherein said method modifies said nucleotide sequence at said target site, wherein said targeted sequence is located immediately 3? of a PAM site in the genome of said eukaryotic cell, wherein said Cpf1 polypeptide recognizes a TTTC PAM site, and wherein said genome of a eukaryotic cell is a nuclear, plastid, or mitochondrial genome.
US Pat. No. 10,111,898

ANTI-TUMOR COMPOSITIONS AND METHODS

PeptiMed, Inc., Madison,...

1. A composition for targeting tumor cells and inhibiting tumor growth by activating a subject's innate immune response, the composition comprising:an isolated double stranded oligonucleotide comprising a strand comprising the nucleic sequence of SEQ ID NO: 1 and a strand comprising the nucleic sequence of SEQ ID NO: 2;
a tumor cell-targeting moiety; and
a pharmaceutically acceptable salt thereof,
wherein said oligonucleotide activates a subject's innate immune response through activation of one or more toll-like receptors (“TLRs”).
US Pat. No. 10,112,154

POLYAMIDE-BASED WATER-TREATMENT SEPARATION MEMBRANE HAVING EXCELLENT DURABILITY, AND MANUFACTURING METHOD THEREFOR

LG CHEM, LTD., Seoul (KR...

1. A water treatment separation membrane comprising:a porous support;
a polyamide active layer formed on the porous support; and
a protective layer formed on the polyamide active layer, the protective layer comprising
polyvinyl pyrrolidone and a polymer including an amine group-containing compound, an epoxy group-containing compound and a fluoro-containing compound,
wherein a thickness of the protective layer is 0.5 nm to 1000 nm.
US Pat. No. 10,113,181

MANIPULATION OF DOMINANT MALE STERILITY

PIONEER HI-BRED INTERNATI...

1. A method of propagating wheat male sterile seeds, comprising:(a) emasculating a first wheat plant that is hemizygous for a GOF-MF (gain of function male fertility) gene which comprises a promoter operably linked to a polynucleotide encoding a male fertility polypeptide, and wherein the GOF-MF gene is linked to (1) a gene that disrupts the function and/or development of male-reproductive tissue and (2) a marker gene;
(b) pollinating the first wheat plant with pollen from a second wheat plant, wherein the second wheat plant is male fertile and comprises (1) a GOF-MF gene that when expressed in male tissue maintains fertility in said second plant, and (2) an exogenous LOF-mf (loss of function of male fertility) nucleic acid construct which comprises a promoter inverted repeat (pIR) sequence comprising at least a 20 nucleotide fragment that targets the promoter of the second plant's GOF-MF gene, wherein said GOF-MF gene is a wheat male fertility gene;
(c) harvesting seeds from the cross of part (b);
(d) selecting from among the harvested seeds of part (c) for those seeds comprising
(1) the GOF-MF gene linked to the gene that disrupts the function and/or development of male-reproductive tissue, and the marker gene; and
(2) the exogenous LOF-mf nucleic acid construct that targets the promoter of the second plant's GOF-MF gene,
wherein said seeds are hemizygous for the GOF-MF gene and the exogenous LOF-mf nucleic acid construct;
(e) planting the selected seeds of step (d) and allowing the plants grown from said seeds to self-pollinate, to produce progeny plants;
(f) screening the progeny plants produced by the selfed plants of step (e) and selecting those progeny plants homozygous for the exogenous LOF-mf nucleic acid construct;
(g) allowing the progeny plants selected in step (f) to self-pollinate to produce seeds;
(h) harvesting the seeds from step (g);
(i) planting the seeds harvested in step (h) that express the marker, and growing said seeds into plants;
(j) selecting the plants of step (i) that are
(1) hemizygous for the GOF-MF gene linked to the gene that disrupts the function and/or development of male-reproductive tissue, and the marker gene, and
(2) homozygous for the exogenous LOF-mf nucleic acid construct,
which selected plants can be used as maintainer plants to propagate a male-sterile inbred; and
(k) selecting the seeds from the plants of step (j) that do not express the marker, which seeds are homozygous for the exogenous LOF-mf nucleic acid construct, and which seeds produce male-sterile progeny.
US Pat. No. 10,113,182

SUBFAMILY E SIMIAN ADENOVIRUSES A1302, A1320, A1331 AND A1337 AND USES THEREOF

THE TRUSTEES OF THE UNIVE...

1. An adenovirus having a capsid comprising a hexon protein, a penton protein, and a fiber protein, wherein said hexon protein is the hexon protein of SAdV-A1302 with the amino acids 1 to 950 of SEQ ID NO: 9, said capsid encapsidating a heterologous nucleic acid comprising a gene operably linked to expression control sequences which direct at least one of transcription, translation, and expression of said gene in a host cell.
US Pat. No. 10,116,002

PRODUCTION METHOD OF SOLID ELECTROLYTE

IDEMITSU KOSAN CO., LTD.,...

1. A method of producing a sulfide-based solid electrolyte comprising:contacting an alkali metal sulfide with a sulfur compound without pulverizing in a mixed solvent of an aromatic hydrocarbon solvent and a polar aprotic solvent, wherein:
the polar aprotic solvent is at least one of an ether solvent and a nitrile solvent, and a volume ratio of the aromatic hydrocarbon solvent to the polar aprotic solvent (aromatic hydrocarbon solvent: polar aprotic solvent) is 95:5 to 5:95.
US Pat. No. 10,113,183

ADENO-ASSOCIATED VIRUS VECTORS FOR TREATMENT OF GLYCOGEN STORAGE DISEASE

The United States of Amer...

1. A recombinant nucleic acid molecule comprising a G6PC promoter/enhancer, a synthetic intron, and a G6PC coding region, wherein the nucleotide sequence of the recombinant nucleic acid molecule is at least 95% identical to nucleotides 182-4441 of SEQ ID NO: 1, and wherein the recombinant nucleic acid comprises at least one nucleotide substitution in the G6PC coding region that results in a coding change at residue 3, 54, 139, 196, 199, 242, 247, 292, 298, 301, 318, 324, 332, 347, 349, 350 or 353 of the human G6PC protein of SEQ ID NO: 4.
US Pat. No. 10,112,414

IMAGE RECORDING METHOD AND IMAGE RECORDED ARTICLE

Fujifilm Corporation, To...

1. An image recording method, comprising:subjecting a recording substrate to a surface treatment by irradiating an image recording surface of the recording substrate with light from excimer emission using a xenon gas, the recording substrate comprising an aggregate of non-absorbent or low absorbent fiber materials; and
applying an ink composition by an ink jet method onto the image recording surface of the recording substrate after the surface treatment,
wherein the fiber materials comprise at least one selected from the group consisting of polypropylene fibers and polyethylene fibers, and
wherein the aggregate is a non-woven fabric.
US Pat. No. 10,113,184

MICROBE TRANSFORMANT FOR WEIGHT LOSS AND LIPID REDUCTION, THE METHOD FOR CONSTRUCTING THE TRANSFORMANT, AND APPLICATION THEREOF

1. A transformant for weight loss and blood lipid reduction, wherein the transformant is obtained by replacing Lactococcus lactis (L. lactis) thyA gene with a codon-optimized human oxyntomodulin gene through homologous recombination.
US Pat. No. 10,115,490

METHOD FOR NUCLEAR WASTE STORAGE AND MONITORING

MWD-IP Holdings, LLC, Da...

1. A waste storage method, comprising:storing nuclear waste, including:
identifying a subterranean storage site location having a shale rock layer, the layer having an expected fluid overpressure in a range corresponding to greater than hydrostatic pressure to less than lithostatic pressure from overlying rock layers;
forming a storage borehole, with an end segment of the storage borehole located within the layer;
measuring the fluid pressure in the end segment of the storage borehole; and
if the measured fluid pressure in the end segment of the storage borehole is in the expected fluid overpressure range:
forming a monitoring borehole in the layer with an end segment of each of the monitoring boreholes being in a vicinity of the end segment of the storage borehole and
storing nuclear waste in the end segment of the storage borehole.
US Pat. No. 10,116,004

ELECTROLYTE FOR LITHIUM BATTERY FOR SOLID STATE DRIVE BACKUP POWER AND LITHIUM BATTERY FOR SOLID STATE DRIVE BACKUP POWER INCLUDING THE SAME

Samsung SDI Co., Ltd., Y...

1. An electrolyte for a lithium battery for solid state drive backup power, the electrolyte comprising:propylene carbonate;
ethylene carbonate;
diethyl carbonate; and
LiBF4, wherein:
the propylene carbonate is present in an amount of about 20 parts by weight to about 50 parts by weight, the ethylene carbonate is present in an amount of about 40 parts by weight to about 90 parts by weight, and the diethyl carbonate is present in an amount of about 1 part by weight to 10 parts by weight, based on 100 parts by weight of the combined propylene carbonate, ethylene carbonate, and diethylene carbonate, and
the electrolyte contains the LiBF4 in a molar concentration of about 0.8 M to about 1.2 M.
US Pat. No. 10,111,904

MICRON-SIZED GOLD, KIT COMPRISING SAID GOLD AND ITS USE AS A NON-TOXIC IMMUNE SUPPRESSOR

Berlock ApS, Aarhus C (D...

4. Medical device, for the treatment of inflammatory diseases, said medical device being obtainable by a method comprising the steps ofproviding a capped vial comprising solid micron-sized gold particles or gold flakes and at least one glass bead having a diameter of 3-8 mm,
injecting a liquid which is inert to the human body and which liquid is capable of maintaining the solid micron-sized gold particles or gold flakes in suspension for at least 1 minutes,
agitating the mixture of the solid micron-sized gold particles or gold flakes, the at least one glass bead and the injected liquid to provide a suspension, whereby the at least one glass beads facilitates efficient distribution of the solid micron-sized gold particles or gold flakes in the suspension,
aspirating the suspension into the syringe, whereby the medical device is provided said medical device being the solid micron-sized gold particles or gold flakes in suspension,
wherein the capped vial comprises between 5 and 10 mg of the solid micron-sized gold particles or gold flakes.
US Pat. No. 10,113,186

ALKENOL DEHYDRATASE VARIANTS

Global Bioenergies, Evry...

1. An alkenol dehydratase variant showing an improved activity in converting prenol into isoprene over the corresponding alkenol dehydratase from which it is derived, wherein the alkenol dehydratase variant is characterized in that it shows one or more substitutions, deletions and/or insertions in comparison to the corresponding sequence from which it is derived and wherein these substitutions, deletions and/or insertions occur at one or more of the positions corresponding to positions: 2, 7, 54, 55, 58, 88, 94, 105, 110, 111, 112, 113, 117, 139, 171, 177, 189, 203, 208, 231, 240, 257, 270, 291, 299, 305, 349, 350, 395 and 397 in the amino acid sequence at least 85% identical to the sequence of SEQ ID NO:1.
US Pat. No. 10,111,905

ANTIBACTERIAL PHARMACEUTICAL PREPARATION

1. A method of treating a bacterial infection in a patient in need thereof, comprising the following steps:contacting a whole blood sample with a vessel or container, wherein the vessel or container contains macroscopic particles from glass, plastic, corundum and or quartz and wherein during incubation the whole blood sample is in contact with the macroscopic particles;
incubating said whole blood sample in contact with said vessel or container, which results in an antibacterial agent in the form of a pharmaceutical preparation being produced, wherein the pharmaceutical preparation comprises exosomes that have been generated during the period of said incubation;
and
administering an effective amount of the pharmaceutical preparation to said patient who is in need of for treatment for bacterial infection, thereby treating the bacterial infection, wherein the exosomes of the pharmaceutical preparation interact with the bacteria to inhibit bacterial growth; said bacterial infection is caused by one or more bacteria selected from Salmonella.
US Pat. No. 10,116,007

LEAD-ACID BATTERY SEPARATORS, ELECTRODES, BATTERIES, AND METHODS OF MANUFACTURE AND USE THEREOF

Daramic, LLC, Charlotte,...

1. A battery separator for a lead-acid battery with enhanced lead-acid energy storage performance comprises:a coating applied to a silica based material filled, polyolefinic lead acid battery separator, the coating comprising an engineered carbon material having a surface area (BET) of from 1500 to 3000 sqm/g;
wherein the battery separator has two surfaces, one surface which faces a positive electrode of a battery and one surface which faces a negative electrode of a battery and wherein the coating is placed on the surface which faces the negative electrode of the battery.
US Pat. No. 10,111,906

SERUM FRACTION OF PLATELET-RICH FIBRIN

Lacerta Technologies Inc....

1. A pharmaceutical preparation comprising a blood-derived serum product which is an isolated serum fraction of platelet rich fibrin (PRF) said blood-derived serum product being contained in an application device for administration of the serum fraction to an individual and being obtained by a method comprising the steps of:a. separating and removing the red blood cell fraction from a venous blood sample without the addition of an anticoagulant to provide a plasma;
b. clotting said plasma spontaneously by centrifugation carried out at 1000 to 5000 g to obtain a coagel of PRF and a supernatant, wherein in said method the centrifugation is carried out for 2 to 20 minutes;
c. pressing or squeezing the coagel to obtain a fluid fraction which comprises an activated platelet releasate from the coagel, wherein said isolated serum fraction of PRF contains the fluid fraction; and
d. providing the serum fraction in a pharmaceutical preparation which is contained in an application device for administration of the serum fraction to an individual, said serum fraction comprising a platelet releasate from activated platelets,wherein said isolated serum fraction of PRF comprises a reduced content of red blood cells, platelets or fibrinogen as compared to whole blood or a reduced content of fibrin as compared to said plasma, andwherein said serum fraction of PRF is depleted in PDGF-AB, PDGF-BB and TGF beta-1 as compared to said plasma or whole blood, and has a non-inflammatory blood factor profile, and a non-differentiating but cell proliferating profile on osteoblasts.
US Pat. No. 10,113,188

COMPOSITIONS AND METHODS FOR BIOLOGICAL PRODUCTION OF FATTY ACID DERIVATIVES

Calysta, Inc., Menlo Par...

1. A alpha-proteobacterial methanotroph, comprising a heterologous nucleic acid molecule encoding a fatty acid converting enzyme, wherein the alpha-proteobacterial methanotroph comprising the heterologous nucleic acid molecule encoding the fatty acid converting enzyme is capable of converting a C1 substrate into a C8-C24 fatty aldehyde, fatty alcohol, fatty ester wax, a hydroxy fatty acid, dicarboxylic acid, or a combination thereof, and wherein the encoded fatty acid converting enzyme comprises:(a) a fatty acyl-CoA reductase capable of forming a fatty alcohol; or
(b) a fatty acyl-CoA reductase capable of forming a fatty aldehyde; or
(c) a carboxylic acid reductase; and
(d) a thioesterase; and/or
(e) an acyl-CoA synthetase.
US Pat. No. 10,111,395

MELON PLANTS WITH ENHANCED FRUIT YIELDS

1. A Cucumis melo plant or a part thereof carrying a loss of function mutation in the MELO3 C009603 gene, wherein the plant bears more than 12 fruit, said fruit being seedless.
US Pat. No. 10,112,933

METHODS AND COMPOSITIONS FOR TREATMENT OF FIBROSIS

BAYLOR COLLEGE OF MEDICIN...

1. A method of treating an individual that has fibrosis, comprising the step of providing to the individual an effective amount of one or more compositions selected from the group consisting of N-(1?,2-dihydroxy-1,2?-binaphthalen-4?-yl)-4-methoxybenzenesulfonamide, N-(1?,2-dihydroxy-1,2?-binaphthalen-4?-yl)-4-methoxybenzenesulfonamide, N-(3,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(4,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(5,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(6,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(7,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, N-(8,1?-Dihydroxy-[1,2?]binaphthalenyl-4?-yl)-4-methoxy-benzenesulfonamide, 4-Bromo-N-(1,6?-dihydroxy-[2,2?]binaphthalenyl-4-yl)-benzenesulfonamide, 4-Bromo-N-[4-hydroxy-3-(1H-[1,2,4]triazol-3-ylsulfanyl)-naphthalen-1-yl]-benzenesulfonamide, and a functional derivative thereof, wherein the fibrosis is not pulmonary fibrosis or myelofibrosis.
US Pat. No. 10,111,396

SOYBEAN VARIETY 5PZCY11

PIONEER HI-BRED INTERNATI...

1. A plant or a seed of soybean variety 5PZCY11, representative seed of the variety having been deposited under ATCC Accession Number PTA-125128.
US Pat. No. 10,111,908

SPINAL DISC REGENERATIVE COMPOSITION AND METHOD OF MANUFACTURE AND USE

Vivex Biomedical, Inc., ...

1. A composition consisting of:(a) a syringe or injectable device which is capable of being inserted into a damaged disc to be treated; and
(b) a hydrated composition comprising hypothermically dried micronized nucleus pulposus in a fluid, produced by a method consisting of:
(i) providing normal human cadaveric intervertebral discs;
(ii) separating the nucleus pulposus from the annulus fibrosus of the normal human cadaveric intervertebral disc;
(iii) drying the nucleus pulposus;
(iv) micronizing the dried nucleus pulposus by pulverizing in a cryomill at low temperature into particles sized less than 400 microns;
(v) hypothermically drying the nucleus pulposus, wherein said hypothermically drying occurs during step (iii), and/or between steps (iii) and (iv), and/or during step (iv), and/or between steps (iv) and step (vi); and then
(vi) mixing the hypothermically dried micronized nucleus pulposus with a fluid, thereby producing the hydrated composition;
wherein the (b) hydrated composition is contained within the (a) syringe or injectable device, and
wherein the (b) hydrated composition has a viscosity which permits it to flow through a cannula.
US Pat. No. 10,113,190

METHOD FOR PRODUCING L-LEUCINE, L-VALINE, L-ISOLEUCINE, ?-KETOISOVALERATE, ?-KETO-BETA-METHYLVALERATE, OR ?-KETOISOCAPROATE USING RECOMBINANT CORYNEBACTERIA THAT CONTAIN THE ILVBN OPERON WHICH CAN BE INDUCED BY PROPIONATE

Evonik Degussa GmbH, Ess...

1. A process for the production of an L-amino acid selected from the group consisting of L-leucine, L-valine and L-isoleucine or of an ?-keto acid selected from the group consisting of ?-ketoisovalerate, ?-keto-methylvalerate and ?-ketoisocaproate, said process comprising:a) fermenting microorganisms of the genus Corynebacterium, wherein:
i) said microorganisms comprise, in replicable form, a polynucleotide with operator activity, the sequence of which is at least 85% identical to the sequence of position 1 to 121 of SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:3 and to which the activator PrpR binds; and
ii) functionally downstream of the polynucleotide with operator activity, at the 3?-end, are a second polynucleotide having propionate- or 2-methylcitrate-inducible promoter activity; as well as genes ilvB and ilvN encoding for the subunits of an acetolactate synthase, and which regulates the transcription of the genes ilvBN as a function of the addition of the activator PrpR, in a medium;
b) during the fermenting of said microorganisms, there is a first phase (growth phase), which takes place without inducer, and a second phase during which propionate or 2-methylcitrate is added as an inducer, whereupon the desired L-amino acid or ?-keto acid is synthesized under conditions in which the desired L-amino acid or ?-keto acid is enriched in the medium and/or in the cells.
US Pat. No. 10,115,496

COMPOSITIONS FOR PREPARING ELECTRICALLY CONDUCTIVE COMPOSITES, COMPOSITES PREPARED THEREFROM, AND ELECTRONIC DEVICES INCLUDING THE SAME

Samsung Electronics Co., ...

1. A composition for an electrically conductive composite, comprising, based on a total weight of the composition:37 weight percent to 84 weight percent of an epoxy;
0.001 weight percent to about 1 weight percent of an electrically conductive filler; and
15 weight percent to about 38 weight percent of a thermoplastic resin,
wherein the thermoplastic resin is a liquid at about 25° C., is miscible with the epoxy, and forms a domain upon heat curing that is phase-separated from the epoxy and the electrically conductive filler,
wherein the thermoplastic polymer is carboxyl terminated butadiene acrylonitrile (CTBN),
wherein the electrically conductive filler is carbon nanotubes having no carboxyl group on a surface thereof.
US Pat. No. 10,111,397

PLANTS AND SEEDS OF HYBRID CORN VARIETY CH249286

Monsanto Technology LLC, ...

1. A seed of hybrid corn variety CH249286, produced by crossing a first plant of variety CV345806 with a second plant of variety CV197629, wherein representative seed of said varieties CV345806 and CV197629 have been deposited under ATCC Accession numbers PTA-124515 and PTA-120299, respectively.
US Pat. No. 10,111,909

THERAPEUTICS USING ADIPOSE CELLS AND CELL SECRETIONS

Cell Ideas Pty Ltd, Gord...

1. A method of alleviating pain in a mammalian subject, the method comprising,administering to the subject a pharmaceutical composition which comprises a combination of adipose tissue-derived cell secretions and multiply-passaged adherent cells from an adipose tissue-derived cell suspension,
wherein said adipose tissue-derived cell secretions are prepared by culturing multiply-passaged adherent progeny cells from an adipose tissue-derived cell suspension and harvesting supernatant from the cell culture after about 3 or more days,
said adherent progeny cells having a fibroblast-like appearance, and
wherein said combination has been cryopreserved.
US Pat. No. 10,113,191

MICROORGANISMS HAVING ENHANCED L-AMINO ACIDS PRODUCTIVITY AND PROCESS FOR PRODUCING L-AMINO ACIDS USING THE SAME

CJ CHEILJEDANG CORPORATIO...

1. A recombinant microorganism, wherein activity of at least one of adenosine deaminase comprising the amino acid sequence of SEQ ID NO: 14 and AMP nucleosidase comprising the amino acid sequence of SEQ ID NO: 16 is removed or decreased compared to that of a mother strain, wherein the recombinant microorganism belongs to the genus Escherichia and has enhanced producibility of an L-amino acid compared to that of the mother strain, wherein the L-amino acid is L-threonine or L-tryptophan, and wherein the recombinant microorganism does not contain chloramphenicol marker gene.
US Pat. No. 10,113,192

METHOD FOR PRODUCING FRUCTOSE

ANNIKKI GMBH, Graz (AT)

1. A method for producing D-fructose from D-glucose, comprising:a) enzymatically oxidizing D-glucose to D-glucosone in a reaction vessel, and
b) enzymatically reducing the D-glucosone to D-fructose in reaction vessel,
wherein a redox cofactor is used in step b) and the redox cofactor is recycled by a cofactor regeneration system comprising a redox enzyme
wherein both enzymatic reaction of steps a) and b) are carried out in the reaction vessel and without the D-glucosone being isolated.
US Pat. No. 10,111,399

SOYBEAN CULTIVAR S170021

M.S. Technologies, LLC, ...

1. A plant of soybean cultivar S170021, representative seed of said soybean cultivar having been deposited under ATCC Accession No. PTA-124449.
US Pat. No. 10,111,911

COMPOSITIONS COMPRISING UNSATURATED FATTY ACIDS AND NITRIC OXIDE RELEASING COMPOUNDS AND USE THEREOF FOR ENHANCING COGNITIVE AND RELATED FUNCTIONS

Nestec S.A., Vevey (CH)

1. A method for enhancing cognitive function in an animal, the method comprising:identifying an animal in which enhancement of cognitive function is desired; and
administering a composition comprising effective amounts of citrulline and one or more unsaturated fatty acids (UFA) comprising docosahexaenoic acid (DHA) on a regular basis, wherein the administration on a regular basis of the composition for a time period results in enhanced cognitive function in the animal compared with an equivalent animal not administered the composition for an equivalent time period, the composition is administered in a daily dose comprising 0.5 g to 1.0 g of the DHA per day and 2.0 g to 10.0 g of the citrulline per day.
US Pat. No. 10,113,193

METHOD FOR OPTIMIZING THE ASSEMBLY AND PRODUCTION OF HETERO-MULTIMERIC PROTEIN COMPLEXES

NovImmune SA, Geneva (CH...

1. A method to increase production yield of a protein complex that comprises more than one polypeptide, the method comprising:(a) providing more than one nucleic acid molecules encoding the polypeptides in the protein complex, wherein the protein complex is a multispecific antibody or a bispecific antibody;
(b) introducing the nucleic acid molecule(s) into a cell;
(c) culturing the cell under conditions that allow for the expression of polypeptides in the protein complex; and
(d) decreasing expression of at least one of the polypeptides in the protein complex by modifying transcription rate, by modifying translation rate, by modifying mRNA stability, by modifying mRNA secondary structure, or by modifying any combination of these factors,
wherein the production yield of the protein complex is increased compared to when the expression of at least one of the polypeptides is not decreased.
US Pat. No. 10,111,912

HERBAL FORMULATIONS

MONTERO GIDA SANAYI VE TI...

1. A formulation for treating or preventing a respiratory tract disease comprising effective amounts of Propolis extract, Ginseng root extract and Zingiber officinale extract, wherein:the percentage amount of the Propolis extract based on the total volume of the formulation, is between 0.02% and 30% (w/v);
the percentage amount of the Ginseng root extract based on the total volume of the formulation, is between 0.05% and 60% (w/v);
the percentage amount of the Zingiber officinale extract based on the total volume of the formulation, is less than 30% (w/v); and wherein the formulation further comprises Glycyrrhiza glabra extract.
US Pat. No. 10,116,014

METHOD FOR MANUFACTURING AN ENERGY STORE

ROBERT BOSCH GMBH, Stutt...

1. A method for manufacturing an electrochemical energy store, the method comprising:providing a temperature control plate made of plastic, the temperature control plate at least partially including a heat-conducting material, and at least one contact area of the temperature control plate being plastically deformable;
bringing the at least one contact area into a deformable state by applying to the at least one contact area a pressure of greater than 0.1 N/cm2 for a time period of less than one hour;
while the at least one contact area is in the deformable state, applying a housing of at least one cell to the at least one contact area, and deforming the at least one contact area by the applying of the housing of the at least one cell to the at least one contact area to adapt a shape of the at least one contact area to the housing of the at least one cell, the applying of the housing of the at least one cell to the at least one contact area being a pressure-based application of the housing of the at least one cell to the at least one contact area in which the housing of the at least one cell is pressed into a material of the at least one contact area to deform the at least one contact area to adapt the at least one contact area to the shape of the housing of the at least one cell; and
hardening at least the at least one contact area of the temperature control plate after the deforming to set the at least one contact area in the adapted shape.
US Pat. No. 10,111,913

METHOD OF REDUCING THE LIKELIHOOD OF SKIN CANCER IN AN INDIVIDUAL HUMAN BEING

1. A method of reducing the likelihood of skin cancer in an individual human being, said method comprising: administering a therapeutically effective amount of a bacterial formulation comprising Nitrosomonas eutropha adapted to produce p53 said bacterial formulation comprising a lotion, ointment or gel adapted to be rubbed onto a region of an individual's skin.
US Pat. No. 10,111,914

COMPOSITIONS AND METHODS COMPRISING BACTERIA FOR IMPROVING BEHAVIOR IN NEURODEVELOPMENTAL DISORDERS

California Institute of T...

1. A method for improving behavioral performance in a human subject, the method comprising:identifying a human subject who is at least 20 years old, having:
anxiety, autism spectrum disorder (ASD), or schizophrenia; and
an adult gut microbiota signature, said adult gut microbiota signature comprising at least 500 different species of microbes,
as a human subject in need of improving behavioral performance; and
administering to the human subject in need of improving behavioral performance an effective amount of one or more Bacteroides bacteria, thereby improving behavioral performance in the human subject.
US Pat. No. 10,113,196

PRENATAL PATERNITY TESTING USING MATERNAL BLOOD, FREE FLOATING FETAL DNA AND SNP GENOTYPING

Natera, Inc., San Carlos...

1. A method for establishing whether an alleged father is the biological father of a fetus that is gestating in a pregnant mother, the method comprising:obtaining genotypic measurements of single nucleotide polymorphism (SNP) alleles at a plurality of polymorphic loci on genetic material from the alleged father;
obtaining fetal and maternal genotypic measurements of SNP alleles at the plurality of polymorphic loci from genetic material isolated from a blood sample from the pregnant mother, wherein the blood sample comprises a mixture of free floating DNA of fetal origin and free floating DNA of maternal origin, wherein the obtaining of fetal and maternal genotypic measurements comprises amplifying the plurality of polymorphic loci from the free floating DNA of fetal origin and the free floating DNA of maternal origin together in a single reaction and measuring the genotypes of the SNP alleles in the amplified DNA by a technique selected from the group consisting of quantitative PCR, digital PCR, SNP microarrays, DNA microarrays, and sequencing;
determining a probability that the alleged father is the biological father of the fetus by calculating a test statistic for the alleged father and the fetus, wherein the test statistic for the alleged father and the fetus indicates a degree of genetic similarity between the alleged father and the fetus, and wherein the test statistic for the alleged father and the fetus is based on the genotypic measurements of SNP alleles made from genetic material from the alleged father and the genotypic measurements of SNP alleles made from genetic material isolated from the blood sample from the pregnant mother;
determining a distribution of test statistics for a plurality of unrelated individuals and the fetus, where each of the test statistics for the plurality of unrelated individuals and the fetus indicates a degree of genetic similarity between an individual unrelated to the fetus and the fetus, wherein the test statistic is based on genotypic measurements of SNP alleles made from genetic material from the unrelated individual and the genotypic measurements of SNP alleles made from genetic material isolated from the blood sample from the pregnant mother;
determining if the test statistic for the alleged father and the fetus belongs to the distribution of the test statistics for the plurality of unrelated individuals and the fetus; and
outputting that the alleged father is the biological father of the fetus if the test statistic for the alleged father and the fetus does not belong to the distribution of the test statistics for the plurality of unrelated individuals and the fetus.
US Pat. No. 10,111,916

COMPOSITIONS COMPRISING BACILLUS COAGULANS SPORES AND WHEY

Ganeden Biotech, Inc., M...

1. A composition which is in powdered or granular form, comprising Bacillus coagulans spores and a component obtained from the milk of a cow, sheep or goat, wherein the component is whey, and wherein said Bacillus coagulans is GBI-30, ATCC Designation Number PTA-6086.
US Pat. No. 10,113,198

GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID ARTHRITIS, METHODS OF DETECTION AND USES THEREOF

Celera Corporation, San ...

1. A diagnostic method for identifying a human for administration of a therapeutic agent to reduce their increased risk for RF-positive rheumatoid arthritis, the method comprising:a) testing nucleic acid from said human for a polymorphism in gene PTPN22 as represented by position 101 of SEQ ID NO:36673 or its complement by contacting said nucleic acid with an oligonucleotide that specifically hybridizes to T at said position 101 of SEQ ID NO:36673 or A at said complement, wherein the nucleotide sequence of said oligonucleotide consists of a segment of at least 12 contiguous nucleotides of SEQ ID NO:36673 or its complement and includes said position 101;
b) detecting the presence of said T or said A;
c) identifying said human for administration of a therapeutic agent to reduce their increased risk for RF-positive rheumatoid arthritis due to the presence of said T or said A; and
d) administering a therapeutic agent suitable for prevention or treatment of RF-positive rheumatoid arthritis to said human.
US Pat. No. 10,111,917

METHOD FOR PREPARING PURIFIED EXTRACTS OF HARPAGOPHYTUM PROCUMBENS

NATUREX, Avignon (FR)

1. A method for preparing an extract of Harpagophytum procumbens for consumption as a food product, wherein said extract is in liquid or dry form, and wherein the extract has a harpagoside titer from 5% to 50% w/w, said method comprising:i.) preparing a crude extract of Harpagophytum procumbens by extracting roots of Harpagophytum procumbens with water and/or ethanol to provide an aqueous crude extract and plant material;
ii.) optionally filtering the plant material from the aqueous crude extract and removing the plant material from the crude aqueous extract to produce a crude filtered aqueous extract; and
iii.) purifying the crude aqueous extract or the crude filtered aqueous extract by liquid-liquid extraction using an ester organic solvent, wherein the crude aqueous extract or the crude filtered aqueous extract is extracted with the ester organic solvent, and the ester organic solvent provides an ester organic phase containing the extract of Harpagophytum procumbens.
US Pat. No. 10,112,173

ZEOLITE-BASED ADSORBENTS BASED ON ZEOLITE X WITH A LOW BINDER CONTENT AND A LOW OUTER SURFACE AREA, PROCESS FOR PREPARING THEM AND USES THEREOF

Arkema France, Colombes ...

1. An adsorbent comprising a zeolite-based phase and a non-zeolite-based phase, wherein said adsorbent:has an outer surface area of less than or equal to 30 m2·g?1,
a pore diameter distribution, determined by mercury intrusion according to standard ASTM D 4284-83 and expressed by the volume distribution dV/d log DHg, wherein DHg is the apparent pore diameter and V is the pore volume, the mode of which is between 100 nm and 250 nm, limits inclusive,
and the zeolite-based phase comprises at least one zeolite of FAU structure of X type.
US Pat. No. 10,113,199

BIOMARKERS FOR NON-HODGKIN LYMPHOMAS AND USES THEREOF

British Columbia Cancer A...

1. A method, comprising testing a sample from a human subject having B-cell non-Hodgkin lymphoma (NHL) for a mutation in Enhancer of Zeste Homolog 2 (EZH2), wherein the mutation in EZH2 is a non-synonymous substitution of Alanine (A) at position 682 (A682) of the wild-type EZH2 protein sequence and/or a non-synonymous substitution of Alanine (A) at position 692 (A692) of the wild-type EZH2 protein sequence.
US Pat. No. 10,111,918

METHOD OF PREPARING BIOLOGICALLY ACTIVE DERIVATIVES FROM CALOTROPIS GIGANTEA FLOWERS

KING SAUD UNIVERSITY, Ri...

1. A method of preparing biologically active derivatives from Calotropis gigantea flowers, comprising:obtaining Calotropis gigantea flowers;
drying the Calotropis gigantea flowers to provide dried flowers;
soaking the dried flowers in an oil to provide oil-soaked flowers; and
burning the oil-soaked flowers at a temperature of at least about 600° C., to provide flower ash, the flower ash including biologically active derivatives.
US Pat. No. 10,113,201

METHODS AND COMPOSITIONS FOR DIAGNOSIS OF GLIOBLASTOMA OR A SUBTYPE THEREOF

The Wistar Institute of A...

1. A kit consisting of ligands that quantitatively detect or identify every one of 121 target isoforms of a glioblastoma (GBM) isoform transcript signature SEQ ID Nos: 1-78 and 95-137, wherein each ligand is a nucleotide or oligonucleotide sequence that binds or hybridizes to a single said target isoform, wherein each ligand is 17 to 30 bases in length, and wherein at least one ligand is covalently joined to a detectable diagnostic label capable of generating a measurable signal; and optionally at least one assay component selected from a substrate for immobilization, a substrate for an enzymatic label, a reagent for conducting an RNA-based assay or an RT-qPCR assay, and computer software.
US Pat. No. 10,111,920

SALT-FREE MISO PRODUCTION METHOD, SALT-FREE MISO, HEPATIC FUNCTION IMPROVEMENT AGENT, AND HYPERTENSION IMPROVEMENT AGENT

MARUZEN PHARMACEUTICALS C...

1. A method of producing salt-free product of reaction of steamed soybeans with koji culture, comprising the step of fermenting steamed soybeans and koji culture under applied heat and pressure,wherein the applied heat and pressure conditions are a pressure of 50 to 80 MPa and a temperature of 50 to 60° C., and
the length of the fermenting step is one to five days.
US Pat. No. 10,112,176

SURFACE-MODIFIED SUPER ABSORBENT RESIN AND METHOD FOR PREPARING SAME

LG Chem, Ltd., (KR)

1. A surface-modified superabsorbent polymer, having a surface modified with a water-soluble polyvalent cationic salt and a polycarbonic acid-based copolymer.
US Pat. No. 10,113,202

METHOD FOR DETERMINING THE METHYLATION STATUS OF THE PROMOTER REGION OF THE TWIST1 GENE IN GENOMIC DNA FROM BLADDER CELLS

MDxHealth SA, Herstal (B...

1. A method comprising:(a) treating genomic DNA isolated from bladder cells in a urine sample with a reagent which selectively modifies unmethylated cytosine residues in DNA contained in the sample to produce detectable modified residues but which does not modify methylated cytosine residues;
(b) amplifying the treated genomic DNA with primers that bind to the promoter region of the TWIST1 gene to produce an amplicon; and
(c) detecting the amplicon to determine the methylation status of the promoter region of the TWIST1 gene;
wherein the amplicon is detected by contacting the amplicon with a probe, and:
(i) the probe comprises the nucleotide sequence of SEQ ID NO:24; or
(ii) the amplicon comprises the probe binding site for SEQ ID NO:24.
US Pat. No. 10,111,921

REGULATION OF BRAIN BIOGENIC AMINES ASSOCIATED WITH DEPRESSION BY A FORMULATION FROM BOTANICAL SOURCE

GoVind Prasad Dubey, Utt...

1. An anti-depressant tablet or capsule consisting essentially of therapeutically effective amounts of Nyctanthes arbor-tristis extract, Ocimum tenuiflorum extract, and Hippophae salicifolia extract.
US Pat. No. 10,111,922

PREPARATION METHOD OF TEA WATER, AND TEA WATER OBTAINED THEREBY

AMOREPACIFIC CORPORATION,...

1. A method for preparing aged tea water, comprising:deactivating enzymes of raw tea leaves by subjecting the raw tea leaves to steaming, and extracting juice therefrom to obtain tea juice, wherein the raw tea leaves are non-processed tea leaves;
removing ions from the tea juice to obtain tea water; and
aging the tea water at 0-120° C. for 12-24 hours,
wherein the aged tea water comprises; linalool in an amount of 5 ?g/mL or less; hexanol in an amount of 0.2 ?g/mL or less; and/or z-3-hexenol an amount of 0.2 ?g/mL or less.
US Pat. No. 10,113,204

METHODS AND MATERIALS FOR DETECTING VIRAL OR MICROBIAL INFECTIONS

Cascade Biosystems, Inc.,...

1. A kit for assessing a mammal for an infection, said kit comprising:(a) probe nucleic acid comprising a nucleotide sequence complementary to a sequence of a target nucleic acid present within a microorganism or virus capable of infecting said mammal, wherein at least a portion of said target nucleic acid is capable of hybridizing to at least a portion of said probe nucleic acid to form a double-stranded portion of nucleic acid comprising a restriction endonuclease cut site, wherein said probe nucleic acid comprises a restriction endonuclease, and
(b) signal expansion nucleic acid comprising an amplifying restriction endonuclease, a label, and a double-stranded portion of nucleic acid comprising a restriction endonuclease cut site of said restriction endonuclease of said probe nucleic acid.
US Pat. No. 10,113,205

COMPOSITIONS TO DETECT SEASONAL H1 INFLUENZA A VIRUS NUCLEIC ACIDS

GEN-PROBE INCORPORATED, ...

1. A composition comprising:at least first and second seasonal H1 influenza A-specific amplification primers, wherein the first primer comprises a H1 influenza A-specific sequence consisting of SEQ ID NO:72 and the second primer comprises a H1 influenza A-specific sequence consisting of SEQ ID:73; and
a seasonal H1 influenza A-specific oligonucleotide detection probe having a H1 influenza A-specific sequence of at least 18 contiguous nucleotides, wherein said detection probe is complementary to a H1 influenza A nucleic acid sequence that is amplifiable by the first and second primers, and wherein said detection probe comprises at least a first detectable label operably linked to said oligonucleotide detection probe.
US Pat. No. 10,111,924

DIETARY SUPPLEMENT FOR THE TREATMENT OF ACID REFLUX AND GASTRO-OESOPHAGEAL REFLUX DISEASE (GORD/GERD)

KFSU LTD, Queensland (AU...

1. A method of treating acid reflux in a human in need thereof consisting essentially of administering therapeutically effective amounts of sugarcane fiber and a component selected from the group consisting of psyllium and bran to effectively treat the acid reflux in the human in need thereof.
US Pat. No. 10,112,180

CERIA-ZIRCONIA COMPOSITE OXIDE, METHOD FOR PRODUCING THE SAME, AND CATALYST FOR PURIFYING EXHAUST GAS USING THE CERIA-ZIRCONIA COMPOSITE OXIDE

TOYOTA JIDOSHA KABUSHIKI ...

1. A ceria-zirconia composite oxide containing a composite oxide of ceria and zirconia, comprisinglanthanum, wherein
a ratio of a total content of lanthanum to a total content of cerium and zirconium in the ceria-zirconia composite oxide is 0.25 atomic % to 2.5 atomic %,
a content of lanthanum present in near-surface regions accounts for 90 atomic % or more of the total content of lanthanum, the near-surface regions being at a distance of less than 50 nm from surfaces of primary particles of the ceria-zirconia composite oxide,
a content ratio of cerium to zirconium in the ceria-zirconia composite oxide is in a range from 43:57 to 48:52 by molar ratio,
an average particle size of the primary particles of the ceria-zirconia composite oxide is 2.2 ?m to 4.5 ?m, and
an intensity ratio I(14/29) of a diffraction line at 2?=14.5° to a diffraction line at 2?=29° and an intensity ratio I(28/29) of a diffraction line at 2?=28.5° to the diffraction line at 2?=29° respectively satisfy the following conditions:
I(14/29)?0.02; and
I(28/29)?0.08,
wherein the intensity ratio I(14/29) and the intensity ratio I(28/29) are calculated from an X-ray diffraction pattern of the ceria-zirconia composite oxide, the X-ray diffraction pattern being obtained by an X-ray diffraction measurement using CuK? after heating the ceria-zirconia composite oxide under a temperature condition of 1100° C. in air for 5 hours.
US Pat. No. 10,113,206

METHODS, COMPOSITIONS, AND KITS FOR DETERMINING HUMAN IMMUNODEFICIENCY VIRUS (HIV)

Grifols Therapeutics Inc....

1. A method for amplifying an HIV-1 group M, HIV-1 group O, and HIV-2 target sequence, the method comprising:performing a single multiplex real time PCR with the HIV-1 group M, HIV-1 group O, and HIV-2 target sequences as templates, wherein performing comprises providing the PCR with forward primer and reverse primer pairs, wherein the forward primer and the reverse primer pairs consist of, respectively, the sequences as set forth in SEQ ID NO:1 and SEQ ID NO:2; SEQ ID NO:3 and SEQ ID NO:4; and SEQ ID NO:5 and SEQ ID NO:6.
US Pat. No. 10,111,925

FORMULATIONS COMPRISING PLANT EXTRACTS

MONTERO GIDA SANAYI VE TI...

1. A formulation for treating or preventing a respiratory tract disease comprising effective amounts of a Hedera helix extract, a Pelargonium sidoides extract, and a Zingiber officinale extract, wherein the percentage amount of the Hedera helix extract based on the total volume of the formulation is between 0.05% and 20% (w/v); the percentage amount of the Pelargonium sidoides extract based on the total volume of the formulation is between 0.05% and 30% (w/v); and the percentage amount of the Zingiber officinale extract based on the total volume of the formulation is between 0.05% and 30% (w/v).
US Pat. No. 10,111,926

SELECTIVELY TARGETED ANTIMICROBIAL PEPTIDES AND THE USE THEREOF

The Regents of the Univer...

1. A method of reducing the ratio of living Streptococcus mutans to total streptococci in a biofilm, said method comprising contacting said Streptococcus mutans with an amount of a construct effective to kill an Streptococcus mutans, wherein said construct comprises a targeting peptide that binds Streptococcus mutans attached to an antimicrobial peptide, wherein the amino acid sequence of said targeting peptide consists of a fragment of the competence stimulating peptide (CSP) ranging in length from 8 to 20 amino acids.
US Pat. No. 10,112,182

CATALYTIC ADSORBENT FOR THE CAPTURE OF ARSENIC AND THE SELECTIVE HYDRODESULFURIZATION OF GASOLINES

IFP ENERGIES NOUVELLES, ...

1. A catalytic adsorbent comprising at least cobalt and molybdenum deposited on a porous substrate in which the content of cobalt, expressed in terms of CoO oxide, is between 20 and 25% by weight relative to the total weight of said adsorbent, and the content of molybdenum, expressed in terms of MoO3 oxide, is between 3 and 30% by weight relative to the total weight of said adsorbent and in which the Co/Mo molar ratio is between 1 and 6, and wherein the cobalt and molybdenum are in part in sulfur form, the content and ratios of Co and Mo being determined before adding sulfur to put them part in sulfur form.
US Pat. No. 10,113,208

COMBINATORIAL METABOLIC ENGINEERING OF SACCHAROMYCES CEREVISIAE FOR TERMINAL ALKENE PRODUCTION

National University of Si...

1. A modified Saccharomyces cerevisiae yeast wherein the modification comprises:insertion of at least one heterologous fatty acid decarboxylase gene encoding a fatty acid decarboxylase that synthesizes terminal alkenes selected from 1-undecene, 1-tridecene, 1-pentadecene, 1-heptadecene or 1-nonadecene,
deletion of fatty acyl-Coenzyme A synthetases, FAA1 and FAA4,
overexpression of porphobilinogen deaminase, HEM3, and
triple-deletion of catalase T, CTT1, catalase A CTA1 and cytochrome c peroxidase, CCP1.
US Pat. No. 10,111,927

PSEUDOMONAS EXOTOXIN A WITH LESS IMMUNOGENIC B CELL EPITOPES

The United States of Amer...

1. A Pseudomonas exotoxin A (PE) comprising a PE amino acid sequence, wherein one or more of amino acid residues selected from the group consisting of E420, D463, Y481, L516, R563, D581, and D589 as defined by reference to SEQ ID NO: 1 are, independently, substituted, with the proviso that when the amino acid residue at position 516 is substituted with alanine, at least one of amino acid residues E420, D463, Y481, R563, D581, and D589 is substituted,wherein the PE has a further substitution of one or more amino acid residues within one or more B cell epitopes, and the further substitution of one or more amino acid residues within one or more B-cell epitopes is a substitution of independently, one or more of amino acid residues selected from the group consisting of E285, P290, R313, N314, P319, D324, E327, E331, Q332, D403, D406, R412, R427, E431, R432, R458, D461, R467, R490, R505, R513, E522, R538, E548, R551, R576, Q592, and L597 as defined by reference to SEQ ID NO: 1, and
wherein the PE optionally has (i) a further substitution of one or more amino acid residues within one or more T-cell epitopes, (ii) a deletion of one or more continuous amino acid residues of residues 1-273 and 285-394 as defined by SEQ ID NO: 1, or (iii) a combination of (i) and (ii).
US Pat. No. 10,111,928

PULSED INTRODUCTION OF LOW-DOSE RANKL AS A THERAPY FOR OSTEOGENESIS IMPERFECTA

Saint Louis University, ...

1. A method for treating osteogenesis imperfecta in a patient, the method comprising:providing said patient a RANK agonist being of:
sufficient amount to induce osteoclasts of said patient to produce FoxP3+ CD8 T-cells (TcREG); and
insufficient amount to activate enough of said osteoclasts to create new bone loss in said patient;
repeating said providing according to a fixed schedule so as to provide said RANK agonist to said patient at pulsed intervals, said patient having as a result of said fixed schedule increased bone mass compared to a patient not on said fixed schedule.
US Pat. No. 10,112,184

ALUMINOSILICATE AEI ZEOLITE PREPARATION

Johnson Matthey Public Li...

andb. reacting the reaction mixture at an elevated temperature for a period of time sufficient to form zeolite crystals having an AEI framework and a silica-to-alumina ratio (SAR) of about 10 to about 30, wherein the reacting step, prior to removal of SDAs from the zeolite crystals, has a relative yield based on the weight of the AEI to the weight of the reaction mixture of ?about 5%.
US Pat. No. 10,111,929

GROWTH HORMONE RELEASING FACTOR ANALOGS AND USES

EZ IP, LLC, Castle Rock,...

1. A growth hormone releasing factor (GHRF) analog comprising a sequence of Xaa1-D-2-Nal-Trp-His-Trp-D-Phe-Xaa2, wherein Xaa1 is an amino acid residue selected from D-Ala, D-Val and Gly and Xaa2 is an amino acid residue selected from Lys and Arg, or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,112,185

CATALYST AND MANUFACTURING METHOD OF CATALYST

HYUNDAI MOTOR COMPANY, S...

1. A catalyst manufacturing method comprising:preparing UZM-35 zeolite;
manufacturing ion-containing UZM-35 zeolite by exchanging ions in the UZM-35 zeolite; and
manufacturing metal-containing UZM-35 zeolite by exchanging copper (Cu) ions or iron (Fe) ions in the ion-containing UZM-35 zeolite.
US Pat. No. 10,111,930

TREATMENT OF SHORT BOWEL SYNDROME PATIENTS WITH COLON-IN-CONTINUITY

Shire-NPS Pharmaceuticals...

1. A method for treating an adult human patient with short bowel syndrome who is dependent on parenteral nutrition and who presents with colon-in-continuity with remnant small intestine, said method comprising administering to the patient [Gly2]hGLP-2 using a dosing regimen effective to reduce the dependency on parenteral nutrition by the patient.
US Pat. No. 10,112,186

BETA MOLECULAR SIEVE, PREPARATION METHOD THEREFOR AND HYDROGENATION CATALYST CONTAINING SAME

FUSHUN RESEARCH INSTITUTE...

1. A ? zeolite having a SiO2/Al2O3 molar ratio of 30-150, non-skeleton aluminum of not more than 2% based on the total aluminum, Si(OAl)-coordinated silicon atom of not less than 95% based on silicon atom in a skeleton structure.
US Pat. No. 10,111,931

TREATMENT OF SHORT BOWEL SYNDROME PATIENTS WITH COLON-IN-CONTINUITY

Shire-NPS Pharmaceuticals...

1. A method of treating an adult human patient having short bowel syndrome with at least 25% colon-in-continuity with remnant small intestine and who receives an amount of parenteral nutrition each week, said method comprising administering [Gly2]hGLP-2 to said patient using a dosing regimen effective to reduce or eliminate said weekly amount of parenteral nutrition received by said patient.
US Pat. No. 10,112,187

HIGH STRENGTH SAPO-34 MICROSPHERE CATALYST, METHOD FOR PREPARING SAME, AND METHOD FOR PREPARING LIGHT OLEFINS USING SAME

KOREA RESEARCH INSTITUTE ...

1. A method for preparing a SAPO-34 microsphere catalyst which is applied to a methanol-to-olefin (MTO) reaction, comprising:spray drying a mixed slurry comprising 100 parts by weight of a crystallized undried silicoaluminophosphate-34 (SAPO-34) slurry, 50-300 parts by weight of a binder and 0.5-5 parts by weight of an additive to prepare microspheres; and
firing the microspheres, wherein the binder consists of one or more selected from an alumina sol and a silica sol, and wherein the additive consists of one or two or more selected from hydrochloric acid, nitric acid, acetic acid, and formic acid,
wherein the crystallized undried SAPO-34 slurry is prepared by hydrothermally synthesizing a mixed synthetic gel in which a synthetic gel comprising an aluminum phosphate gel, a first organic template and a solvent; and a silica-dissolving solution comprising a silica precursor, a second organic template and a solvent are mixed,
wherein the mixed slurry comprises kaolin as a matrix in range of 13.3-67 parts by weight based on 100 parts by weight of the SAPO-34 slurry,
wherein the solvent comprises one or two selected from water and alcohol in a molar ratio of 10 to 60 based on 1 mole of an alumina precursor (based on Al2O3),
wherein the crystallized undried SAPO-34 slurry includes SAPO-34 with average crystal size of less than 1 ?m,
wherein the hydrothermal synthesis is performed by putting the mixed synthetic gel into an autoclave, maturing the mixed synthetic gel while being stirred at 20° C. to 120° C. for 0.5 hr to 24 hr and stirring the mixed synthetic gel at 150° C. to 200° C. for 5 hr to 48 hr to perform crystallization,
wherein a molar ratio calculated by the first organic template/the second organic template is 0.5 to 2.0,
wherein the SAPO-34 microsphere catalyst is used in circulating-fluidized bed reactor for preparing light olefins.
US Pat. No. 10,113,213

PROCESSING AND APPLICATION OF A PURIFICATION SYSTEM FOR A NEW ALTERNATIVE SOURCE OF ENERGY

University of Bisha, Bis...

1. A method of producing at least one metal from a gold ore and oil and/or ethanol from algae, the method comprising:(a) treating a first salt water stream having a first salt concentration X,
wherein the treating is carried out with at least one of electrodialysis reversal, reverse osmosis, and mechanical vapor compression in a first water purification system to form: (i) a first purified water stream having a second salt concentration Y lower than X, and (ii) a first saline water stream having a third salt concentration Z higher than X,
(b) treating the gold ore with the first purified water stream to separate gold from the gold ore and form a waste water comprising metal ions in a gold mining production system,
(c) treating the first saline water stream in a second water purification system connected to the first water purification system to form a second saline water stream and a second purified water stream,
wherein the second purified water stream has a fourth salt concentration A lower than Z, and the second saline water stream has a fifth salt concentration B higher than Z,
(d) feeding the second saline water stream to a bioreactor containing algae to form a first algae biomass in the saline water of the second saline water stream,
(e) feeding the first algae biomass to an algae growth and harvesting chamber to grow the first algae biomass and form a concentrated algae biomass,
(f) feeding the concentrated algae biomass to a waste water processing unit,
wherein the concentrated algae biomass forms a first algae mat in the waste water processing unit, wherein the first algae mat comprises 10-200 layers of algae and each layer of algae has a length and/or a width of 50-500 cm and a depth of 0.5-50 cm,
(g) feeding the waste water comprising the metal ions from the gold mining production system to the waste water processing unit,
wherein the first algae mat in the waste water processing unit filters the waste water to form (i) a third purified water stream and (ii) the first algae mat bound to the metal ions,
(h) removing the first algae mat bound to the metal ions from the waste water processing unit,
(i) extracting the metal ions bound to the first algae mat to produce the at least one metal, and
(j) extracting oil and/or ethanol from the first algae mat.
US Pat. No. 10,111,420

WETTING COMPOSITION

RJ ROBERTS CONSULTING PTY...

1. A method for wetting a low energy surface with an aqueous liquid, the method comprising the steps of:adding a wetting composition to the aqueous liquid to lower the surface tension of the liquid and thereby increase the ability of the aqueous liquid to wet the low energy surface; and
contacting the low energy surface with the liquid comprising the wetting composition;
wherein the wetting composition comprises:
from about 50 wt % to 70 wt % of a C5 to C12 alcohol; and
greater than or equal to about 30 wt % of a surfactant capable of forming micelles, the surfactant being selected from one or more anionic, cationic, and non-ionic surfactants;
wherein the C5 to C12 alcohol and the surfactant together make up 90 wt % or more of the wetting composition; and
wherein the amount of wetting composition added to the aqueous liquid is from about 0.1 to 5 vol %.
US Pat. No. 10,112,188

PROCESS FOR MANUFACTURE OF A ZEOLITE BASED CATALYST FOR THE CONVERSION OF METHANOL TO OLEFINS

CLARIANT PRODUKTE (DEUTSC...

1. A process for manufacturing of a zeolite based catalyst comprising the following steps:(a) adding an aluminum oxide and an acid to a zeolite powder of pentasil type, wherein the zeolite powder has an Si/Al atomic ratio of about 50 to about 250 and is of the H form,
(b) forming, drying and calcining, without treatment with steam, the mixture obtained in step (a) to obtain formed material,
(c) impregnating the formed material of step (b) with a phosphorus compound to obtain a phosphorus containing product, and
(d) calcining the phosphorus containing product from step (c) at a temperature in the range of from 150° C. to 800° C., to obtain a phosphorus containing catalyst
wherein the amounts of the aluminum oxide added in step (a), and of the phosphorus compound added in step (c) are chosen such that the AI:P atomic ratio in the phosphorus containing catalyst obtained in step (d) is 2.5 or more.
US Pat. No. 10,115,520

SYSTEMS AND METHOD FOR WIRELESS POWER TRANSFER

Mojo Mobility, Inc., San...

1. A base unit for wireless power transfer through a magnetic field, comprising:one or more components including a magnetic material or layer, that modify the magnitude and/or phase of the magnetic field and/or guide a corresponding magnetic flux generated by one or more coils in the base unit in one or multiple dimensions and/or to guide the magnetic flux in such a manner as to create a preferential path for returning flux flow in one or multiple dimensions,
wherein, when one or more power receivers each having one or more receiver coils or receivers associated therewith, is placed in proximity to a base unit, the one or more coils in the base unit are used to inductively generate a current in the one or more receiver coils or receivers associated with the one or more power receivers, and
further wherein the base unit and the one or more power receivers have a coupling coefficient therebetween of less than 0.5.
US Pat. No. 10,111,933

USE OF GROWTH HORMONE FRAGMENTS

METABOLIC PHARMACEUTICALS...

1. A method for treating osteoarthritis in a subject suffering from osteoarthritis, comprising administering to the subject in need of such treatment an effective amount of a peptide that is up to 50 amino acid residues in length and comprises amino acid residues 182-189 of human growth hormone or the corresponding region from any one of SEQ ID Nos: 1-41, which peptide does not include the domain of growth hormone responsible for IGF-1 production.
US Pat. No. 10,112,189

TRANS-METALLATED MOF CATALYST

King Fahd University of P...

1. A transmetallated metal organic framework catalyst, comprising:zinc (II) ions;
second metal ions selected from the group consisting of cobalt (II) ions, iron (II) ions, copper (II) ions and mixtures thereof; and
benzene-1,3,5-tricarboxylic acid ligands;
wherein the benzene-1,3,5-tricarboxylic acid ligands comprise carboxylate groups, each carboxylate group forming a coordinative bond to the zinc (II) ions or the second metal ions to form a coordination network in the form of porous polyhedral crystals that are isostructural to an HKUST-1 metal organic framework,
wherein the metal organic framework catalyst does not comprise a coordinated solvent and a ratio of the Zn (II) ions to the second metal ions is in the range of 1.0 to 3.0.
US Pat. No. 10,111,422

COMPOSITION AND METHOD FOR RETENTION OF SOLVATED COMPOUNDS AND IONS

ECO VERDE TECHNOLOGIES, I...

1. A method of controlled release of one or more compounds, the method comprisinga. forming a controlled release composition by reacting a reactive composition comprising
i. an ether adduct having the structure X—O—Y, wherein X is the residue of a polyhydroxylated aromatic compound free of methylol moieties, O is oxygen, and Y is a group comprising from about 10 to 1000 ethylene oxide and propylene oxide repeat units arranged in a block conformation; and
ii. a phenolic aldehyde prepolymer, an aldehyde, or a combination thereof;
b. curing the reactive composition to form a cured composition;
c. loading the composition with one or more compounds, and
d. placing the loaded composition in a release environment.
US Pat. No. 10,111,934

IGF-1 PROTEINS AND THERAPEUTIC USES THEREOF

THE TRUSTEES OF THE UNIVE...

1. A pharmaceutical composition comprising a pharmaceutically acceptable carrier and a mutant pro-IGF-I protein, wherein the mutant pro-IGF-I protein comprises an amino acid sequence set forth in SEQ ID NO: 5, wherein the amino acid sequence comprises a combination of mutation K68G, a mutation at amino acid residue R71, and a mutation at amino acid residue R77.
US Pat. No. 10,111,423

MICROBIAL PESTICIDE COMPOSITION OF DRIED BACILLUS

SDS BIOTECH K.K., Tokyo ...

1. A microbial pesticide composition, comprising: a bacterial cell dried product of a Bacillus sp. bacterium; and calcium chloride and/or magnesium sulfate, wherein the content of calcium chloride and/or magnesium sulfate in said composition is from 1 mass % to 5 mass %.
US Pat. No. 10,111,935

AGENT FOR CAPTURING TUMOR CELLS AND METHODS OF USE THEREOF

1. A method of manufacturing an agent for modulating metastatic tumor cell dissemination, the method comprising the steps of:preparing a suspended solution of a cryogenically ground ECM protein;
coating a polycarbonate polyurethane matrix by saturation within the solution of the cryogenically-ground ECM protein; and
drying the ECM protein within the polycarbonate polyurethane matrix to form the agent for modulating metastatic tumor cell dissemination.
US Pat. No. 10,113,217

PLATINUM THERMOCOUPLE WIRE

FURUYA METAL CO., LTD., ...

1. A platinum thermocouple wire being used in a negative electrode of a platinum-based thermocouple, whereina nitrogen mass concentration is 10 to 100 ppm, and
when structure observation of a cross section of the wire in a longitudinal direction is performed, a structure is observed in which there is a plurality of crystal grains, which have an aspect ratio {(length of major axis)/(length of minor axis perpendicular to major axis)} of 5 or more and elongate in the longitudinal direction of the wire, in a wire thickness direction.
US Pat. No. 10,113,218

CAST AL—SI—MG-BASED ALUMINUM ALLOY HAVING EXCELLENT SPECIFIC RIGIDITY, STRENGTH AND DUCTILITY, AND CAST MEMBER AND AUTOMOBILE ROAD WHEEL MADE THEREOF

HITACHI METALS, LTD., Mi...

1. A casting Al—Si—Mg-based aluminum alloy comprising by mass 12.0-14.0% of Si, 1.5-4.0% of Mg, 0.10% or less of Mn, and 0.10% or less of Cu, the balance being Al and inevitable impurities, and having excellent specific rigidity, strength and ductility.
US Pat. No. 10,111,425

DISINFECTANT FORMULATION

1. An aqueous disinfectant formulation consisting of:a) from about 0.05% to about 25% weight of at least one antimicrobial isolated or synthetic phenolic compound of natural origin selected from the group consisting of thymol and carvacrol;
b) from about 0.1% to about 15% weight of an anionic, a cationic, an amphoteric, an non-ionic surfactant, or combinations thereof, in an amount sufficient to form a solution or dispersion of said phenolic compound in an aqueous carrier;
c) from about 0.1% to about 40% weight of a solvent;
d) from about 0.01% to about 10% weight of a sequestering agent selected from the group consisting of ethylene diamine tetraacetic acid (EDTA) sodium salt, sodium gluconate, citric acid, trisodium NTA, trisodium ethylene disuccinate, and sodium choleate;
e) from about 0.01% to about 5% weight of a pH adjusting agent; and
f) sufficient water to make 100 weight percent.
US Pat. No. 10,112,963

SUBSTITUTED BISPHENYL BUTANOIC PHOSPHONIC ACID DERIVATIVES AS NEP INHIBITORS

Novartis AG, Basel (CH)

1. A compound selected from the group consisting of:(3-(((R)-1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-((S)-1-(((cyclohexyloxy)carbonyl)oxy)ethoxy)-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid;
(3-(((2R)-1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-(1-(((cyclohexyloxy)carbonyl)oxy)ethoxy)-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid; and
(R)-(3-((1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-ethoxy-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid; or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,113,219

NANO-PEARLITE RAIL AND PROCESS FOR MANUFACTURING SAME

Yanshan University, Qinh...

1. A nano-pearlite rail, which is a steel rail having an internal microstructure of 100% pearlite with an average interlamellar spacing of pearlite of 55-70 nm, and containing 0.83 to 0.93 of C, 0.05 to 0.10 of Mn, a certain content of Al and Si, 1.0 to 1.5 of Cr, 0.1 to 0.3 of Co, 0.35 to 0.55 of Zr, 0.02 to 0.06 of Mg, 0.01 to 0.05 of Cu, less than 0.025 of S, less than 0.025 of P, and reminder of Fe, wherein the content of Al is 8 to 12 times the content of Mn and the collective content of Al and Si is 1, wherein all the amounts are expressed in wt. %.
US Pat. No. 10,111,426

BIOCIDAL MATERIALS

SALVECO, Saint Die des V...

1. A biocidal composition comprising:a chelating agent, in an amount of 0.05-0.2 wt % of said composition, wherein said chelating agent is selected from the group consisting of succinic acid and sorbic acid;
a nonionic surfactant, in an amount of 0.03-0.12 wt % of said composition, wherein said nonionic surfactant contains a carbon-based chain of between 6 and 20 carbon atoms and is selected from the group consisting of alkyl polyglycoside, polyglycerol ester and sorbitan ester;
an anionic surfactant, in an amount of 0.02-0.08 wt % of said composition, wherein said anionic surfactant contains a carbon-based chain of between 6 and 20 carbon atoms and is an alkali or alkaline earth-metal carboxylic salt selected from a group consisting of alkyl polyethoxylates, propoxylates, polyols of polyglycoside, polyols of polyglycerol combined with a chemical so as to form alkyl carboxylate surfactants or alkyl sulfate surfactants;
lactic acid, in an amount of 0.025-0.1 wt % of said composition;
citric acid, in an amount of 0.025-0.1 wt % of said composition;
a natural fragrance, in an amount of 0.001-0.004 wt % of said composition, wherein the natural fragrance is selected from the group consisting of essential oils, plant essences and plant extracts; and
water, in an amount of 99.00 to 99.75 wt % of said composition;
wherein said composition has bactericidal activity after at least five minutes of contact at 20 degrees Celsius on a surface to which said composition is applied.
US Pat. No. 10,111,938

INJECTION PARADIGM FOR ADMINISTRATION OF BOTULINUM TOXINS

Allergan, Inc., Irvine, ...

1. A method for alleviating or reducing the occurrence of a headache in a patient with chronic migraine headaches, the method comprises:localizing one or more administration targets;
isolating the one or more administration targets; wherein the isolating step isolates the one or more administration targets from an adjacent area; thereby preventing or minimizing unwarranted adverse effects;
administering a therapeutically effective amount of a clostridial toxin to the one or more isolated administration targets;
wherein the one or more administration targets comprises the frontalis, corrugator, procerus, occipitalis, temporalis, trapezius and cervical paraspinal muscles;
wherein the administrating step is by injection and wherein the administering step comprises limiting the injection to a defined tissue depth and injection angle; and wherein the administrating to the corrugator muscle comprises targeting the belly of the corrugators and injecting superficially at a 90° angle into the belly of the corrugator muscles.
US Pat. No. 10,113,220

HIGH STRENGTH, HOT DIPPED GALVANIZED STEEL SHEET EXCELLENT IN SHAPEABILITY AND METHOD OF PRODUCTION OF SAME

1. A high strength hot dipped galvanized steel sheet comprising, as ingredients of the steel, by mass %,C: 0.05 to 0.1%,
Si: 0.1 to 1.0%,
Mn: 2.0% to 2.5%,
Al: 0.02 to 0.1%,
Ti: 0.01 to 0.05%,
Cr: 0.1 to 1.0%,
Sn: 0.0010 to 0.1%, and
a balance of Fe and unavoidable impurities,
as the unavoidable impurities,
P: 0.03% or less,
S: 0.01% or less,
Nb: 0.001% or less,
V: 0.001% or less,
W: 0.001% or less,
Mo: 0.001% or less,
Zr: 0.001% or less,
B: 0.0001% or less,
having a microstructure containing, by area %, 70-90% of ferrite and the balance being comprised of a low-temperature transformation phase containing martensite,
having an average grain size of the low temperature transformed phase of 0.1 to 1 ?m,
having a ratio of average nano hardnesses of the ferrite phase and the low temperature transformed phase of 1.5 to 3.0, and
having a nano hardness of the low temperature transformed phase at 80% or more of the measurement points of 1 to 5 times the average nano hardness of the ferrite phase.
US Pat. No. 10,111,427

FORMULATION FOR IMPROVING THE YIELD AND QUALITY OF FIBER IN COTTON PLANTS

1. A plant growth stimulating formulation, suitable for improving fiber yield and quality of the plant, comprising a solution of Anacardic acid or its other derivatives at a concentration ranging from 2-20?M, along with Phytohormone ingredients 1-Naphthaleneacetic acid (1-NAA), and Gibberellic Acid; wherein the presence of anacardic acid or its other derivatives in the formulation in combination with the phytohormone ingredients improves the fiber yield and quality of the plant.
US Pat. No. 10,111,939

ALBUMIN-FREE BOTULINUM TOXIN FORMULATIONS

Revance Therapeutics, Inc...

1. A method for stabilizing a botulinum toxin formulation comprising a botulinum toxin, a non-reducing disaccharide or a non-reducing trisaccharide, a non-ionic surfactant, and a physiologically compatible buffer, the method comprising:combining the botulinum toxin, the non-reducing disaccharide or the non-reducing trisaccharide, the non-ionic surfactant, and the physiologically compatible buffer thereby forming a liquid botulinum toxin formulation;
wherein the concentration of the non-reducing disaccharide or non-reducing trisaccharide is in the range of 10% to 40% (w/v); and
wherein the concentration of the non-ionic surfactant is in the range of 0.005% to 0.5% (w/v).
US Pat. No. 10,111,940

PROSTATE CANCER VACCINE

Wisconsin Alumni Research...

1. A method for inducing an immune reaction to androgen receptor in a mammal having prostate cancer, comprising administering to the mammal an effective amount of a polypeptide selected from the group consisting of (i) a mammalian androgen receptor (e.g., a human androgen receptor), (ii) a fragment of the androgen receptor that comprises the ligand-binding domain, (iii) a fragment of the ligand-binding domain defined by SEQ ID NO:9, (iv) a fragment of the ligand-binding domain defined by SEQ ID NO:10, (v) a fragment of the ligand-binding domain defined by SEQ ID NO:11, and (vi) a fragment of the ligand-binding domain defined by SEQ ID NO:12, whereby the mammal develops immune reaction against androgen receptor.
US Pat. No. 10,111,942

TARGETS OF ACINETOBACTER BAUMANNII

1. An immunogenic composition comprising:an isolated polypeptide encoded by a recombinant nucleic acid molecule comprising a polynucleotide having the nucleic acid sequence of:
SEQ ID NO: 3; and,
an immuno-effective amount of an adjuvant;
wherein the composition is effective in generating an immune response against Acinetobacter baumannii in a subject in need thereof.
US Pat. No. 10,111,431

APPLICATION OF BIOFILM FORMATION INHIBITING COMPOUNDS ENHANCES CONTROL OF CITRUS CANKER

University of Florida Res...

1. A method of reducing population of microbe on an object, the method comprising: applying to the object a biofilm reducing agent, or a metal antimicrobial agent and a biofilm reducing agent, in amount and for time sufficient to reduce the microbial population, wherein the microbial population comprises Xanthomonas citri subsp. citri and the biofilm reducing agent comprises D-leucine, D-Serine, or 3-idolylacetonitrile.
US Pat. No. 10,111,943

ALPHAVIRUS REPLICON PARTICLES MATCHED TO PROTEIN ANTIGENS AS IMMUNOLOGICAL ADJUVANTS

ALPHAVAX, INC., Research...

1. A vaccine composition comprising (a) purified protein and (b) alphavirus replicon particles expressing said protein, wherein the protein is an influenza virus hemagglutinin protein and wherein the alphavirus is Venezuelan Equine Encephalitis (VEE) Virus.
US Pat. No. 10,111,944

INFLUENZA VIRUS VACCINES AND USES THEREOF

1. An influenza hemagglutinin stem domain polypeptide comprising the amino acid sequence:DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLENGGGGKYVCSAKLRMVTGLRNX1PS X2QSQGLFGAIAGX3X4EGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNK VNSVIEKX5NTQX6TAX7GKEX8NKX9ERRMKQIEDKIEEIESKIWCYNAELLVLLENERTL DFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNREKIDG (SEQ ID NO: 146),
wherein X1 is K, X2 is K, X3 is F, X4 is T, X5 is M, X6 is Y, X7 is I, X8 is Y, and X9 is S.
US Pat. No. 10,111,945

CMV VACCINES

Hookipa Biotech GmbH, Vi...

1. A pharmaceutical composition comprising a first infectious, replication-deficient arenavirus viral vector engineered to contain a genome with the ability to amplify and express its genetic information in infected cells but unable to produce further infectious progeny particles in normal, not genetically engineered cells, wherein one arenavirus open reading frame is removed and replaced by a first nucleotide sequence selected from the group consisting of:a) a nucleotide sequence encoding a cytomegalovirus glycoprotein B (gB) or an antigenic fragment thereof;
b) a nucleotide sequence encoding a cytomegalovirus tegument protein pp65 or an antigenic fragment thereof;
c) a nucleotide sequence encoding a cytomegalovirus glycoprotein H (gH) or an antigenic fragment thereof;
d) a nucleotide sequence encoding a cytomegalovirus glycoprotein L (gL) or an antigenic fragment thereof;
e) a nucleotide sequence encoding a cytomegalovirus UL128 protein or an antigenic fragment thereof;
f) a nucleotide sequence encoding a cytomegalovirus UL130 protein or an antigenic fragment thereof; and
g) a nucleotide sequence encoding a cytomegalovirus UL131A protein or an antigenic fragment thereof,and a second infectious, replication-deficient arenavirus viral vector engineered to contain a genome with the ability to amplify and express its genetic information in infected cells but unable to produce further infectious progeny particles in normal, not genetically engineered cells, wherein one arenavirus open reading frame is removed and replaced by a second nucleotide sequence selected from the group consisting of:a) a nucleotide sequence encoding a cytomegalovirus glycoprotein B (gB) or an antigenic fragment thereof;
b) a nucleotide sequence encoding a cytomegalovirus tegument protein pp65 or an antigenic fragment thereof;
c) a nucleotide sequence encoding a cytomegalovirus glycoprotein H (gH) or an antigenic fragment thereof;
d) a nucleotide sequence encoding a cytomegalovirus glycoprotein L (gL) or an antigenic fragment thereof;
e) a nucleotide sequence encoding a cytomegalovirus UL128 protein or an antigenic fragment thereof;
f) a nucleotide sequence encoding a cytomegalovirus UL130 protein or an antigenic fragment thereof; and
g) a nucleotide sequence encoding a cytomegalovirus UL131A protein or an antigenic fragment thereof wherein the first and second nucleotide sequences are different.
US Pat. No. 10,112,971

PROTEIN PURIFICATION IN THE PRESENCE OF NONIONIC ORGANIC POLYMERS AND ELECTROPOSITIVE SURFACES

AGENCY FOR SCIENCE, TECHN...

1. A method of purifying an antibody from a preparation comprising:(a) providing the preparation comprising an antibody;
(b) adding allantoin to the preparation to a supersaturating concentration, wherein after adding the allantoin, the preparation is supersaturated with allantoin;
(c) removing solids from the preparation;
(d) contacting the preparation with polyethylene glycol (PEG) having a molecular weight of 2,000 to 12,000 Daltons and a salt, wherein (i) a concentration of the PEG is sufficient to precipitate the antibody or cause its accretion on a first surface, or maintain it in a precipitated state or accreted on the first surface, and (ii) the salt concentration is sufficient to produce a conductivity between 50 mS/cm and 150 mS/cm; and
(e) contacting the preparation with at least one electropositive surface whereby the antibody does not adsorb to the at least one electropositive surface, wherein the contacting does not prevent adsorption of acidic contaminants to the at least one electropositive surface.
US Pat. No. 10,111,946

POXVIRAL VECTORS FOR LOW ANTIBODY RESPONSE AFTER A FIRST PRIMING IMMUNIZATION

1. An early/late hybrid promoter comprising (a) a late element driving late expression of an antigenic determinant and (b) at least two Pr7.5 early elements (Pr7.5E) driving early expression of the antigenic determinant, wherein the late element is linked to the at least two early elements, and wherein RNA levels from the late element in a recombinant modified vaccinia Ankara (MVA) virus are at least 1.5 fold greater than RNA levels produced by the SEQ ID NO: 11 promoter in a recombinant MVA virus in HeLa cells.
US Pat. No. 10,112,972

PROCESS FOR PRODUCTION OF FIBRINOGEN AND FIBRINOGEN PRODUCED THEREBY

OCTAPHARMA AG, Lachen (C...

1. A process for purifying fibrinogen from a fibrinogen containing source, the process comprising precipitating fibrinogen with a precipitating agent from the fibrinogen containing source in the presence of one or more chelating agent(s) to form a fibrinogen paste, removing the supernatant from the fibrinogen paste, extracting fibrinogen from the fibrinogen paste in an aqueous medium void of the chelating agent(s) for a suitable extraction time thereby forming a liquid fraction containing fibrinogen and an undissolved residue, and separating the undissolved residue from the liquid fraction containing fibrinogen, whereinaddition of one or more protease inhibitor(s) is omitted in all steps of the process,
the fibrinogen is precipitated in a temperature range of from 4.1° C. to 40° C., and
the one or more protease inhibitor(s) is selected from the group consisting of C1-protease inhibitors, trypsin inhibitors, thrombin inhibitors, antithrombin-III (AT-III), heparin-cofactor-II, aprotinin, pepstatin, leupeptin and epsilon-aminocaproic acid.
US Pat. No. 10,111,436

CONTROL OF AQUATIC WEEDS WITH ENDOTHALL AND ALS-INHIBITING AGENT

SePRO Corporation, Carme...

1. A method for controlling hydrilla in a body of fresh water, comprising:providing in the body of fresh water a synergistically effective amount of a herbicidal combination including an ALS-inhibiting herbicide and endothall, so as to control the hydrilla, wherein the ALS-inhibiting herbicide is penoxsulam, imazamox, or bispyribac sodium;
wherein said providing comprises adding the endothall to the body of fresh water prior to or simultaneously with adding the ALS-inhibiting herbicide to the body of fresh water;
wherein said providing comprises providing the endothall at a level of about 0.1 to about 3.5 ppm in the body of fresh water; and
with the further proviso that:
(i) where the ALS-inhibiting herbicide is penoxsulam, the penoxsulam is applied to the body of fresh water to provide a penoxsulam level of about 2.5 to 50 ppb in the body of fresh water;
(ii) where the ALS-inhibiting herbicide is imazamox, the imazamox is applied to the body of fresh water to provide an imazamox level of about 0.02 to about 0.15 ppm in the body of fresh water; and
(iii) where the ALS-inhibiting herbicide is bispyribac sodium, the bispyribac sodium is applied to the body of fresh water to provide a bispyribac sodium level of about 0.01 to about 0.25 ppm in the body of fresh water.
US Pat. No. 10,111,948

SYNTHETIC HAPTEN CARRIER COMPOSITIONS AND METHODS

TRIA BIOSCIENCE CORP., S...

1. A peptide monomer comprising an amphipathic ?-helical peptide comprising an amino acid sequence with at least 80% identity to SEQ ID NO:1, SEQ ID NO:2, or SEQ ID NO:3.
US Pat. No. 10,111,949

COMPOSITIONS AND METHODS FOR SELF-ADJUVANTING VACCINES AGAINST MICROBES AND TUMORS

The Regents of the Univer...

1. An isolated protein comprising a multimerizing domain from the N-terminal fragment of Latent Membrane Protein 1 (LMP1) operatively joined to a cytoplasmic signaling domain of a heterologous receptor such that the protein assembles into a complex of three or more protein moieties; wherein the LMP1 multimerizing domain is translated from nucleic acids that do not contain introns.
US Pat. No. 10,111,438

COMPOSITIONS AND METHODS FOR IMPROVING FRUIT PRODUCTION

NEWLEAF SYMBIOTICS, INC.,...

1. A method for improving fruit production, said method comprising:(a) applying a composition comprising Methylobacterium and an agriculturally acceptable adjuvant, excipient, or combination thereof to a fruit bearing plant, wherein said Methylobacterium is NLS0037 (NRRL B-50941), NLS0038 (NRRL B-50942), NLS0042 (NRRL B-50932), NLS0062 (NRRL B-50937), and wherein said fruit bearing plant is an apple, pear, grape, citrus, melon, pepper, berry, kiwi, mango, or banana plant, and,
(b) harvesting fruit from said plant, wherein said plant exhibits faster fruit set, increased fruit set, earlier fruit maturation, and/or more uniform fruit maturation compared to an untreated control plant, thereby obtaining improved fruit production.
US Pat. No. 10,111,439

NON-AQUEOUS, NON-OIL BACILLUS AMYLOLIQUEFACIENS COMPOSITIONS

VALENT BIOSCIENCES LLC, ...

1. A non-aqueous, non-oil liquid composition comprising live Bacillus amyloliquefaciens, a liquid carrier selected from the group consisting of a polyethylene glycol, glycerol, ethylene glycol, dipropylene glycol, propylene carbonate and mixtures thereof, a vinylpyrrolidone polymer and a nonionic block copolymer.
US Pat. No. 10,111,440

NON-AQUEOUS, NON-OIL LIVE MICROBIAL COMPOSITIONS

VALENT BIOSCIENCES LLC, ...

1. A non-aqueous, non-oil liquid composition comprising live microbial organisms, a liquid carrier selected from the group consisting of a polyethylene glycol, glycerol, ethylene glycol, dipropylene glycol, propylene carbonate and mixtures thereof, a vinylpyrrolidone polymer and a nonionic block copolymer.
US Pat. No. 10,111,952

SILICON DIOXIDE NANOPARTICLES AND THE USE THEREOF FOR VACCINATION

MERCK PATENT GmbH, Darms...

1. A method for providing an adjuvant immune response, comprising administering nanoparticles of silicon dioxide to a patient in need thereof, wherein the nanoparticles have a size of at least 5 nm up to 150 nm.
US Pat. No. 10,112,208

GLASS ARTICLES WITH NANOPARTICLE REGIONS

1. A glass article, comprising:a glass substrate having a first surface, a second surface, and an edge;
a first nanoparticle region located within the substrate comprising first nanoparticles which are completely surrounded by the substrate; and
a second nanoparticle region located adjacent at least one of the first surface and the second surface, wherein the second nanoparticle region comprises second nanoparticles, wherein at least some of the second nanoparticles are completely surrounded by the substrate.
US Pat. No. 10,112,978

PEPTIDE AND USE THEREOF

Osaka University, Suita ...

1. A composition containing (a) a peptide of 20 or less amino acids comprising the amino acid sequence LHRLKRLRKRLK (SEQ ID NO: 9) and (b) at least one antigen that is different from the peptide.
US Pat. No. 10,114,004

SINGLE CELL ANALYSIS USING SECONDARY ION MASS SPECTROMETRY

The Board of Trustees of ...

1. A method of analyzing a cell, comprising:obtaining a cell on a substrate, wherein the cell is labeled with a plurality of mass tags; measuring, using mass spectrometry, an abundance of each of the plurality of mass tags at a plurality of sites for each of a plurality of depths within the cell, thereby generating a set of data, wherein the abundance of each of the plurality of mass tags at a plurality of sites for each of a plurality of depths within the cell is measured using secondary ion mass spectrometry (SIMS).
US Pat. No. 10,111,953

METHODS FOR REDUCING REMNANT CHOLESTEROL AND OTHER LIPOPROTEIN FRACTIONS BY ADMINISTERING AN INHIBITOR OF PROPROTEIN CONVERTASE SUBTILISIN KEXIN-9 (PCSK9)

Regeneron Pharmaceuticals...

1. A method for reducing in a patient the serum concentration of IDL-C; the method comprising selecting a patient with elevated serum IDL-C, and administering to the patient a pharmaceutical composition comprising a PCSK9 inhibitor;wherein the patient is otherwise healthy except for exhibiting elevated serum IDL-C; and
wherein the PCSK9 inhibitor is an antibody or antigen-binding fragment of an antibody that specifically binds PCSK9 and comprises the heavy and light chain CDRs of a HCVR/LCVR amino acid sequence pair selected from the group consisting of SEQ ID Nos: 90/92 and 218/226.
US Pat. No. 10,112,979

INFLUENZA VACCINATION

Seqirus UK Limited, Berk...

1. A method of immunizing a patient against an influenza virus comprising steps of:(a) selecting a patient that is immunologically naïve to the influenza virus; and
(b) administering an immunological composition comprising an antigen of the influenza virus to the patient; wherein
the immunological composition is delivered to the patient's Langerhans cells by microporation using microneedles made from at least one biocompatible polymer, which open pores in the patient's stratum corneum, wherein the microneedles ranges in length from 25 ?m to 1 mm. and wherein the influenza virus antigen is in the form of an inactivated virus or a virosome or wherein the influenza virus antigen is produced by a recombinant or synthetic system that does not involve growth of influenza viruses.
US Pat. No. 10,111,954

COMBINATION THERAPY FOR INDUCING IMMUNE RESPONSE TO DISEASE

IBC Pharmaceuticals, Inc....

1. A method of treating a Trop-2+ cancer comprising:a) administering to a human subject with a Trop-2+ cancer a trivalent T-cell redirecting complex comprising a bispecific antibody, wherein the bispecific antibody comprises (i) an anti-CD3 antibody moiety conjugated to an AD (anchoring domain) moiety from an AKAP protein, wherein the amino acid sequence of the AD moiety is SEQ ID NO:4 and (ii) an anti-Trop-2 antibody moiety conjugated to a DDD (dimerization and docking domain) moiety with an amino acid sequence of residues 1-44 of human protein kinase A (PKA) regulatory subunit RII?, wherein two copies of the DDD moiety form a dimer that binds to one copy of the AD moiety to form a complex; and
b) administering to the subject a checkpoint inhibitor antibody selected from the group consisting of pembrolizumab (MK-3475), nivolumab (BMS-936558), and pidilizumab (CT-011).
US Pat. No. 10,112,980

MUTATED IMMUNOGLOBULIN-BINDING POLYPEPTIDES

1. A separation matrix, comprising a plurality of polypeptides or multimers of the polypeptides coupled to a solid support, wherein the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 6-10, 12, 13, or a combination thereof.
US Pat. No. 10,111,443

FILLED SNACK PRODUCT WITH SPACED FILLING LINES AND METHOD OF MAKING THE SAME

Kellogg Company, Battle ...

1. A method of producing a filled snack product comprising the steps of:disposing a plurality of filling lines on a first flat surface of a first sheet, each of the plurality of filling lines being spaced to define a void between each of the adjacent filling lines;
placing the second sheet over the first sheet to sandwich the plurality of filling lines between the first and second sheets and form a laminate;
docking the laminate after the second sheet is placed over the first sheet to create a plurality of docking holes which each extend through the first and the second sheets of the laminate for the release of steam or gas during heating;
pinning the first and second sheets at the voids between the plurality of spaced filling lines to secure the first and second sheets to each other; and
heating the laminate to form the filled snack product;
wherein the plurality of docking holes and the plurality of spaced filling lines allow for pinning of the first and second sheets at the voids disposed between the plurality of spaced filling lines to minimize puffing of the filled snack product during heating.
US Pat. No. 10,112,981

METHODS FOR TREATMENT OF STROKE OR CEREBROVASCULAR ACCIDENTS USING AN ETB RECEPTOR AGONIST

MIDWESTERN UNIVERSITY, D...

1. A method of treating a stroke or cerebrovascular accident comprising administering multiple doses of a therapeutically effective amount of N-Succinyl-[Glu9, Ala11,15] Endothelin 1 to an individual in need thereof and further comprising administering a therapeutically effective amount of a second therapeutic agent useful in the treatment of stroke or cerebrovascular accident.
US Pat. No. 10,112,982

DETECTION OF ANTI-NEUROCHONDRIN AUTOANTIBODY IN PATIENTS WITH CEREBELLAR ATAXIA OR CEREBELLITIS

EUROIMMUN MEDIZINISCHE LA...

1. A method of detecting an autoantibody to Neurochondrin in a subject, the method comprising:contacting a bodily fluid sample isolated from a subject having cerebellar ataxia or cerebellitis with a polypeptide comprising Neurochondrin, wherein the polypeptide comprising Neurochondrin is recombinant and/or isolated, and binds specifically to autoantibodies binding to Neurochondrin, and
detecting the presence or absence of the autoantibody to Neurochondrin in a complex with the polypeptide.
US Pat. No. 10,114,264

DEVICE FOR REGULATING THE PASSAGE OF ENERGY

Merck Patent GmbH, Darms...

1. A device for regulating the passage of light through a light-transmitting area, said device comprising:one or more glass layers and at least one switching layer which comprises a liquid-crystalline medium comprising at least one dichroic dye,
wherein said switching layer has a bright state ?v bright and a dark state ?v dark, and
wherein said switching layer has a degree of anisotropy R of at least 0.65 and a degree of light transmission in the bright state ?v bright in accordance with Standard EN410 of 40% to 90%,
wherein said device is a component of a window,
wherein said switching layer comprises three or more different dichroic dyes, and
wherein the liquid-crystalline medium has a clearing point in the temperature range from 70° C. to 170° C.
US Pat. No. 10,111,957

INHALATION COMPOSITIONS COMPRISING GLUCOSE ANHYDROUS

Arven Ilac Snayi ve Ticar...

1. A dry powder inhalation composition comprising,at least one corticosteroid or a pharmaceutically acceptable salt thereof,
fine particle lactose in an amount of 1-20% by weight of said composition and having d50 particle size in the range of 4-10 ?m and coarse particle anhydrous glucose in an amount of 80-99% by weight of said composition and having a d50 particle size in the range of 50-120 ?m.
US Pat. No. 10,112,983

NEUREGULIN VARIANTS AND METHODS OF SCREENING AND USING THEREOF

1. A polypeptide variant of neuregulin-1 ? comprising amino acid sequence shown in SEQ ID NO:1, wherein the polypeptide variant comprises a different amino acid than that in SEQ ID NO:1, wherein the polypeptide variant has an enhanced binding affinity to ErbB3 compared to polypeptide of SEQ ID NO:1, and whereinat residue 25 said different amino acid is A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y; or
at residue 35 said different amino acid is A, C, D, E, F, G, H, I, L, N, M, P, Q, R, S, T, V, W, or Y; or
at residue 46 said different amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, or Y.
US Pat. No. 10,114,009

METHODS OF DETECTING T1R HETERO-OLIGOMERIC TASTE RECEPTOR EXPRESSION TO IDENTIFY CELLS THAT ARE POTENTIALLY SENSITIVE TO SWEET TASTANTS

Senomyx, Inc., San Diego...

1. An in vitro method of detecting a human or monkey cell that is potentially sensitive to sweet tastants, the method comprising: (a) detecting the expression of a T1R2 polypeptide at least 90% identical to the polypeptide of SEQ ID NO: 6 and (b) further detecting expression of a T1R3 polypeptide at least 90% identical to the polypeptide of SEQ ID NO: 7; and (c) based on the results of (a) and (b), identifying a cell that expresses said T1R2 and T1R3 polypeptides (“detected cell”) which, therefore, is potentially sensitive to sweet tastants (“detected cell”).
US Pat. No. 10,111,446

FATTY ACID VINYL ESTER COPOLYMERS WITH WAX QUALITIES

Wacker Chemie AG, Munich...

1. A method for preparing fatty acid vinyl ester copolymers by free-radical initiated polymerization ofa) one or more vinyl esters of carboxylic acids having 16 to 22 carbon atoms and
b) one or more vinyl esters of carboxylic acids having 2 to 15 carbon atoms,
wherein the one or more vinyl esters a) and the one or more vinyl esters b) are metered in during the polymerization, and
during the polymerization either a metered addition rate of vinyl ester a) or a metered addition rate of vinyl ester b) is reduced and the metered addition rate of the other of the two vinyl esters a) or b) is increased.
US Pat. No. 10,111,958

ANTI-CD40 ANTIBODY FORMULATION

Novartis AG, Basel (CH)

1. An aqueous pharmaceutical composition, wherein the composition has a pH of 6.0 and comprises(i) an anti-CD40 antibody wherein the antibody has a concentration of 150 mg/ml, and wherein said anti-CD40 antibody includes heavy chain CDR1, CDR2 and CDR3 of SEQ ID NOs 3, 4 and 5 respectively, and light chain CDR1, CDR2 and CDR3 of SEQ ID NOs: 6, 7 and 8,
(ii) 270 mM sucrose as a stabiliser,
(iii) 30 mM histidine as a buffering agent, and
(iv) 0.06% polysorbate 20 as a surfactant.
US Pat. No. 10,112,984

LIGHT-SENSITIVE CHIMERIC GPCR PROTEIN

Haagstreit Medtech AG, K...

1. A chimeric G-protein-coupled-receptor (GPCR) protein comprising an N-terminal domain, a C-terminal domain, transmembrane domains, extracellular loops and intracellular loops, wherein the chimeric GPCR protein includes domains from at least two different GPCR proteins and has the domains arranged to form a GPCR protein, and wherein:(a) a first portion of the chimeric GPCR protein comprises transmembrane domains contributed by a first member of the G-protein-coupled-receptor (GPCR) superfamily, wherein said first member is a bi-stable opsin, wherein said transmembrane domains mediate light activation and comprise an amino acid residue that forms a Schiff' base with a chromophore to covalently bind the chromophore to the GPCR protein; and
(b) a second portion of the chimeric GPCR protein comprises one or more intracellular domains of mGluR6 selected from the intracellular loops IL1, IL2, IL3 and the C-terminal domain (CT), said second portion of the chimeric GPCR protein binding a Galpha(o) protein of the signaling cascade of mGluR6, wherein said one or more selected intracellular loops are present in the chimeric GPCR in corresponding numerically defined positions as in the native mGluR6 structure, and wherein the second portion comprises intracellular loop 3 (IL3) of mGluR6.
US Pat. No. 10,114,010

BIOMIMETIC INTERFACE DEVICE AND METHODS OF USING THE SAME

1. A method of using a physiologically-relevant apparatus, the method comprising the steps of:providing an apparatus including at least one cassette; wherein each cassette includes a spun elastomer scaffold located within a channel separating two chambers, the spun elastomer scaffold, channel and chambers are sealed within the cassette; wherein each chamber in each cassette includes a port and nozzle configured to connect each chamber to tubing; wherein the tubing is connected to a pump; wherein the pump is configured to flow fluid in a circuit through the tubing and each cassette seeding a spun elastomer scaffold in the apparatus with a biological sample; and at least one reservoir connected to the tubing;
configuring the apparatus pump to create a specified flow rate and pressure;
adding an analyte to a reservoir;
flowing a fluid through the apparatus for a specified period of time; and
measuring the analyte;
wherein the spun elastomer scaffold is self-riveted to the chambers.
US Pat. No. 10,114,266

ELECTROACTIVE OPTICAL DEVICE

PPG Industries Ohio, Inc....

1. An electroactive optical device comprising:(a) an optical substrate having two opposing surfaces;
(b) at least two electrodes spaced one from the other and disposed on the surface of the substrate;
(c) at least one electroactive material layer in contact with the at least two electrodes (b) and the surface of the substrate (a) wherein the electroactive material layer comprises at least one electrochromic-dichroic material which is a single compound which is both electrochromic and dichroic in response to an applied voltage, and
wherein the electroactive optical device has variable light transmittance in response to the magnitude of an applied electrical voltage.
US Pat. No. 10,111,959

ANTIMICROBIAL GELS

1. An antimicrobial dressing comprising an antimicrobial gel comprising at least two polysiloxanes, wherein the antimicrobial gel is formed by creating at least one covalent bond between at least one alkenyl and/or alkynyl moiety of a first polysiloxane and at least one Si—H moiety of a second polysiloxane, the antimicrobial gel further comprises at least one hydrosilylation catalyst, at least one silver salt, and at least one hydrophilic component, wherein the at least one hydrophilic component makes the antimicrobial gel swell at least 5% (wt/wt) after 24 hours in a water solution containing 8.298 g/L of sodium chloride and 0.368 g/L of calcium chloride dihydrate, as measured by the free swell absorption method, wherein the antimicrobial gel is on a substrate, wherein the substrate comprises a foam comprising polyurethane, wherein the antimicrobial gel is characterized in having an accumulated silver release of at least 0.3% of the total silver content in the initial antimicrobial composition after 24 hours.
US Pat. No. 10,114,011

ANTIGEN PRESENTING CELL ASSAY

1. A method, comprising:(i) contacting a first portion of a biological sample comprising antigen presenting cells (APCs) obtained from a subject in need of or having received an organ transplant from a donor, with a donor antigen from the donor in vitro under conditions sufficient to induce uptake of the donor antigen;
(ii) contacting a second portion of the biological sample comprising APCs obtained from the subject in need of or having received an organ transplant with a third-party antigen in vitro under conditions sufficient to induce uptake of the third-party antigen; and
(iii) measuring amount of uptake of the donor antigen in the first portion of the biological sample and measuring amount of uptake of the third-party antigen in the second portion of the biological sample, wherein the APCs are dendritic cells or macrophages, wherein the method determines the ratio of uptake of the donor antigen in the first sample and the uptake of the third party antigen by the APCs in the second sample.
US Pat. No. 10,111,448

FEED COMPOSITIONS COMPRISING RICINODENDRON HEUDELOTII AND METHODS OF PROCESSING AND USING THEREOF

Alcorn State University, ...

1. A method of reducing fat in an animal in need thereof, the method comprising:forming an oral feed composition comprising a delivery media and at least about percent by weight of Ricinodendron heudelotii (njangsa) seeds, and
feeding the animal an effective amount of the feed composition for a suitable period of time to reduce fat in the animal,
wherein the feed composition is metabolized by the animal and the body composition of the animal is improved such that fat is reduced by about 31%; and
wherein the njangsa seeds are obtained from mature njangsa tree fruit and the seeds are extracted from the seed shells by heating the seed kernels at a temperature above about 100° C.
US Pat. No. 10,112,986

ANTI-GLUCOSAMINIDASE PASSIVE IMMUNIZATION FOR STAPHYLOCOCCUS AUREUS INFECTIONS

University of Rochester, ...

1. A method of introducing an orthopedic implant into a patient comprising:administering to a patient in need of an orthopedic implant an effective amount of an antibody or an antigen-binding portion of an antibody that binds specifically to a Staphylococcus aureus glucosaminidase and comprises the complementarity determining region sequences of the VH domain of SEQ ID NO:2 and the VL domain of SEQ ID NO:3; and
introducing the orthopedic implant into the patient.
US Pat. No. 10,114,012

METHODS AND ASSAYS FOR DETECTING AND QUANTIFYING PURE SUBPOPULATIONS OF WHITE BLOOD CELLS IN IMMUNE SYSTEM DISORDERS

THE BOARD OF TRUSTEES OF ...

1. A method for determining a subject's susceptibility to an allergic reaction, the method comprising:(a) stimulating a whole blood sample from the subject with an allergen, wherein the whole blood sample comprises a basophil cell population;
(b) labeling the whole blood sample with anti-CD203c and a differential label for phosphatase and tensin homolog (PTEN); and
(c) measuring a level of expression of CD203c and PTEN using flow cytometry and comparing the level of expression to a control sample, wherein a higher level of expression of CD203c and PTEN in the basophil cell population compared to the control sample is indicative of increased susceptibility to an allergic reaction to the allergen in the subject.
US Pat. No. 10,111,449

PRODUCTION PROCEDURE FOR A FUNCTIONAL FEED BASED IN ELLAGIC ACID, CIMENOL AND ALLIIN FROM VEGETABLE EXTRACTS TO BE USED AS PRONUTRIENT IN ANIMAL FEED

BIOVET, S.A., Cambrils (...

1. An animal food product consisting essentially of an extract of Thymus vulgaris, an extract of Punica granatum and an extract of Allium sativum, wherein the Thymus vulgaris has a p-cimenol content of 15%-17% by weight, the Allium sativum has an allin content of 20%-26% and the Punica granatum has an ellagic acid from 2%-4%, wherein said animal food product was treated with methanolic hydrochloric acid and wherein said product has an inductor effect on the reproduction rate of RNA-protein in swine intestinal cells.
US Pat. No. 10,111,961

SELF-ASSOCIATING MICROPARTICLES AND NANOPARTICLES CONSISTING OF PROTEINS

CENTRE NATIONAL DE LA REC...

1. An inclusion complex formed by the interaction betweenat least one protein selected from the group consisting of elastin, collagen, gliadin, gelatin, keratin, legumin, vicilin, casein, fibrinonectin and fibrillin, said protein substituted by hydrophobic groups covalently bound to said protein, and
at least one ?-cyclodextrin (CD) in the form of a monomer,the protein and the cyclodextrin being non-covalently bound, wherein the hydrophobic groups by which said protein is substituted are alkyl groups, linear or branched.