US Pat. No. 10,555,624

PRODUCT MANAGEMENT DISPLAY SYSTEM WITH TRACKLESS PUSHER MECHANISM

RTC Industries, Inc., Ro...

1. A merchandise display system comprising:a front rail that is mountable to a shelf;
at least one divider floor configured to engage the front rail and to receive product;
a divider wall extending upwardly from the divider floor;
a portion of the divider floor having a front lock; and
a pusher mechanism coupled to the divider floor and configured to slide in a same plane as a surface of the shelf and in a direction perpendicular to the front rail,
wherein a portion of the front lock is in front of the divider wall and is configured to be digitally accessible by a user's thumb or finger when product is on the divider floor,
wherein the front lock is shiftable between a first position and a second position,
wherein the front lock moves the divider floor out of engagement with the front rail when in the first position to permit slidable movement of the divider floor relative to the front rail,
wherein the front lock prevents slidable movement of the divider floor relative to the front rail when in the second position, and
wherein the front rail further defines a tongue extending upwardly from the front rail, and wherein the divider floor defines a groove for receiving the tongue when the divider floor is mounted to the front rail.

US Pat. No. 10,555,623

COMPACT DISPLAY TRAY

Trion Industries, Inc., ...

1. A modular system for the display and dispensing of a plurality of product containers in front-to-back columns and in one or more tiers, said system comprisinga plurality of individual, width-adjustable trays configured to be joined in a side-by-side array, where the individual trays each comprise:
a first extruded component comprising a first bottom-forming part and a high side wall having a first height for laterally confining product containers to be displayed in and dispensed from each tray respectively, with said product containers being stackable in a plurality of tiers, wherein the high side wall has an interior side surface and an opposite exterior side surface,
wherein the high side wall is generally perpendicular relative to the first bottom-forming part, wherein the first bottom-forming part comprises an upwardly extending flanged protrusion; wherein at least one rail protrudes from the interior side surface of the high side wall, wherein a pusher is slidably mounted to the high side wall, wherein the pusher has at least one generally horizontal flange that engages the at least one rail to suspend the pusher from the high side wall, wherein the pusher is configured to move the product containers forwardly within each tray respectively;
a second extruded component comprising a second bottom-forming part at least partially overlying said first bottom-forming part and defining a product support surface and a low side wall of lower height than said high side wall for lateral confinement of the product containers between the high wall and the low side wall, the height of the low side wall being no greater than two inches above the product support surface, wherein the low side wall has an interior side surface and an opposite exterior side surface,
wherein the low side wall is generally perpendicular relative to the second bottom-forming part, wherein the second bottom-forming part comprises a plurality of inverted flanged elements extending downwardly from the second bottom-forming part, wherein a channel is defined between each adjacent pair of inverted flanged elements from said plurality of inverted flanged elements;
the first bottom-forming part and the second bottom-forming part overlap and interlock with each other by inserting the upwardly extending flanged protrusion within a corresponding channel to adjust a spacing between said high wall and said low wall to a desired width for the product containers to be displayed therein;
wherein each exterior side of each high side wall and each exterior side of each low side wall have a male connector or a female connector defining a track,
wherein each male connector is generally perpendicular relative to each flanged protrusion and each flanged element respectively,
wherein each male connector is configured to be inserted into a corresponding female connector so that the low side wall of a first tray is slidably connected to the high side wall of an adjacent second tray, such that the high side wall of said second tray also functions as a second high side wall for said first tray.

US Pat. No. 10,555,622

DISPENSING DEVICE

1. A dispensing device comprising:a housing, the housing comprising:
a loading chamber,
a dispensing chamber located beneath the loading chamber and openable to dispense its contents, and
a gate or shutter which forms the base of the loading chamber and the upper wall of the dispensing chamber;
the gate or shutter being manually movable between a first, open position in which it is withdrawn from the housing and allows the contents of the loading chamber to drop into the dispensing chamber and a second, closed position in which it is received in the housing and prevents the contents of the loading chamber from dropping into the dispensing chamber;
wherein whenever the gate or shutter is moved from the closed position to the open position, the whole contents of the loading chamber are displaced into the dispensing chamber,
the dispensing device further comprising:
first indicating means which displays a first visible signal indicative that the gate or shutter has been moved from the closed position to the open position such that the loading chamber is empty, and
second indicating means which can be actuated by a user to display a second visible signal to indicate that the first signal has been observed,
wherein the second indicating means can be actuated only after the first visible signal has been displayed.

US Pat. No. 10,555,621

COVER HAVING INTERNAL SECURING BENDABLE RODS

1. A cover having an internal bendable rod comprising:a first cover having a first side, a second side, a top, a bottom, a front, a back and a sleeve portion containing a sealed hollow interior;
at least one internal bendable rod temporarily completely secured within the sealed hollow interior of the sleeve portion wherein the internal bendable rod is capable of being bent into various orientations and may maintain the position the internal bendable rod is bent into;
a second cover secured to the first cover wherein the second cover is smaller than the first cover and wherein the second cover is completely located within a perimeter of the first cover; and
wherein the second cover has a first side, a second side, a third side and a fourth side and wherein a securing mechanism runs along an entire length of the first side, the second side, the third side and the fourth side of the second cover and wherein the securing mechanism is capable of independently securing or releasing the first side, the second side, the third side or the fourth side of the second cover to the first cover and therein creating an opening forming a pocket between the first cover and the second cover when three of the four sides of the second cover are secured to the first cover.

US Pat. No. 10,555,620

BABY CARRIER WITH TIES

The Boppy Company, LLC, ...

1. A baby carrier, comprising:a waist belt configured to wrap around a caregiver's waist;
a baby support coupled to the waist belt that is configured to support at least a portion of a baby adjacent the caregiver;
a left and a right shoulder strap that are configured to rest on a left and right shoulder of the caregiver, respectively, wherein the left and right shoulder straps are operably connected to or integrally formed with the baby support and each form a loop through which a left and right arm of the caregiver pass through to permit the left and the right shoulder straps to rest on the caregiver's left and rights shoulders; and
a left tie and a right tie, wherein one end of the left tie and the right tie are operably coupled to the baby support, the waist belt and/or the left and the right shoulder straps, respectively, and wherein the left tie and the right tie each have a free end to permit the left and the rights ties to be tied together to secure the baby carrier to the caregiver separately from the waist belt.

US Pat. No. 10,555,619

METHOD AND SYSTEM FOR ASSEMBLED FURNITURE

Yuntek International Inc....

1. A method of forming a packaged assembled furniture comprising:providing a single, contiguous cover defining a single cavity and comprising a plurality of dividers attached to the cover and disposed within the cavity, wherein the cavity is at least partially divided into a plurality of inner compartments by the plurality of dividers;
providing a plurality of cushions, the plurality of cushions configured to fit within respective inner compartments of the cavity, wherein the plurality of cushions are confined in the inner compartments by the plurality of dividers disposed within the respective inner compartments of the cavity;
sealing the plurality of cushions in an air-tight bag; and
removing the air from inside the air-tight bag to decrease the size of the plurality of cushions.

US Pat. No. 10,555,618

MATTRESS PROTECTORS, MATTRESSES COVERED BY MATTRESS PROTECTORS, AND RELATED METHODS

Purple Innovation, LLC, ...

1. A mattress protector, comprising:a single continuous composite sheet having a non-deformed length and a non-deformed width,
the composite sheet including:
a fabric with between 4% to 15% by weight elastomeric fibers; and
a water impermeable polymer carried by the fabric with a greatest average layer of thickness of 0.0015, wherein the fabric is embedded within a layer of the water impermeable polymer;
wherein the composite sheet is capable of repeatedly stretching to a deformed length of at least 115% of the non-deformed length and returning to within 8% of the non-deformed length without rupture or permanent wrinkling of the composite sheet.

US Pat. No. 10,555,617

AIR POCKET MODULE AND AIR MATTRESS INCLUDING SAME

iOBED INC., Gyeonggi-Do ...

1. An air mattress comprising:an air pocket unit including an air pocket module;
a body portion into which the air pocket unit is inserted and fixed;
a controller mounted at the body portion and controlling the air pocket unit; and
a pressure sensor unit measuring pressure of the air pocket unit,
wherein the air pocket module includes:
multiple air pockets each having a hollow portion formed therein and configured to inflate due to air inflow or to deflate due to air outflow; and
a bottom plate coupled to lower sides of the air pockets and configured to block the hollow portion of each of the air pockets,
wherein each air pocket comprises:
a top surface portion forming a top surface; and
a side surface portion connected with the top surface portion and forming a side surface, the side surface portion comprising:
a first side surface including two surfaces facing each other, the first side surface including a first inflation portion formed concavely toward the hollow portion; and
a second side surface including two other surfaces facing each other and connected to edges of the first side surface, the second side surface having a width greater than a width of the first side surface, each of the two other surfaces of the second side surface including a pair of second inflation portions spaced apart from each other and each formed concavely toward the hollow portion.

US Pat. No. 10,555,616

ROCKING DEVICE

1. A device for rocking a hammock holding a human, wherein the device comprises:a frame having an upper surface defining a slot;
a lever arm, wherein the lever arm is rotatably coupled with the frame at a pivot point and an upper portion of the lever arm extends outside of the frame through the slot;
a solenoid coupled with the frame, wherein:
a plunger of the solenoid is coupled with the lever arm; and
the plunger, when actuated by the solenoid, rotates the lever arm about the pivot point in a first rotational direction;
a cord, wherein the cord comprises:
a first end coupled with an upper half of the lever arm; and
a second end; and
a first signaling device coupled with the frame, wherein the solenoid is configured to actuate the plunger upon at least the first signaling device detecting that the lever arm has been rotated about the pivot point in a second rotational direction to a first rotational position, by a hammock coupled with the second end of the cord.

US Pat. No. 10,555,615

CALIBRATION OF DETECTION FEATURES FOR AUTOMATED FURNITURE

1. A non-transitory computer-readable storage medium including instructions that, when executed by a processor, cause the processor to:determine a first noise state associated with an environment of the furniture item based on a first measured noise received from one or more sensors associated with the furniture item;
generate a first baseline noise level for the furniture item based on filtering the first noise state associated with the environment of the furniture item;
determine a second noise state associated with the environment of the furniture item based on a second measured noise received from the one or more sensors associated with the furniture item;
generate a second baseline noise level for the furniture item based on filtering the second noise state associated with the environment of the furniture item; and
adjust the first baseline noise level to the second baseline noise level.

US Pat. No. 10,555,614

BOTTOM BED COMBINATION

Apex Health Care Mfg. Inc...

1. A bottom bed combination comprising:a first bed bottom, a second bed bottom, two fastening units and a plurality of stands;
wherein:
the first bed bottom includes a first bed frame and a first bed board;
the first bed frame is provided with a plurality of first bases;
the first bed frame has a lower portion provided with a first linkage and a first electric cylinder;
the second bed bottom includes a second bed frame juxtaposed to the first bed frame and a second bed board juxtaposed to the first bed board;
the second bed frame is provided with a plurality of second bases;
the second bed frame has a lower portion provided with a second linkage and a second electric cylinder;
each of the two fastening units includes a mount detachably mounted on the first bed frame and the second bed frame, and a pin extending through the mount, the first bed frame and the second bed frame, to connect the first bed frame and the second bed frame by the mount; and
the stands are respectively secured on the first bases of the first bed frame, the second bases of the second bed frame and the mount of each of the two fastening units.

US Pat. No. 10,555,613

REMOTE CONTROL FOOTREST

1. A remote control footrest comprising:a base, the base having a top side, a bottom side, a front side, a back side, a right side, a left side, and a cavity between the top side, the bottom side, the front side, the back side, the right side, and the left side, the top side having a pole aperture extending through to the cavity;
a lift means coupled to the base, the lift means being coupled within the cavity;
an adjustable support pole coupled to the base, the adjustable support pole being coupled through the pole aperture and in operational communication with the lift means, the lift means adjusting a length of the adjustable support pole;
a footrest coupled to the adjustable support pole, the footrest being configured to support a foot or a leg of a user; and
a remote control, the remote control being in wireless communication with the lift means, the remote control adjusting the length of the adjustable support pole and thus a height of the footrest.

US Pat. No. 10,555,612

ADJUSTABLE HEAD SUPPORTING TRAVEL ACCESSORY

Coolside Limited, Glasgo...

1. An adjustable head supporting apparatus configured, in use, to be anchored against a user's neck, wherein the apparatus comprises:a contoured head element;
a contoured shoulder element; and
at least one connecting member connectable to each of the head element and the shoulder element;
wherein the at least one connecting member is configured to link respective ends of the head element with respective ends of the shoulder element; and
wherein the at least one connecting member facilitates displacing the head element and the shoulder element to adjust spacing between the head element and the shoulder element, wherein displacement of a first end of the head element relative to a first end of the shoulder element can be independent of displacement of a second end of the head element relative to a second end of the shoulder element;
at least one fastening unit joins the connecting member, the head element and the shoulder element, wherein the fastening unit is operable to lock together the connecting member, the head element and the shoulder element thereby preventing displacement of the head and shoulder element; and wherein upon releasing the fastening unit displacement of the head and shoulder element is permitted, wherein the fastening unit comprises:
an actuator, which facilitates manual release and manual displacement of the fastening unit relative to the connecting member, the head element and the shoulder element, and wherein displacement of the fastening unit causes displacement of corresponding ends of the head and shoulder element; and
a retaining element configured to engage with the connecting member, thereby preventing displacement of the fastening unit until release of the retaining element from the connecting member; and
wherein, in use, at least the head element and the shoulder element are encased within a fabric garment, wherein, in use, the fabric garment anchors the adjustable head supporting apparatus against a user's neck,
wherein the fastening unit further comprises a resilient member operable to bias the fastening unit to a locked configuration,
wherein upon applying a bias-overriding load to the fastening unit, via the actuator, the fastening unit is released and capable of displacing the head and shoulder element.

US Pat. No. 10,555,611

ADJUSTABLE SEATING SYSTEMS AND ASSOCIATED STRUCTURES

FORCE 3 INNOVATIONS INC.,...

1. A structure of a seating system for a human user, the structure comprising:a frame;
a seat structure supported by the frame, the seat structure comprising a thigh support region and a pelvic support region, the pelvic support region defining a pelvic well for receiving an ischial tuberosity of the user and providing a fulcrum for rotation of a pelvis of the user;
a back rest structure supported by the frame, the back rest structure comprising:
a gluteal panel for supporting a gluteal mass of the user; and
a posterior superior iliac spine (PSIS) panel disposed above the gluteal panel, the PSIS panel being adjustable to cause movement of a PSIS of the user and cooperate with the pelvic well to cause rotation of the pelvis of the user about the fulcrum provided by the pelvic well, wherein:
the PSIS panel comprises two loading zones separated by a spine relief zone; and
the spine relief zone of the PSIS panel comprises a recess formed into the PSIS panel.

US Pat. No. 10,555,610

TELESCOPIC SEATING SYSTEMS, AND FOLDABLE CHAIRS AND RELATED COMPONENTS FOR USE WITHIN TELESCOPIC SEATING SYSTEMS

1. A foldable chair, comprising:a structural frame having a first surface defined by a first side of the structural frame and having a second surface defined by a second side of the structural frame, wherein the first side is oriented toward a chair occupant, and wherein the second side is oriented opposite the first side;
an occupant support having a spring structure attached to the first surface of the structural frame that, at least partially, extends into a space between the first surface and the second surface when the chair occupant sets on the occupant support;
a spring structure travel limiter, wherein the spring structure travel limiter is a panel attached to the second surface of the structural frame, that prevents travel of the spring structure beyond the second surface when the chair occupant sets on the occupant support; and
a cushion, supported by a surface defined by the spring structure oriented toward the chair occupant, that cooperates with the spring structure to at least partially conform to a portion of a profile of the chair occupant and that supports the chair occupant.

US Pat. No. 10,555,609

PRESSURE-SENSING CHAIR, INCLUDING FIRST ELASTIC BODY HAVING LOWER ELASTIC MODULUS THAN SECOND ELASTIC BODIES ARRANGED THEREIN

LG INNOTEK CO., LTD., Se...

1. A pressure-sensing chair comprising:a sensing sheet including a first electrode having a plurality of first conductive regions formed in a first direction and a plurality of first non-conductive regions formed in the first direction, a second electrode having a plurality of second conductive regions formed in a second direction and a plurality of second non-conductive regions formed in the second direction, and an intermediate layer disposed between the first electrode and the second electrode, and the sensing sheet including a plurality of sensing regions corresponding to regions where the plurality of first conductive regions intersect the plurality of second conductive regions; and
a cushion on the sensing sheet, the cushion including:
a first elastic body disposed on the sensing sheet and having a first elastic modulus; and
a plurality of second elastic bodies arranged in the first elastic body and having a second elastic modulus higher than the first elastic modulus, wherein the plurality of second elastic bodies extend in a direction from an upper portion of the first elastic body toward the sensing sheet, wherein each of the plurality of second elastic bodies includes a first head unit adjacent to an upper surface of the cushion, a second head unit adjacent to the sensing sheet, and an extension unit connecting the first head unit and the second head unit, and a width of the first head unit is greater than a width of the extension unit, and a width of the second head unit is greater than the width of the extension unit,
wherein the cushion is disposed on the sensing sheet such that the first electrode is in direct contact with the cushion and each second head unit of the cushion is vertically adjacent to a different one of the sensing regions of the sensing sheet, and the first elastic body of the cushion is provided between each of the second head units of the cushion such that the first elastic body of the cushion is vertically adjacent to each of the plurality of first non-conductive regions.

US Pat. No. 10,555,608

HYDRAULIC SUPPORT

Flat Pty Ltd, New South ...

1. A hydraulic foot assembly for supporting an object on a surface, the foot assembly comprising:a cylinder defining an interior reservoir,
a piston dividing the reservoir into a first chamber and a second chamber, the chambers being in fluid communication with one another, the piston moveable within the reservoir, the position of the piston within the reservoir effecting a change in an overall length of the foot assembly,
a valve arrangement comprising at least two unidirectional valves, the arrangement configured to control movement of fluid between the chambers and thereby control movement of the piston within the cylinder, the valve arrangement being adapted to allow movement of fluid between the chambers when fluid pressure in one chamber is greater than a predetermined level, while resisting movement of fluid between the chambers when fluid pressure in both chambers is below a predetermined level.

US Pat. No. 10,555,607

SLIDE RAIL ASSEMBLY

KING SLIDE WORKS CO., LTD...

1. A slide rail assembly, comprising:a first rail having a front portion and a rear portion, the first rail comprising a first blocking structure and a second blocking structure;
a second rail having a front portion and a rear portion;
a third rail mounted between the first rail and the second rail;
a working member arranged to the third rail in a movable manner; and
an auxiliary member arranged between the front portion and the rear portion of the first rail, the auxiliary member comprising a guiding portion and a blocking portion;
wherein when the third rail is located at a retracted position relative to the first rail, the first blocking structure is configured to prevent the third rail from being moved from the retracted position in a retracted direction;
wherein when the third rail is located at the retracted position, the second rail is able to be moved relative to the third rail in the retracted direction to a predetermined position with the rear portion of the second rail being beyond the rear portion of the first rail by a distance;
wherein during a process where the second rail is moved in the retracted direction, the second rail is capable of switching the working member from a first state to a second state, such that the working member in the second state cooperates with the second blocking structure for preventing the third rail from being moved from the retracted position in an extended direction opposite to the retracted direction;
where when the working member is in the first state, the working member does not cooperate with the second blocking structure allowing the third rail to be moved relative to the first rail in the extended direction, the working member being guided to the blocking portion by the guiding portion during a predetermined movement where the working member is moved, so as to prevent the third rail from being moved relative to the first rail in the retracted direction when the third rail is at a first extension position.

US Pat. No. 10,555,606

STAND FOR HOLDING BOTTLES UPSIDE DOWN

1. A device for holding a bottle upside down, comprising:a. a rigid wire frame comprising a metal-infused plastic, said frame having a plurality of horizontal interconnected layers for increasing the strength of the frame and collectively supporting the weight of said bottle, said plurality of horizontal interconnected layers being connected to each other via a plurality of substantially vertical connecting wires;
b. at least one foot; and
c. at least one bottle support comprising a substantially semi-spherical shape having a concave surface, and an upper edge having a plurality of raised, curving shoulders for contacting said bottle.

US Pat. No. 10,555,605

MODULAR SHELVING

1. A modular shelving apparatus, comprising:a first piece comprising a top surface, a bottom surface, a first end, a second end, a right side, and a left side; wherein a first channel, a second channel, a third channel, and a fourth channel are each formed in the first end or the second end of the first piece and each extend from the top surface to the bottom surface;
wherein a first tine, a second tine, a third tine, and a fourth tine are formed on the first piece, the first tine and the second tine and the third tine and the fourth tine are all on the first end or the second end of the first piece, wherein the first channel is located between the first tine and the second tine, the second channel is between the second tine and a middle section, the third channel is between the middle section and the third tine, the fourth channel is between the third tine and the fourth tine, wherein the middle section is located between the second channel and the third channel;
a second piece comprising a top surface, a bottom surface, a first end, a second end, a right side, and a left side; wherein a fifth channel, a sixth channel, a seventh channel, and an eighth channel are each formed in the second piece and each extend from the top surface to the bottom surface of the second piece;
wherein a fifth tine, a sixth tine, a seventh tine, and an eighth tine are formed on the second piece, the fifth tine and the eighth tine are both located on the second end of the second piece and the sixth tine and the seventh tine are both located on the first end of the second piece opposite the second end, the fifth channel is located between the fifth tine and a middle section, the sixth channel is located between the sixth tine and the middle section, the seventh channel is located between the middle section and the seventh tine, and the eighth channel is located between the middle section and the eighth tine, the sixth channel and the seventh channel are located between the fifth channel and the eighth channel, wherein the middle section is located between the fifth channel and the eighth channel and also between the sixth channel and the seventh channel;
a third piece comprising a top surface, a bottom surface, a first end, a second end, a right side, and a left side; wherein a ninth channel, a tenth channel, an eleventh channel, and a twelfth channel are each formed in the third piece and each extend from the top surface to the bottom surface of the third piece;
wherein a ninth tine, a tenth tine, an eleventh tine, and a twelfth tine are formed on the third piece, the ninth tine and the tenth tine and the twelfth tine are all located on the second end of the third piece and the eleventh tine is located on the first end of the third piece opposite the second end, the ninth channel located between the ninth tine and the tenth tine, the tenth channel is located between the tenth tine and a middle section, the eleventh channel is located between the middle section and the eleventh tine, and the twelfth channel is located between the middle section and the twelfth tine, wherein the middle section is located between the tenth channel and the twelfth channel and also between the tenth channel and the eleventh channel; wherein the third piece further comprises a first pair of grooves in the top and bottom surfaces of the third piece, wherein the first pair of grooves spans between the ninth channel and the first end of the third piece, a second pair of grooves in the top and bottom surfaces of the third piece, wherein the second pair of grooves spans between the tenth channel and the first end of the third piece, a third pair of grooves in the top and bottom surfaces of the third piece, wherein the third pair of grooves spans between the eleventh channel and the second end of the third piece, and a fourth pair of grooves in the top and bottom surfaces of the third piece, wherein the fourth pair of grooves spans between the twelfth channel and the first end of the third piece, wherein the first pair of grooves, the second pair of grooves, the third pair of grooves, and the fourth pair of grooves each have a first width and a first depth, wherein the ninth channel, the tenth channel, the eleventh channel, and the twelfth channel each have a second width and a second depth, wherein the second width is larger than the first width and the second depth is larger than the first depth;
wherein the first piece is configured to slide into the third piece with the first channel engaging the twelfth channel, and wherein the third piece is configured to slide into the second piece with the fifth channel engaging the ninth channel.

US Pat. No. 10,555,604

CANTILEVER SHELVING SYSTEM

INTERMETRO INDUSTRIES COR...

1. A cantilever shelving system of the type that is freestanding on a floor surface, the cantilever shelving system comprising:a frame adapted to be supported on the floor surface comprising a plurality of laterally-spaced, vertically-oriented support members comprising first and second lateral end support members and at least one intermediate support member located between the first and second lateral end support members, each of the plurality of support members having a base portion adapted to engage the floor surface and a front surface, wherein the front surfaces of the plurality of support members are all coplanar along a first vertical plane;
a cantilever shelf support mounted to the frame and extending generally perpendicularly from the first plane in a first direction;
at least one shelf supported by the shelf support and the frame at a first vertical distance above the floor surface; and
a plurality of base supports adapted to engage the floor surface, the plurality of base supports comprising two laterally spaced first base supports and at least one second base support located intermediate of the two first base supports;
wherein the two first base supports are respectively connected to the first and second lateral end support members near a lower vertical end of each of the first and second lateral end support members respectively;
wherein the at least one second base support is connected to the at least one intermediate support member near a lower vertical end of the at least one intermediate support member;
wherein each of the plurality of base supports comprises a single support leg having an upper side, a proximal end located adjacent to each corresponding one of the plurality of support members respectively and a distal end spaced from each proximal end in the first direction;
wherein each support leg is generally perpendicular to each of the plurality of support members respectively;
wherein the two first base supports each further comprise:
a flange connected to the proximal end of each support leg, wherein each flange extends both above and below the upper side of each support leg respectively; and
wherein each flange includes a plurality of mounting apertures for respectively accommodating a corresponding plurality of fasteners for fixing the two first base supports directly to the first and second lateral end support members respectively;
wherein the first base supports each further comprise a mounting strap connected to the proximal end of each support leg; wherein the mounting straps each wrap around the first lateral end support member and the second lateral end support member respectively;
wherein the distal end of each support leg of the two first base supports terminates at a second vertical plane generally parallel to the first vertical plane;
wherein the respective upper sides of the support legs of the two first base supports are located in a first horizontal plane at a second vertical distance above the floor surface; and
wherein the upper side of the at least one second base support is located in a second horizontal plane at a third vertical distance above the floor surface;
wherein the first vertical distance is greater than the second vertical distance and the second vertical distance is greater than the third vertical distance;
wherein a piece of kitchen equipment is configured to rest upon the floor surface while being disposed between the two first base supports, above the upper side of each support leg of the at least one second base support, and beneath the at least one shelf.

US Pat. No. 10,555,603

HEIGHT ADJUSTABLE WORKSTATION

LUMI LEGEND CORPORATION, ...

1. An adjustable workstation, comprising:a table top having an upper side and an opposed underside;
a legs assembly comprising at least a first scissor mechanism including a first leg and a second leg, a top of the first leg pivotally attached to the underside of the table top, a top of the second leg slidingly engaged with a groove attached to the underside of the table top;
a base frame, a bottom of the first leg comprising a roller engaged with a roller tray on the base frame, a bottom of the second leg pivotally attached to the base frame; and
an adjustment mechanism configured to move the legs assembly to adjust a height of the table top relative to the base frame, the adjustment mechanism comprising:
a rack and pinion mechanism comprising a first rack engaged with a pinion gear, the first rack mounted on a slide such that the first rack can move back and forth along the slide as the pinion gear rotates,
a first locking mechanism, comprising a spring loaded locking pawl configured to engage the first rack to prevent movement of the first rack,
a gas spring comprising a cylinder and a piston rod, wherein a free end of the piston rod is attached to the underside of the table, and an end of the cylinder is attached to the first rack, and
a first actuator configured to release the locking pawl to allow the first rack to move, wherein the first actuator comprises an actuator arm extending along an axis, an actuator handle positioned at a first end of the actuator arm, a first surface formed at an angle with respect the axis positioned at a second end of the actuator arm, and a movable housing having a second surface configured to slidingly contact the first surface so as to move along the first surface as the first actuator is actuated, wherein the spring loaded locking pawl is connected to the moveable housing, wherein movement of the moveable housing engages and disengages the locking pawl, wherein the first actuator is actuated by pulling the handle along the axis of actuator arm, and wherein the locking pawl moves along a second axis that is orthogonal to the axis of the actuator arm;
wherein, upon actuation of the actuator, the height of the table top relative to the base frame is adjustable, and upon release of the actuator, the height of the table top relative to the base frame remains fixed.

US Pat. No. 10,555,602

HEIGHT-ADJUSTABLE TABLE

DONG GUAN SONG WEI ELECTR...

1. A height-adjustable table, comprising a base, at least two height-adjustable table legs, a retaining frame, a tabletop, a motor box, a controller, a power adapter, and a hand controller; the table legs being spaced apart and arranged vertically, each of the table legs including an immovable outer tube and a movable inner tube, a lower end of the immovable outer tube being fixed to the base, the movable inner tube being movably disposed in the immovable outer tube, an upper end of the movable inner tube extending out of the immovable outer tube; the retaining frame being fixedly connected to the upper end of the movable inner tube of each of the table legs, the tabletop being disposed on top of the retaining frame and fixedly connected to the retaining frame; the motor box being disposed on the retaining frame, the motor box including a box body and a motor disposed in the box body, the motor driving the movable inner tube of each of the table legs to move up and down through a driving rod; the controller being disposed in the box body, the controller being connected to the motor; the power adapter being connected to the controller; the hand controller being connected to the controller,wherein each of the table legs is provided with an immovable screw rod, a movable sleeve and a transmission assembly, the immovable screw rod and the movable sleeve are disposed in the movable inner tube, a lower end of the immovable screw rod is fixedly connected to the lower end of the immovable outer tube, the movable sleeve is screwed to the immovable screw rod, an upper end of the movable sleeve is rotatably connected to the upper end of the movable inner tube, the transmission assembly is mounted to the upper end of the movable inner tube and drives the movable sleeve to rotate back and forth, and an end of the driving rod is connected to the transmission assembly.

US Pat. No. 10,555,601

EXPANDABLE TABLE ASSEMBLY

1. An expandable table assembly being configured to increase a useable surface area without occupying more floor space, said assembly comprising:a box being positionable on a support surface wherein said box is configured to serve as a coffee table;
a lid being hingedly coupled to said box for closing said box, a top surface of said lid being horizontally oriented when said lid is closed wherein said top surface is configured to serve as a table top, said top surface of said lid being oriented at an upwardly slanting angle when said lid is in said open position wherein said top surface is configured to serve as an angled work surface;
a first extension panel being hingedly coupled to said first lateral side of said box, said first extension panel extending away from said first lateral side in a horizontal orientation when said first extension panel is positioned in a deployed position for increasing a surface area of a top of said box; and
a second extension panel being hingedly coupled to said second lateral side of said box, said second extension panel extending away from said second lateral side in a horizontal orientation when said second extension panel is positioned in a deployed position for increasing a surface area of a top of said box, said box having a top side, a first lateral side, a second lateral side and a front side, said top side having an opening extending an interior of said box, said front side having a pair of holes each extending into said interior of said box; and
a base having said box being coupled thereto, said base being positionable on the support surface having said box extending upwardly from said base, said base having a perimeter being greater than a perimeter of said box, said box being centrally positioned on said base.

US Pat. No. 10,555,600

CLEANING APPLIANCE

Dyson Technology Limited,...

15. A handle for a dental cleaning appliance, the handle being detachably connectable to a cleaning tool of the appliance, the handle comprising:a body;
a transparent panel connected to the body, the panel defining a trough-shaped recess that extends longitudinally in a longitudinal direction of the handle;
a display; and
a control circuit for activating the display,
wherein the display is located beneath the recess such that the display is viewable through the recess.

US Pat. No. 10,555,599

LOADOUT EXCHANGE SYSTEM

AARDVARK, Laverne, CA (U...

1. A loadout exchange system comprising:a back panel comprising a front side with a hook and loop surface, a back side with a MOLLE-compatible surface, and at least one strap; and
a front panel comprising a front side with a MOLLE-compatible surface, a back side with a hook and loop surface, and a first pull tab;
wherein the MOLLE-compatible surface of the back side of the back panel is configured for attachment to a MOLLE-compatible load-bearing platform using the at least one strap;
wherein the hook and loop surface of the front side of the back panel is complementary to the hook and loop surface of the back side of the front panel; and
wherein the MOLLE-compatible surface of the front side of the front panel is configured to receive at least one strap from a MOLLE-compatible pouch.

US Pat. No. 10,555,598

ATTACHMENT APPARATUS FOR MODULAR LOAD-CARRYING DEVICES

1. An apparatus for securing an accessory to a modular load-carrying device, comprising:a plurality of connectors, wherein each of the plurality of connectors comprises a first end, a body portion, and a second end, wherein the plurality of connectors is configured to attach the accessory to the modular load-carrying device;
a bridge comprising one or more openings formed therein; and
an attachment mechanism securing the plurality of connectors to the bridge via the one or more openings.

US Pat. No. 10,555,597

PHONE RING HOLDER

CASE-MATE, INC., Atlanta...

1. A holder accessory for a portable electronic device, comprising:a base portion configured for attachment to the portable electronic device, the base portion comprising a cap, a base plate, and a rail positioned between the cap and the base plate, wherein the rail is configured to rotate about a rotational axis relative to the base portion;
a gripping component pivotally mounted to the rail, wherein the gripping component is configured to pivot about a pivot axis between a storage position and a use position, wherein the pivot axis is different than the rotational axis;
a first seal positioned between the cap and the rail; and
a second seal positioned between the rail and the base plate.

US Pat. No. 10,555,596

COMBINED CARRIERS AND PROTECTIVE VESTS

Leatherback Gear, LLC, C...

1. A backpack for providing protection, the backpack comprising:a housing that is configured to be assembled as a backpack in a first configuration and deploy a protective vest in a second configuration, wherein the housing comprises a plurality of compartments including at least a first compartment and second compartment when the housing is assembled as a backpack in the first configuration;
a fastener that enables the housing to transition from the first configuration to the second configuration, wherein: (i) a structure of the housing arranged in the second configuration includes a front vest portion and a rear portion; (ii) the first compartment is located on the front vest portion or rear portion; and (iii) a structure of the backpack permits content included within the first compartment or second compartment to remain within the backpack when the housing is arranged in the second configuration;
one or more connectors that enable the front vest portion to be coupled to the rear portion in the second configuration, wherein the one or more connectors at least include:
a pair of mid-section connectors configured to connect the front vest portion to the rear portion near an individual's mid-section region in the second configuration, and
a pair of shoulder straps that connect the front vest portion to the rear portion in the second configuration; and
armor components included in the front vest portion and the rear portion, wherein the armor components are positioned to provide protection for both a portion of an individual's torso and a portion of back or posterior region when the housing is arranged in the second configuration.

US Pat. No. 10,555,595

HANGING CHAIR HAVING A SPREADING STICK

LA SIESTA GMBH, Jungenhe...

1. A hanging chair, comprising:a spreading stick, a hanging chair surface, suspension strings, and drawstring tunnels on the hanging chair surface for receiving the suspension strings,
wherein
a base section of the hanging chair surface of the hanging chair has at least one approximately rectangular seat surface and a trapezoidal back surface attached to the seat surface,
a trapezoidally widening extension portion is attached to an edge of the seat surface that is opposite to a connection of the seat surface with the back surface,
the extension portion, on account of the trapezoidal widening in a suspended laterally gathered state of the hanging chair, continues the seat surface approximately horizontally and adapted to support stretched-out legs of a person using the hanging chair,
the seat surface, back surface and extension portion have common lateral drawstring tunnels on each lateral edge of the hanging chair surface for string guidance and fastening to the spreading stick,
these lateral drawstring tunnels bring out, by the suspension strings guided therein, a gathering of an entire length of each lateral edge of the hanging chair surface, and
these gatherings on the hanging chair, when suspended, form a steeper profile of the back surface with respect to a flatter extending profile of the seat surface.

US Pat. No. 10,555,594

BACKPACK CONFIGURED TO DISSIPATE HEAT

Gizmospring.com Dongguan ...

1. A backpack configured to dissipate heat along a back of a wearer, the backpack comprising:a backpack body having a surface configured to contact the back, the surface having at least one air duct formed therein; and
an air moving device attached to the backpack body, the air moving device being positioned to provide an airflow to the at least one air duct, the at least one air duct conducting the airflow along the back of the wearer to thereby dissipate heat along the back of the wearer, the air moving device comprising a multi-level speed-regulating module, and one or more first blowers each connected to the multi-level speed-regulating module, the multi-level speed-regulating module being configured to control a speed of the one or more first blowers, the multi-level speed-regulating module comprising a speed control circuit, an output interface, and a switching circuit, the speed control circuit comprising a multi-level switch, which includes a first fixed contact, a second fixed contact, a third fixed contact, and a moveable contact, the moveable contact being selectively connectable to one of the first, second, and third fixed contacts, the speed control circuit comprising a first resistor and a second resistor, the first fixed contact being connected to a first end of the first resistor, a second end of the first resistor being connected to the output interface, the second fixed contact being connected to a first end of the second resistor, a second end of the second resistor being connected to the output interface, the third fixed contact being connected to the output interface, the switching circuit comprising an input interface, a power input interface, and a plurality of blower output interfaces, the input interface being connected to the output interface, and the plurality of blower output interfaces being connected one each to the one or more first blowers.

US Pat. No. 10,555,593

LIP APPLICATOR CARRIER SYSTEM

1. A lip applicator carrier system comprising:a) at least one lip applicator comprising a lip applicator housing, a lip applicator housing interior, and a dermatologically acceptable topical agent located in the lip applicator housing interior and configured to be used on a human's lips; and
b) a carrier comprising a carrier housing comprising a top, a forward end, a rear end opposite the forward end, a left side, a right side opposite the left side, a substantially open bottom, at least one internal wall extending downward from the carrier housing top and defining a plurality of reservoirs, each of the plurality of reservoirs extending from the carrier housing forward end to the carrier housing rear end,
wherein the carrier further comprises a clip extending above the carrier housing top,
wherein the at least one lip applicator is removably located in a reservoir, and further wherein each reservoir comprises a top and further wherein at least one reservoir comprises a deflectable ramp extending from the top of the reservoir.

US Pat. No. 10,555,592

APPLICATION FOR TOPICAL COMPOSITION

SYMBIOTEC PHARMA LAB PVT....

1. An applicator for administering a composition to a target area comprising:an applying portion comprising a cavity with at least one open portion, the cavity comprising a porous volume and defined, at least in part, by at least one side wall, the side wall comprising at least one controlled-adaptation zone;
a dividing portion adjacent to, and opposite the at least one open portion of, the cavity; and
a target-area contacting portion adapted to create a seal between the at least one open portion of the cavity and the target area to which the composition is being applied;
wherein the controlled-adaptation zone is coupled to the target-area contacting portion and adapted to flexibly promote continuous contact between the target-area contacting portion and the target area.

US Pat. No. 10,555,591

EPILATION DEVICE MEASURING CONTACT FORCE AND COMPRISING A FEEDBACK UNIT

Braun GMBH, Kronberg (DE...

1. An epilation device for pinching and pulling out hairs from the skin of a user comprising:an epilation barrel comprising a plurality of clamping elements;
a drive unit for driving the epilation barrel into movement; and
a control unit for analyzing a contact pressure between the epilation barrel and the skin of a user and for determining whether the contact pressure is equal to or smaller than a lower threshold contact pressure and is equal to or larger than a first upper threshold contact pressure, wherein the drive unit is adapted to reduce the movement of the epilation barrel by a predetermined amount when the contact pressure is equal to or larger than the first upper threshold contact pressure.

US Pat. No. 10,555,590

CARBON FORMED BODY, DRYER, AND NOZZLE

OHGI Technological Creati...

1. A carbon formed body for use to cover an outlet of a dryer, the carbon formed body comprising:a plate-like member formed from graphite; and
elongated holes extending along a spiral line as viewed in a thickness direction of the carbon formed body and penetrating through the plate-like member in the thickness direction of the carbon formed body, wherein the thickness direction of the carbon formed body is parallel to a direction of a flow of air that flows in a housing of the dryer and that is discharged from the outlet.

US Pat. No. 10,555,589

PROTECTIVE CASE FOR MOBILE ELECTRONIC DEVICE WITH STORAGE COMPARTMENT

Incipio, LLC, Irvine, CA...

1. A user-removable protective case for retaining and protecting a mobile electronic device and containing a personal item, the protective case comprising:an inner layer;
an outer layer;
a shell formed by a main body and a subpanel, at least a portion of the main body and the subpanel are sandwiched by the inner layer and the outer layer, the subpanel is coupled to the main body through a hinge, a cavity dimensioned to retain the mobile electronic device is formed by the shell;
a front cover formed by a cover panel that is positioned between the inner layer and the outer layer, the cover panel is coupled to the subpanel of the shell through a flexible spine;
a compartment dimensioned to retain the personal item is formed into the inner layer of the shell; and
an aperture positioned and dimensioned to enable the personal item contained in the compartment to be inserted into and removed from the protective case when the subpanel is hingedly rotated away from the main body.

US Pat. No. 10,555,588

ADJUSTABLE LUGGAGE TRUNK STROLLER HAVING FOLDABLE SEAT

1. A luggage trunk stroller having a foldable seat, comprisinga rod assembly, comprising a grasping part and two parallel sleeves,
wherein said grasping part has two ends separately sleeved in top ends of said parallel sleeves, said grasping part being configured to be prolonged in length or shortened in length;
wherein said parallel sleeves are combined with a front wheel set at first bottom ends of said parallel sleeves;
wherein said parallel sleeves have two rotation pivots and two support rods at two sides of said parallel sleeves separately opposite to a casing;
wherein said support rods are disposed to said rotation pivots at second top ends of said support rods separately to be swayed with a center of said rotation pivots; and
wherein said support rods are combined with a rear wheel set at second bottom ends of said support rods;
a casing,
wherein said casing is combined with said rotation pivots of said parallel sleeves at two opposite sides of said casing; and
wherein said casing is swayed with a center of said rotation pivots of said parallel sleeves to obtain a tilt angle;
a seat cushion,
wherein said seat cushion is pivotally connected to the casing; and
wherein said seat cushion is moved in a way selected from a group consisting of being swayed and extended to be used on a front surface of said casing;
and being swayed and folded to be disposed on a side of said casing; and
a seat belt,
wherein said seat belt is obtained on said front surface of said casing to fasten and safeguard an infant.

US Pat. No. 10,555,587

EXPANDABLE LUGGAGE

Travelers Club Luggage, I...

1. An expandable luggage container comprising:a first compartment;
a side cover formed on a lateral side of the first compartment, a first zipping mechanism formed around three sides of the side cover;
a second compartment coupled to the first compartment;
a top cover formed on a top side of the second compartment, a second zipping mechanism formed around three sides of the top cover; and
a retractable telescopic pull hand that is configured to be stored in a back pocket formed at a back side of the luggage container when the pull hand is completely retracted,
wherein:
a first opening of the first compartment and a second opening of the second compartment are directed to different directions;
the second compartment is collapsible by a third zipping mechanism formed between the first compartment and second compartment;
the luggage container is in a compact mode when the second compartment is collapsed and is in an expanded mode when the second compartment is expanded by unzipping of the third zipping mechanism;
the second compartment is configured to receive a small item sized to be placed in the collapsed second compartment when the top cover is open in the compact mode;
the back pocket has a fourth zipping mechanism; and
the pull hand is extended from the back pocket when the back pocket is open by the fourth zipping mechanism;
the second compartment comprises a passage formed on a back side of the second compartment;
the passage is concealed in the compact mode; and
the extended pull hand passes through the passage in the expanded mode.

US Pat. No. 10,555,586

FRAGRANCE BODY BAND

1. A band, comprising:a base, having a base first side and a base second side, further comprising a pair of lips located at opposing perimeter edges, each of the pair of lips is extending outward away from said base first side;
an outer cover, having a cover first side and a cover second side, said outer cover having a plurality of perforations boated thereon, said cover second side removably attachable to said base first side between said pair of ups;
wherein when said outer cover is removably attached to said base, an interior is defined;
wherein said interior is capable of retaining a substrate therein;
wherein said base and said outer cover comprises a flexible and resilient material;
wherein each of said plurality of perforations are in fluid and environmental communication with said interior;
a pair of first steps, each upstanding from a surface of said base first side and each located at an equidistant position from an individual lip;
a pair of second steps, each upstanding from a surface of said outer cover second side;
wherein when said outer cover is removably attached to said base, said interior is defined as an area defined between said base first side, said outer cover second side, said pair of first steps, and said pair of second steps;
wherein said outer cover and base are cylindrical-shaped;
wherein said band is configured to facilitate wearing about a limb or appendage of a person;
wherein said base is a silicone rubber compound;
and
wherein said outer cover is a silicone rubber compound.

US Pat. No. 10,555,585

FASTENER

BSN MEDICAL GmbH, Hambur...

1. A belt assembly closure for an orthosis comprising:(a) a first closure part having a pin and a first closure part connecting means adapted to connect to a belt of a belt assembly;
(b) a second closure part having:
(i) a coupling end, an opposing connection end, and a connecting line between the coupling end and the connection end,
(ii) a second closure part connecting means positioned on the connection end of the second closure part adapted to connect to another belt of the belt assembly,
(iii) an arcuate guide track positioned between the coupling end and the connection end and extending in a closure plane from an entrance opening to a guide track end and adapted to receive and guide the pin between the entrance opening and the guide track end along the guide track by movement perpendicular to the connecting line for a releasable connection between the first closure part and the second closure part,
(iv) the guide track entrance opening positioned between the connection end and the coupling end and formed on an edge of a first side of the second closure part, and
(v) another second closure part connecting means positioned on a second side of the connecting line opposing the first side adapted for another belt of the belt assembly;
(c) the pin having a first section proximate to the first closure part connecting means and a second section adjoining the first section and positioned on an end of the first section opposite the first closure part connecting means; and
(d) wherein dimensions of the first section of the pin perpendicular to the direction of extension of the pin correspond to the dimensions of the guide track in the closure plane at the guide track end, and dimensions of the second section of the pin perpendicular to the direction of extension of the pin are greater than the dimensions of the guide track at the guide track end so that the second section restricts movement of the pin relative to the second closure part perpendicular to the closure plane.

US Pat. No. 10,555,584

BUTTON COVER AND METHOD OF USE

1. A button cover, comprising in combination:a button cover base;
a resilient button mounting wire having a central mounting section intermediate opposed, spaced-apart bent arms extending from the central mounting section; each bent arm having a resilient button clasp arced section intermediate a curled wire end and a bent section bending transverse to the button clasp arced section; the central mounting section being mounted within the button cover base;whereby the opposed curled wire ends may resiliently spread apart when a button component moves against and into the button clasp arced section.

US Pat. No. 10,555,583

AUTOMATIC SHOE-LACING MACHINE AND METHOD FOR PROCESSING A SHOE UPPER

Pou Chen Corporation, (T...

1. An automatic shoe-lacing machine adapted for securing a shoelace onto a shoe upper, the shoelace having a flexible lace body, and two tipping members that are respectively connected to two opposite ends of the lace body, the shoe upper having two spaced-apart lace stay pieces, each of the lace stay pieces being formed with a plurality of spaced-apart eyelets, said automatic shoe-lacing machine comprising:a jig unit adapted to permit the shoe upper to be disposed thereon;
a robotic arm unit disposed at the proximity of said jig unit, said robotic arm unit being adapted to simultaneously hold and move the tipping members of the shoelace for sequentially passing the tipping members through the eyelets of the shoe upper; and
a control unit controlling the movement of said robotic arm unit;
wherein said robotic arm unit includes an arm module, and two spaced-apart grip modules that are connected to the arm module and that are for respectively holding the tipping members, said arm module and said grip modules being controlled by the control unit for sequentially passing the tipping members through the eyelets of the shoe upper;
wherein said arm module includes an upper arm mechanism, said grip modules being mounted to a distal end of said upper arm mechanism;
wherein said automatic shoe-lacing machine further comprising a machine vision unit that is for detecting the positions of the eyelets of the shoe upper; and
wherein said machine vision unit is operable to output a coordinate signal that is related to the position of at least one of the eyelets of the shoe upper, said control unit emitting a drive signal upon reception of the coordinate signal output from said machine vision unit, said upper arm mechanism of said arm module moving said grip modules to a designated position upon reception of the drive signal emitted from said control unit, and then returning a ready signal, said control unit emitting a lacing signal upon reception of the ready signal emitted from said upper arm mechanism, said upper arm mechanism cooperating with said grip modules for operating the shoelace upon reception of the lacing signal emitted from said control unit, and then returning a finish signal to said control unit.

US Pat. No. 10,555,582

SHOE CONSTRUCTIONS HAVING UPPER ASSEMBLIES WITH INDEPENDENTLY MOVABLE BOOTIES AND DECOUPLED SOLE ASSEMBLIES

Brooks Sports, Inc., Sea...

1. A shoe assembly, comprising:an upper having an exterior layer, an interior layer coupled to the exterior layer and defining an interior area configured to contain a foot of a wearer, and a throat portion defining an opening to the interior area;
a sole assembly coupled to the upper and configured to support the foot when positioned in the interior area, the sole assembly having a midsole and an outsole couple to a bottom portion of the midsole, the sole assembly having a forefoot region, a heel region and an arch region between the forefoot and heel regions, midsole and outsole defining a first portion in the forefoot region and a second portion in the heel region, wherein the first and second regions are separated by a space and are decoupled from each other forming a flex portion rearward of the forefoot portion between the first and second regions, wherein the interior layer of the upper forms a bootie connected to the exterior layer at the throat, wherein the bootie is independently movable relative to the sole assembly and at least a portion of the exterior layer;
a strapping assembly with at least one strap extending partially laterally around a midfoot region, an underfoot portion, and a heel portion of the bootie, wherein the at least one strap is movable relative to the bootie to tighten or loosen the bootie on the foot;
a plurality of retainers secured to the bootie, wherein the retainers slidably receive the strapping assembly such that the strapping assembly is movable with respect to the bootie and wherein the at least one strap is movable through the retainers to tighten or loosen the bootie on the foot; and
a shoe lace coupled to the exterior layer and to the strapping assembly, the shoe lace configured to move the strapping assembly relative to the bootie to tighten or loosen the bootie on the foot while within the exterior layer.

US Pat. No. 10,555,581

BRAIDED UPPER WITH MULTIPLE MATERIALS

Nike, Inc., Beaverton, O...

1. An article of footwear having a braided upper, comprising:a first group of tensile elements having a square cross-sectional shape and braided to form a first braided strand having a first cross-sectional area;
a second group of tensile elements having a circular cross-sectional shape and braided to form a second braided strand having a a second cross-sectional area;
wherein the first braided strand is different than the second braided strand; and
wherein the first braided strand oriented along a first direction is braided with the second braided strand oriented along a second direction at a bias relative to the first direction to form at least a region of the braided upper and wherein one of the first braided strand and the second braided strand is an axial component of the braided upper.

US Pat. No. 10,555,580

ARTICLE OF FOOTWEAR AND METHOD OF MANUFACTURING AN ARTICLE OF FOOTWEAR

NIKE, Inc., Beaverton, O...

1. An article of footwear comprising:a sole structure including a polymeric bladder element enclosing a fluid-filled interior cavity;
wherein the polymeric bladder element has:
a peripheral flange displaced from a ground-engaging surface of the sole structure and that:
surrounds the fluid-filled interior cavity; and
includes a transverse edge extending from a lateral side of the polymeric bladder element to a medial side of the polymeric bladder element;
a surface of the peripheral flange has a groove that extends continuously and generally parallel with the transverse edge from the lateral side to the medial side and with the transverse edge and the groove disposed at a midfoot region of the article of footwear;
a reduced thickness at the groove;
a first length along a longitudinal midline of the polymeric bladder element from a longitudinal extremity of the polymeric bladder element to the groove; and
a second length along the longitudinal midline of the polymeric bladder element from the longitudinal extremity to the transverse edge;
wherein the first length corresponds with a first footwear size, and the second length corresponds with a second footwear size larger than the first footwear size.

US Pat. No. 10,555,578

RAPID-ENTRY SHOE

FAST IP, LLC, Vineyard, ...

1. A rapid-entry shoe comprising:a sole having an upper surface configured to support a user's foot, an inner layer positioned below the upper surface, and two connection points, each connection point dispersed around a periphery of the sole;
an upper defining an opening adapted to receive entry of the user's foot into the shoe, the opening defining a top edge of the upper surrounding the opening;
a rear portion of the upper configured to secure the user's foot in the shoe; and
a rear flexible loop, each end thereof extending into the inner layer of the sole and directly coupled to and terminating at its respective connection point in the sole and operatively attached to the rear portion, wherein the rear flexible loop is configured to have a native position in which the rear flexible loop holds the rear portion of the shoe in a closed position securing the user's foot in the shoe and wherein the rear flexible loop may be deformed by an opening force to open the shoe to permit rapid entry of the user's foot into the shoe,
the rear flexible loop comprising at least one deformable element,
the rear flexible loop further comprising a rear bending portion extending around the rear portion of the upper, and
wherein, in response to the opening force, the rear bending portion is configured to flex independent of the at least one deformable element; wherein the at least one deformable element extends continuously from its respective connection point to the rear bending portion, the rear bending portion being positioned both rearward of the connection points and proximal the top edge of the upper of the rear portion.

US Pat. No. 10,555,577

MASSAGING BOOT ASSEMBLY

1. A massaging boot assembly being configured to massage a foot, said assembly comprising:a boot being configured to be worn on a foot, said boot having a vamp, a counter, a sole, a front quarter and a back quarter, each of said front quarter and said back quarter having a distal edge with respect to said sole to define an opening in the said boot, said boot having a cut extending between said distal edge and said sole to divide said front quarter from said back quarter;
a string being laced between each of said front quarter and said back quarter, said string being aligned with and being coextensive with said cut such that said string selectively closes said cut when said string is tightened;
a massage unit being coupled to said boot wherein said massage unit is configured to massage the foot when said boot is worn, said massage unit being selectively turned on and off, said massage unit comprising a plurality of motors, each of said motors being positioned within said boot, said motors being spaced apart from each other and being distributed along said vamp, said counter, said sole, said front quarter and said back quarter, each of said motors being electrically coupled together to form an array of motors;
a first power button being coupled to said boot wherein said power button is configured to be manipulated, said power button being electrically coupled to said array of motors such that said power button turns said array of motors on and off; and
a heating unit being coupled to said boot such that said heating unit is in thermal communication with said boot, said heating unit being selectively turned on wherein said heating unit is configured to selectively heat the foot thereby enhancing therapeutic relief of the foot, said heating unit comprising a plurality of heating elements, each of said heating elements being positioned within said boot such that each of said heating elements is in thermal communication with said boot, said heating elements being spaced apart from each other and being distributed on said vamp, said counter, said front quarter and said back quarter.

US Pat. No. 10,555,576

PROTECTIVE HOOD MADE FROM MATERIALS OF VARIABLE STRETCH KNIT AND WOVEN TEXTILES

HONEYWELL INTERNATIONAL I...

15. A protective hood for use by a firefighter or other emergency worker, the hood comprising:a crown portion to cover a top of a wearer's head;
a head portion that extends downward from the crown portion to cover at least sides and back of the wearer's head, the head portion comprising one or more layers of a first woven material;
a face opening defined by an aperture in a front of the head portion, the face opening defined at least in part by a first edge of an innermost band encircling the face opening, the innermost band comprising a one or more layers of a first knit material disposed about an elastic member;
a brow band coupled along a first edge to a second edge of the innermost band, the brow band comprising one or more layers of a second knit material;
a woven band coupled along a first edge to a second edge of the brow band, the brow band coupled along a second edge to the head portion, the woven band comprising one or more layers of a second woven material; and
a front drape and a rear drape, both of the front drape and the rear drape coupled to and extending in a downward direction from the head portion to cover at least a portion of a neck and shoulders of the wearer.

US Pat. No. 10,555,575

PROTECTIVE HEADGEAR AND SHOULDER PAD APPARATUS AND METHODS

1. An apparatus, comprising:a) a helmet component having an interior surface comprising a padding component, and an exterior surface comprising a hard, impact-resistant material,
b) a shoulder pad component structured to cover the shoulder blades of a wearer and comprising a hard shell with foam padding underneath;
c) at least one force-directing member integrated as part of at least one of the front, the back, and the top, of the shoulder pad component;
d) a plurality of piers joined said helmet component and said shoulder pad component, and extending between said helmet component and said shoulder pad component,said plurality of piers being stucturally integrated into the helmet component and extending downward beyond a lower peripheral edge of the helmet component, and each pier of said plurality of piers having an end joined to said shoulder pad component, respectively, to form a unitary engineered network effective to selectively transfer impact forces from the helmet component through the plurality of piers, and the shoulder pad component to a wearer's shoulders and body in preference to a wearer's head, neck and spine;wherein said helmet component is structured to leave sufficient space between an inner surface of the helmet component and an outer surface of a separate, padded inner hat component, when the helmet component and the inner hat component are worn by said wearer, to permit the wearer to turn his or her head up, down and from side to side within the helmet component without the helmet component itself moving.

US Pat. No. 10,555,574

SUNSHADE CAP WITH MULTIPLE RETRACTABLE SUNSHIELD MEMBERS

1. A sunshade cap, comprising:(a) a cap body comprising
a crown configured for covering the top of a wearer's head, said crown including an exterior crown surface, an interior crown surface; a front crown portion, a rear crown portion, a left crown portion, a right crown portion, a bottom crown edge, a vertex, a front centerline, and a rear centerline;
a visor extending forwardly from the front crown portion adjacent to the bottom crown edge;
(b) a left sunshield member and a right sunshield member made of flexible foldable fabric permanently attached to said crown and configured for shading the left and right side of the wearer's face and being retractable on said crown, said left and right sunshield members being mirror images of each other having a shape, and wherein the left and right sunshield members each include a first side facing outward when retracted onto said crown, a second side facing toward said crown when retracted thereon, a front edge, a top edge, a bottom edge and a rear edge;
(c) a rear sunshield member made of flexible foldable fabric permanently attached to said crown configured for shading the hack of the wearer's neck and ears and being retractable on said crown, said rear sunshield member having a shape, and including a first side facing outward when retracted onto said crown, a second side facing inward toward said crown when retracted thereon, a top edge, a bottom edge, a left edge and a right edge;
(d) a plurality of permanent fastening members that permanently attach at least a portion of the second side of each of said left, right and rear sunshield members adjacent to said left, right, and rear bottom edges respectively onto said exterior crown surface adjacent to said bottom crown edge;
wherein said left sunshield member is attached on a left side of the front crown portion as well as on the left crown portion, and said right sunshield member is attached on a right side of the front crown portion as well as on the right crown portion, and forward of any attaching positions of said rear sunshield member; whereby said left and right sunshield members drape forwardly down a left and a right side respectively of said visor where in said left and right sunshield members are configured to forwardly shade the sides of the wearer's face and cheeks during deployment, and wherein the left and right sunshield members include an angle that is also configured to provide shading to the rear portion of the wearer's face and the ears;
wherein said rear sunshield member is attached on said left and right crown portions and/or on said rear crown portion adjacent to said left and right crown portions respectively, and rearward of any attaching position of said left and right sunshield members on said crown; whereby said rear sunshield member drapes down adjacent to the rear crown portion below the bottom crown edge and is configured to shade the back of the wearer's neck during deployment;
(e) at least one detachable fastening member configured at a position on each of said left and right sunshield members, and a plurality of detachable fastening members configured at positions on said rear sunshield member that secure in a position of retraction at least one angled folded flap formed on and extending outwardly from each of said left and right sunshield members and at least two angled folded flaps formed on and extending either outwardly or inwardly from said rear sunshield member;
wherein at least one detachable fastening member is disposed on an exterior side of each of said at least one angled folded flaps formed on said left and right sunshield members for coupling with at least one of the following: at least one detachable fastening member attached to said left and right sunshield members respectively; at least one detachable fastening member attached to said rear sunshield member; and at least one detachable fastening member attached to said crown;
wherein at least one detachable fastening member is disposed on either an exterior or an interior side of each of said at least, two angled folded flaps formed on said rear sunshield member that couples with at least one of the following: at least one detachable fastening member attached to said rear sunshield member, and at least one detachable fastening member attached to said crown, thereby securing said at least two angled folded flaps in their retracted position;
wherein each of said at least one angled folded flaps on said left and right sunshield members secured by detachable fastening members includes a first fold along a first fold line that starts from a central location of said left and right sunshield members respectively and ends at said rear edge of said left and right sunshield members respectively, and a second fold, folded in an opposite direction of said first fold, along a second fold line located above said first fold line and sharing the same starting focal point as the first fold from the central location and ending at either said top edge of said left and right sunshield members respectively or said rear edge of said left and right sunshield members respectively, so that said first fold forms a flap edge that rises up starting from the focal point at an angle defined by the angle between the first and second fold lines to form an angled folded flap that extends outwardly from said left and right sunshield members, and said second fold serving as an axis that guides said angled folded flap toward its position of retraction secured by detachable fastening members;
wherein two angled folded flaps on said rear sunshield member each secured by detachable fastening members include a first fold either inwardly or outwardly along a first fold line which starts from a central location of said rear sunshield member and ends at either an edge or folded edge of said rear sunshield member, and a second fold along a second fold line located either above or below said first fold line and in the opposite direction of said first fold, and sharing the same starting focal point as the first fold from the central location and ends at an edge or folded edge, wherein the first fold creates a flap edge defined by the angle between the first and second fold line to form an angled folded flap that extends either outwardly or inwardly from said rear sunshield member depending on the direction of the fold, and said second fold serving as an axis that guides said angled folded flap toward its position of retraction secured by detachable fastening members;
(f) a plurality of detachable fastening members attached to said crown within 5.1 cm of the vertex, and a plurality of detachable fastening members attached to said left, right and rear sunshield members, that detachably attach portions of said left, right and rear sunshield members on top of said crown during retraction;
wherein at least one detachable fastening member is disposed on said crown that couples with a corresponding detachable fastening member disposed adjacent to the front edge of each of said left and right sunshield members, so that the front edge of each of said left and right sunshield members is laid along the front centerline on top of said crown and secured near the vertex dining retraction;
wherein at least one detachable fastening member is disposed on said crown that couples with at least one corresponding detachable fastening member disposed on a top portion of said rear sunshield member; wherein the configuration of said detachable fastening members on both said crown and said rear sunshield member holds down and secures one or more folds on said rear sunshield member during retraction.

US Pat. No. 10,555,573

SEAMLESS BACK BUCKLE WITH CONCEALED FITTINGS

1. A seamless back buckle, comprising:a substrate and a plurality of rows of concealed fittings disposed on the substrate; wherein the substrate further comprises a surface layer and a bottom layer, an interlayer is disposed between the surface layer and the bottom layer, and the plurality of rows of concealed fittings are disposed in the interlayer; and a through hole is formed at a position corresponding to each fitting on the surface layer, and each through hole is communicated with an interior of the interlayer; and wherein an edge of the substrate is provided with a hemming structure.

US Pat. No. 10,555,572

ATHLETIC GARMENT WITH POCKETS

1. An athletic garment, comprising:an envelope pocket being disposed along an upper portion of the athletic garment;
the envelope pocket having an outer panel and an inner panel, the outer panel comprising of a compression material and being adapted to secure an object against the inner panel;
the envelope pocket having a height defined by a bottom portion and a top portion, and a width defined by a first seam and a second seam, the outer panel being coupled with the inner panel by the first seam and the second seam and at the top portion of the envelope pocket, forming a pocket cavity;
the outer panel having a pocket opening at the bottom portion of the envelope pocket; and
wherein the first seam is positioned along a first side of the athletic garment and the second seam is positioned along a center of a rear of the athletic garment such that the width of the envelope pocket extends between the first side of the athletic garment to the center of the rear of the athletic garment.

US Pat. No. 10,555,571

BODYBUILDING COMPETITION SUIT NUMBERS TAB

6. A system for connecting a number sheet to a competition suit, comprising:a competition suit of a predetermined stretch material having a bottom portion, wherein the bottom portion is adapted to be worn around a waist of a human wearer;
an attachment point provided by the bottom portion, wherein the attachment point is located adjacent to an upper left hand side of a front portion of the waist of the human wearer when the bottom portion is worn; and
a number sheet having an elongated pin connector;
a tubular tab attached at the attachment point;
the tubular tab shaped from the predetermined stretch material to define a lumen having an inner periphery related to a length of the elongated pin connector so that the elongated pin connector may be woven in and out of the tubular tab before closing the elongated pin connector,
whereby the number sheet can be securely pinned indirectly to the competition suit without damaging the competition suit.

US Pat. No. 10,555,570

NECKWEAR FOR DISPLAYING COINS, MEDALS OR BARS

PATUGA LLC, Clarence, NY...

1. A neckwear, comprising:a neckband;
a neckband module;
at least one display segment;
at least one fastener;
a first coin, medal or bullion bar, said neckband module including a compartment containing the first coin, medal or bullion bar, and said neckband module displaying the first coin, medal or bullion bar; and
a second coin, medal or bullion bar, said at least one display segment including a compartment containing the second coin, medal or bullion bar, and said at least one display segment displaying the second coin, medal or bullion bar,
wherein said neckband directly connects to said neckband module, and said neckband module directly connects to said at least one display segment;
wherein said at least one fastener includes a first fastener, said first fastener pivotably connecting said neckband module to said at least one display segment;
wherein said first coin, medal or bullion bar and said second coin, medal or bullion bar are intra-changeable with one another; and
wherein said first coin, medal or bullion bar and said second coin, medal or bullion bar are coins, medals or bullion bars selected from the group consisting of:
(a) commemorative coins, medals or bullion bars sold by mints;
(b) precious metal coins, medals or bullion bars; and
(c) custom-designed coins, medals or bullion bars,
wherein said commemorative coins, medals or bullion bars commemorate events or honor people or organizations with achievements or deeds,
wherein said precious metal coins, medals or bullion bars comprise silver, gold or platinum, and
wherein, said custom-designed coins, medals or bullion bars are configured for the neckband module and the at least one display segment of the neckwear.

US Pat. No. 10,555,569

VOLUNTARY TEMPORARY HAND RESTRAINT GLOVE TO REDUCE A WEARERS ABILITY TO EFFECTIVELY HOLD OR USE A WEAPON

1. A device, comprising:a main body providing a thumb cavity, an index cavity, and a first cavity;
the thumb cavity dimensioned to receive an extended thumb of a human wearer;
the index cavity dimensioned to receive an extended index finger of the human wearer;
the first cavity dimensioned to receive a third finger, a fourth finger and a fifth finger of the human wearer in a first configuration;
the first cavity extending from a wrist opening to an opposing distal boundary, wherein the first cavity is enclosed at said distal boundary;
the index cavity extends beyond said distal boundary and a distal end of the thumb cavity, wherein only the index cavity extends from said distal boundary; and
a webbing extending between the index cavity and the thumb cavity.

US Pat. No. 10,555,568

PREMATURE INFANT CLOTHING

1. A patient gown comprisinga plurality of panels and a plurality of detachable fasteners;
wherein the plurality of panels are interconnected using the plurality of detachable fasteners to form a plurality of garments;
wherein the plurality of detachable fasteners removably attach one or more panels selected from the plurality of panels to form a garment selected from the plurality of garments;
wherein the patient gown is a therapeutic garment;
wherein the patient gown is configured for use with a patient;
wherein the patient is a low birthweight infant receiving medical therapy;
wherein the therapy further comprises medical tubing;
wherein each of the plurality of panels is a textile;
wherein the plurality of detachable fasteners are adjustable such that any detachable fastener selected from the plurality of detachable fasteners can be reconfigured to accommodate the insertion of the medical tubing through the selected detachable fastener;
wherein the patient gown is configured for use with a cap;
wherein each garment selected from the plurality of garment comprises one or more panels selected from the plurality of panels and one or more detachable fasteners selected from the plurality of detachable fasteners;
wherein no permanent attachments are used to assembly any garment selected from the plurality of garments;
wherein each of the plurality of detachable fasteners is a hook/loop surface;
wherein each of the plurality of garments is an article of apparel that is worn by the patient;
wherein the assembly of any garment selected from the plurality of garments allows for the medical tubing required for the care of the patient to be inserted through the selected garment at any point along any seam that joins two panels selected from the plurality of panels;
wherein the plurality of panels comprises a first panel, a second panel, a third panel, a fourth panel, a fifth panel, a sixth panel, and a seventh panel;
wherein the first panel is a textile that is cut in the shape of a cruciform;
wherein the second panel is a textile that is cut in the shape of a rectangle;
wherein the third panel is a textile that is cut in a rectilinear shape;
wherein the fourth panel is a textile that is cut in a rectilinear shape;
wherein the fifth panel is a textile that is cut in a rectilinear shape;
wherein the sixth panel is a textile that is cut in the shape of a rectangle;
wherein the seventh panel is a textile that is cut in the shape of a rectangle;
wherein the first panel is further defined with a first edge, a second edge, a third edge, a fourth edge, a fifth edge, a sixth edge, a seventh edge, and an eighth edge;
wherein the second panel is further defined with a ninth edge, a tenth edge, an eleventh edge, and a twelfth edge;
wherein the third panel is further defined with a thirteenth edge, a fourteenth edge, a fifteenth edge, a sixteenth edge, a seventeenth edge, an eighteenth edge, a nineteenth edge, a twentieth edge, a twenty-first edge, and a twenty-second edge;
wherein the fourth panel is further defined with a twenty-third edge, a twenty-fourth edge, a twenty-fifth edge, a twenty-sixth edge, a twenty-seventh edge, and a twenty-eighth edge;
wherein the fifth panel is further defined with a twenty-ninth edge, a thirtieth edge, a thirty-first edge, a thirty-second edge, a thirty-third edge, and a thirty-fourth edge;
wherein the sixth panel is further defined with a thirty-fifth edge, a thirty-sixth edge, a thirty-seventh edge, and a thirty-eighth edge;
wherein the seventh panel is further defined with a thirty-ninth edge, a fortieth edge, a forty-first edge, and a forty-second edge.

US Pat. No. 10,555,567

PROTECTIVE PAD SYSTEMS AND METHODS

1. An apparatus for preventing hyper-flexion of a joint comprising:(a) a sleeve having a first end and a second end and a first portion and a second portion;
(b) a first pad associated with the first portion of the sleeve, wherein the first pad is retained within a first covering and is selectively removable from the first covering;
(c) a second pad associated with the second portion of the sleeve, the second pad being retained within a second covering, wherein the first pad is spaced apart from the second pad by a distance;
(d) an angle of engagement, wherein the angle of engagement is a predetermined angle at which the first pad engages the second pad to resist further motion and to prevent hyper-flexion of the joint; and
wherein the first pad retained within the first covering is selectively replaceable with a first alternate pad.

US Pat. No. 10,555,566

IMPACT PROTECTION SYSTEMS

PINWREST DEVELOPMENT GROU...

1. A protection system, comprising:a) at least one interconnected mesh plate element network comprising a plurality of plate elements substantially evenly spaced from one another in an arrayed pattern, the plurality of plate elements being made from a hard plastic material; and
b) at least one liner disposed adjacent to the at least one interconnected mesh plate element network, the at least one liner being made from a different material than the plurality of plate elements,
wherein the at least one interconnected mesh plate element network includes a first interconnected mesh plate element network and a second interconnected mesh plate element network that overlap one another, and wherein the plurality of plate elements of the first interconnected mesh plate element network are disposed adjacent to and laterally offset from corresponding plate elements of the second interconnected mesh plate element network.

US Pat. No. 10,555,565

REFLECTIVE ARTICLES OF WEAR

NIKE, Inc., Beaverton, O...

1. An upper torso reflective garment comprising:a webbed structure having a plurality of apertures, wherein the webbed structure is formed from a plurality of intersecting reflective elastomeric strands, the webbed structure comprising:
(1) a front panel;
(2) a back panel; and
(3) a pair of shoulder straps that connect the front panel and the back panel;
wherein:
the front panel, the back panel, and the pair of shoulder straps define a neck opening, and a pair of armhole openings,
each aperture in the plurality of apertures comprises a shape having at least a first axis and at least a second axis,
the first axis of at least one aperture located on the back panel is oriented orthogonal to a hypothetical vertical axis,
the second axis of the at least one aperture located on the back panel is oriented parallel to the hypothetical vertical axis; and
the at least one aperture is deformable to a first degree in a direction that is parallel to the first axis and is deformable to a second degree in a direction that is orthogonal to the first axis.

US Pat. No. 10,555,564

PANTS WITH BIASING CROTCH OPENING

Tania Brady, Englewood, ...

1. An article of clothing comprising:a body-encircling portion having a right leg panel, a left leg panel, and a crotch portion;
said crotch portion has an outer perimeter with a first side, a second side, a third side, and a fourth side, said crotch portion includes a first crotch panel and a second crotch panel, said crotch portion is fastenerless, said outer perimeter is essentially in the shape of a kite when said article is in a relaxed configuration, such that the first side and the third side have a first length, wherein the second side and the fourth side have a second length, and wherein the second length is greater than the first length;
said first crotch panel has a free edge, said second crotch panel has a free edge;
wherein said first and second sides are entirely directly affixed to said first crotch panel, and wherein a portion of said third side and a portion of said fourth side are directly affixed to said first crotch panel, and wherein said first crotch panel free edge extends continuously from said third side to said fourth side;
wherein said third and fourth sides are entirely directly affixed to said second crotch panel, and wherein a portion of said first side and a portion of said second side are directly affixed to said second crotch panel, and wherein said second crotch panel free edge extends continuously from said first side to said second side; and
wherein said first and second crotch panels are configured to bias to a closed position such that said right leg panel, said left leg panel, said first crotch panel, and said second crotch panel collectively cover a user's entire crotch area when said article is worn by the user.

US Pat. No. 10,555,563

HYBRID APPAREL AND METHOD OF TRANSFORMING SAME INTO OTHER GARMENT TYPES

1. A multipurpose customizable garment comprising:a first detachable element having a first plurality of fasteners;
a second detachable element having a second plurality of fasteners, wherein the first detachable element is a first detachable sleeve, the second detachable element is a second detachable sleeve, wherein at least one of the first detachable sleeve and the second detachable sleeve is convertible into a second multipurpose customizable garment, by detachably connecting the first detachable sleeve to the second detachable sleeve selectively using at least one of the first plurality of fasteners and the second plurality of fasteners such that: (a) each of at least one end of the first detachable sleeve and of at least one end of the second detachable sleeve serves as a neckline of the second multipurpose customizable garment, (b) each of at least one other end of the first detachable sleeve and of at least one other end of the second detachable sleeve serves as hem of the second multipurpose customizable garment, (c) each of at least one top edge of the first detachable sleeve and of at least one top edge of the second detachable sleeve serves as a first sleeve of the second multipurpose customizable garment, and (d) each of at least one bottom edge of the first detachable sleeve and of at least one bottom edge of the second detachable sleeve serves as a second sleeve of the second multipurpose customizable garment.

US Pat. No. 10,555,562

GARMENT FOR BREAST SUPPORT

1. A garment that provides support to breasts on a person comprising:an upper portion with breast cups, the upper portion comprising:
a back panel, front panels, and outer breast panels, each one of the front panels structurally functions both as an inner breast panel and a front strap and each one of the front panels is comprised of a single fabric piece; each one of the outer breast panels is comprised of a double fabric piece and connects to the back panel via an outer breast panel/back panel interface; at least one inner breast panel and at least one outer breast panel are connected by a curved seam to form at least one breast cup; whereby each breast cup directs a breast volume forward and supports the breast volume from an outside of a breast to an inside of the breast.

US Pat. No. 10,555,561

ATHLETIC GARMENT WITH INTEGRAL CUP ASSEMBLY

Shock Doctor, Inc., Foun...

1. An athletic garment comprising:an upper portion having a front and a rear, a first side and a second side, an interior and an exterior, and a waistband, the upper portion being configured to receive a waist of a user;
a first leg portion extending downwardly from the upper portion and configured to receive a first leg of the user;
a second leg portion extending downwardly from the upper portion and configured to receive a second leg of the user;
a pocket disposed in the interior of the upper portion, the pocket having a first side, a second side, a top, and a bottom, and narrowing in width from the top to the bottom, the first and second sides of the pocket being partially secured to the front of the upper portion within the interior of the upper portion such that the bottom of the pocket is freely suspended from the front of the upper portion; and
an elongated member extending from the bottom of the pocket to the rear of the upper portion, wherein the elongated member forms a “Y”-shape with a first end of the elongated member corresponding to a bottom of the “Y”-shape, the first end of the elongated member directly attaching to the bottom of the pocket and extending therefrom toward the rear of the upper portion, and the elongated member branching into a second end corresponding to a top of the “Y”-shape, the second end terminating and directly attaching to the rear of the upper portion at a first location spaced apart from the waistband and terminating and directly attaching to the rear of the upper portion at a second location spaced apart from the waistband.

US Pat. No. 10,555,560

HEATER MANAGEMENT

Altria Client Services LL...

1. An aerosol-generating system comprising:a main body configured to receive an aerosol-forming substrate;
a cartridge including a heater, the cartridge configured to couple with the main body, the heater configured to heat the aerosol-forming substrate;
a power supply configured to supply a current to the heater; and
electric circuitry connected to the heater and to the power supply, the electric circuitry including a memory, the electric circuitry configured to,
detect a coupling of the cartridge to the main body,
determine an initial resistance of the heater in response to the detection of the coupling of the cartridge to the main body,
determine a subsequent resistance of the heater, and
determine a presence of an adverse condition based on a resistance change of the heater compared to a threshold value stored in the memory, the resistance change of the heater based on the determined initial resistance and the subsequent resistance.

US Pat. No. 10,555,559

ELECTRONIC VAPOR PROVISION DEVICE

Nicoventures Holdings, Li...

1. An electronic vapor provision device comprising:a liquid store;
a wicking element configured to wick liquid from the liquid store to a heating element for vaporizing the liquid;
an air outlet for vaporized liquid from the heating element; and
a heating element support configured to support the heating element, wherein the heating element is on the inside of the heating element support, and wherein the heating element support is the wicking element,
wherein the heating element support comprises a first support section and a second support section, and wherein the heating element is supported between the first support section and the second support section.

US Pat. No. 10,555,558

AEROSOL DELIVERY DEVICE PROVIDING FLAVOR CONTROL

RAI Strategic Holdings, I...

1. An aerosol delivery device, comprising:a control body;
a cartridge, comprising:
a reservoir tank configured to contain an aerosol precursor composition;
a masking disc proximate the aerosol precursor composition, the masking disc including an opening configured to the permit aerosol precursor composition to pass therethrough; and
a flavor disc proximate the masking disc, the flavor disc including two or more separate sections, wherein at least two of the sections are configured to permit the aerosol precursor composition to pass therethrough, and at least one of the sections comprises a flavor section that contains a flavorant; and
an atomizer configured to receive the aerosol precursor composition and produce an aerosol,
wherein at least one of the masking disc or the flavor disc is configured to be rotated relative to the other to align the opening of the masking disc with a selected section of the flavor disc so as to allow the aerosol precursor composition to flow from the reservoir tank through the opening of the masking disc and the selected section of the flavor disc to the atomizer such that, when the flavor section is selected, the flavorant is imparted to the aerosol precursor composition delivered to the atomizer.

US Pat. No. 10,555,557

ELECTRONIC CIGARETTE AND METHOD FOR CONTROLLING HEATING AND ATOMIZATION THEREOF

SHENZHEN SMOORE TECHNOLOG...

1. An electronic cigarette, wherein the electronic cigarette comprises a power supply device (1), a heating element (2) and a control device (3);the control device (3) is electrically connected with the power supply device (1) and the heating element (2) respectively, and the power supply device (1) supplies electric energy to the control device (3) and the heating element (2);
the control device (3) comprises:
a storage module storing a plurality of temperature variation parameters corresponding to a plurality of temperature variation curves, wherein each temperature variation curve shows a temperature variation of the heating element (2) when a liquid solution is heated with a first power, and the storage module also stores a plurality of preferable atomization temperatures corresponding to a plurality types of liquid solutions;
a temperature detection module for detecting a temperature variation of the heating element (2); and
a control module comparing the temperature variation parameters of the heating element (2) detected by the temperature detection module with the temperature variation parameters stored in the storage module, obtaining, if the type of the detected liquid solution is one of types of the liquid solution stored in the storage module, the preferable atomization temperature of the liquid solution, and controlling the heating of the liquid solution by the heating element (2) at the corresponding preferable atomization temperature.

US Pat. No. 10,555,556

CARTRIDGE FOR AN AEROSOL-GENERATING SYSTEM

Philip Morris Products S....

1. A cartridge for use in an aerosol-generating system, comprising:a liquid storage portion, comprising a housing configured to hold a liquid aerosol-forming substrate, the housing having an opening, wherein the liquid storage portion comprises at least two parts in fluid communication with each other,
a first part of the liquid storage portion comprising
a first capillary material, provided in a vicinity of the opening of the housing, and
a second capillary material in fluid contact with the first capillary material and spaced apart from the opening by the first capillary material, and
a second part of the liquid storage portion comprising a container configured to hold the liquid aerosol-forming substrate and to supply the liquid to the second capillary material.

US Pat. No. 10,555,555

AEROSOL-GENERATING ARTICLE AND ELECTRICALLY OPERATED SYSTEM INCORPORATING A TAGGANT

PHILIP MORRIS PRODUCTS S....

1. A method of controlling an aerosol-generating system,the system comprising:
an aerosol-generating article including an aerosol-forming substrate and at least one component incorporating a taggant having an identifiable spectroscopic signature within a material of the at least one component; and
an aerosol-generating device, comprising:
a cavity configured to at least partially receive the aerosol-generating article;
a power supply configured to supply power to at least one heating element to heat the aerosol-forming substrate to form an aerosol;
control circuitry connected to the power supply; and
a detector configured to detect the presence of the aerosol-generating article and to detect the identifiable spectroscopic signature of the taggant;
wherein the control circuitry is configured to distinguish the aerosol-generating article from other articles configured for use with the aerosol-generating system, based on the spectroscopic signature detected by the detector, and
wherein the taggant is distributed throughout the material,
the method comprising:
detecting, by the detector, a presence of the aerosol-generating article;
determining, by the control circuitry, whether the aerosol-generating article comprises the taggant;
comparing, by the control circuitry, the spectroscopic signature of a detected taggant with a look-up table of taggant spectroscopic signatures corresponding to aerosol-generating articles configured for use with the aerosol-generating system;
preventing, by the control circuitry, activation of the aerosol-generating device, including preventing the supply of power to the at least one heating element, unless the detected taggant spectroscopic signature corresponds to the aerosol-generating article configured for use with the aerosol-generating system; and
activating, by the control circuitry, the aerosol-generating device if the detected taggant spectroscopic signature corresponds to the aerosol-generating article configured for use with the aerosol-generating system.

US Pat. No. 10,555,554

SIMULATED CIGARETTE

KIND CONSUMER LIMITED, L...

1. A simulated cigarette having a generally cylinder-shaped cylindrical cigarette like housing with a main axis corresponding to a cylindrical axis of the cylinder shape, the housing containing a reservoir of a pressurized pressurised inhalable composition extending along a substantial portion of the housing, the reservoir having a reservoir outlet at one end which is selectively closed by an outlet valve, the outlet valve being operable to allow the composition to flow from the reservoir outlet to an inhalation outlet at the outlet end of the device; wherein the simulated cigarette further comprises a tube with a through bore extending along a substantial portion of the reservoir from the vicinity of the reservoir outlet such that composition flows into a tube bore inlet and along the tube bore to the reservoir outlet, a tube inlet end being retained such that the main axis passes through the inlet end and so that the tube bore inlet is positioned in the axial sense in the central 50% of the volume of the reservoir.

US Pat. No. 10,555,553

FILTER WITH IMPROVED HARDNESS AND FILTRATION EFFICIENCY

Philip Morris Products S....

1. A smoking article comprising:an aerosol generating substrate; and
a mouthpiece attached to the aerosol generating substrate, the mouthpiece comprising a segment comprising:
a filtration material comprising polylactic acid; and
an additive for reducing phenols;
wherein the additive comprises a mixture of triacetin with cellulose acetate flakes.

US Pat. No. 10,555,552

AEROSOL GENERATING DEVICE WITH PIERCING ASSEMBLY

Altria Client Servies LLC...

1. An electrically heated aerosol-generating device for use with a consumable cartridge comprising a storage portion containing an aerosol-forming substrate, the storage portion having a fluid permeable internal surface surrounding an open ended passage extending through the cartridge, the device comprising:a main housing having a cavity for receiving a cartridge;
a closure body engageable with the main housing to enclose the cartridge in the cavity; and
a heater assembly for heating the cartridge, the heater assembly including,
an elongate piercing assembly configured to extend into the open ended passage of the cartridge and defining an internal airflow passage forming part of an airflow pathway through the device, the elongate piercing assembly including,
a first hollow shaft portion connected to the main housing, the first hollow shaft portion having a first piercing surface at a distal end thereof, the first piercing surface configured to break through a first frangible seal across a first end of the open ended passage when the cartridge is inserted into the cavity, and
a second hollow shaft portion connected to the closure body, the second hollow shaft portion having a second piercing surface at a distal end thereof, the second piercing surface configured to break through a second frangible seal across a second end of the open ended passage when the closure body is engaged with the main housing, the first and second hollow shaft portions extending along a same longitudinal axis when the closure body is engaged with the main housing, and the first and second hollow shaft portions being sized to meet at a junction such that the elongate piercing assembly extends along an entire length of the cavity when the closure body is engaged with the main housing; and
at least one electric heater fixed to the elongate piercing assembly, the at least one electric heater having at least one heating element for heating the aerosol forming substrate when the cartridge is enclosed in the cavity.

US Pat. No. 10,555,551

TOBACCO ARTICLES AND METHODS

U.S. Smokeless Tobacco Co...

1. A method of introducing noncombusted tobacco, a noncombusted tobacco constituent or both noncombusted tobacco and a noncumbusted tobacco constituent into air, the method comprising:exposing to the atmosphere a first end portion and a second end portion of a tobacco article, the tobacco article comprising a substantially cylindrical body and tobacco, the substantially cylindrical body including a porous matrix and an outer shell surface substantially impermeable to migration of tobacco constituents, the porous matrix defining a frusto-conical channel therein, the outer shell surface at least partially surrounding the porous matrix, the tobacco being disposed in pores of the porous matrix, and the porous matrix being integrally formed with the outer shell surface; and
introducing noncombusted tobacco, a noncombusted tobacco constituent, or both noncombusted tobacco and a noncombusted tobacco constituent into air by passing the air through the pores of the porous matrix and over the tobacco disposed in the pores.

US Pat. No. 10,555,549

ROASTING DRUM OF ROASTER

1. A roasting drum comprising:a main body having
a rotating axis;
a first end;
a second end disposed opposite the first end of the main body along the rotating axis of the main body; and
multiple drums disposed along the rotating axis of the main body, mounted around one another in sequence, fastened to one another, and communicating with one another;
each one of the multiple drums having
an inner surface; and
a blending blade formed on the inner surface;
the blending blade being spiral and extending from the first end of the main body toward the second end of the main body;
the blending blade of one of the multiple drums spirally extends along a clockwise direction from the first end of the main body toward the second end of the main body;
the blending blade of another one of the multiple drums disposed within said one of the multiple drums that has the blending blade extending along the clockwise direction and spirally extending along a counter-clockwise direction from the first end of the main body toward the second end of the main body; and
at least one opening disposed on the main body; wherein
the multiple drums of the main body are two in amount;
the two drums are a first drum and a second drum;
the first drum has
a first inner surface; and
a first blending blade fixed on the first inner surface of the first drum; and
a first space disposed inside the first drum;
the second drum is mounted around the first drum and has
a second inner surface; and
a second blending blade fixed on the second inner surface of the second drum; and
a second space disposed between the first drum and the second drum; and
the first blending blade has two opposite terminal ends;
the first drum has
an entrance defined through the first inner surface of the first drum and communicating with the first space of the first drum and the second space of the second drum; and
an exit defined through the first inner surface of the first drum and communicating with the first space of the first drum and the second space of the second drum;
the entrance and the exit are respectively adjacent to the two opposite terminal ends of the first blending blade.

US Pat. No. 10,555,548

OZONE GENERATOR METHODS FOR RETROFIT OF ENCLOSED AND AIR-CONDITIONED ENVIRONMENTS

Quail Systems, LLC, Adam...

1. A method of operating a conditioned airflow ozone generator in an enclosed airspace in a previously existing conditioned airflow to extend produce and other foods shelf-life after shipment, the method comprising:sterilizing an enclosed airspace lacking produce and other foods with a conditioned airflow ozone generator placed in a previously existing conditioned airflow within the enclosed airspace, where the enclosed airspace maintains from 4 to 8 ppm ozone for a time period from 10 to 20 minutes;
placing produce and other foods within the enclosed air space;
disinfecting the produce and other foods within the enclosed airspace with the conditioned airflow ozone generator placed in the previously existing conditioned airflow, where the enclosed airspace maintains from 2 to 3.9 ppm ozone for a time period from 15 minutes to 2 hours; and
managing the produce and other foods within the enclosed airspace with the conditioned airflow ozone generator during transport of the produce and other foods, where the enclosed airspace maintains from 0.5 to 1.5 ppm ozone for a time period after termination of the disinfecting.

US Pat. No. 10,555,547

MEAT DEWATERING ASSEMBLY

Wenger Manufacturing Inc....

1. A meat dewatering assembly, comprising:a pair of elongated, non-parallel, tapered and intermeshed helically flighted screws, each screw presenting a longitudinal axis, said screws oriented with the included angle between the longitudinal axes thereof being from about 1-7°, the helical fighting of the screws cooperatively presenting nip clearances along the length of the screws;
an elongated housing at least partially surrounding said helical screws with an entrance opening for emulsified meat, a series of water outlets along at least a part of the length of the housing, and a dewatered meat outlet,
the rear end of said screws located adjacent said housing entrance, and the front end of said screws located adjacent said dewatered meat outlet, the pitch length of the helical fighting of said screws decreasing along the length of the screws between said rear and front ends;
a drive operably coupled with said screws in order to counter-rotate the screws during operation of the dewatering assembly; and
said housing configured so that as meat traverses the length of the housing the pressure within the housing is substantially atmospheric.

US Pat. No. 10,555,546

BLADE FOR SHAVING ICE

Snowie LLC, Salt Lake Ci...

1. A system for shaving ice comprising:a cabinet;
a hopper attached to said cabinet;
a drive motor disposed within said cabinet;
a stationary arcuate blade fixed relative to said cabinet, the blade comprising a plurality of slots adjacent to a plurality of corresponding teeth, wherein at least one of the plurality of corresponding teeth are offset relative to the plurality of corresponding teeth and offset relative to a centerline of the arcuate blade, wherein the centerline of the arcuate blade intersects each of the plurality of slots along an arc of the arcuate blade;
a control mechanism for activating and deactivating said drive motor;
a spout configured for dispensing conditioned ice; and
a scraper mechanically connected to said drive motor, such that when said drive motor is activated, the scraper rotates and scrapes ice against said arcuate blade thereby conditioning the ice.

US Pat. No. 10,555,545

FROZEN BEVERAGE MACHINE VALVING

Taylor Commercial Foodser...

1. A dispensing apparatus (20; 300; 400) comprising:a freezing cylinder (40);
a water flowpath (526);
a first controllable valve (130) along the water flowpath;
a syrup flowpath (528), merging with the water flowpath and proceeding as a water/syrup flowpath (552) to the freezing cylinder;
a second controllable valve (132) along the syrup flowpath; and,
a carbon dioxide flowpath (572, 574) merging with the water/syrup flowpath, the carbon dioxide flowpath comprises a branch (576) extending to the water/syrup flowpath and the freezing cylinder,
wherein the first controllable valve and the second controllable valve each comprise:
a valve body (144; 432) having a cartridge compartment (164,166), an inlet (176) to the cartridge compartment, and an outlet (178) from the cartridge compartment; and
a valve cartridge (162) having a unitary construction so as to allow removal from the valve compartment and replacement as a unit, the valve cartridge comprising:
a cartridge body (200) mounted in the cartridge compartment and having a valve seat;
a valve element (222) carried by the cartridge body and having a head shiftable between a first condition disengaged from the valve seat and permitting communication between the inlet and the outlet and a second condition engaged to the valve seat and blocking communication between the inlet and the outlet; and,
a solenoid (224) carried by the cartridge body and coupled to the valve element to drive movement of the valve element.

US Pat. No. 10,555,542

METHODS OF SEPARATING FAT FROM NON-SOY PLANT MATERIALS AND COMPOSITIONS PRODUCED THEREFROM

Specialty Protein Produce...

1. A centrifugal fat separation method of processing a non-soy plant material to produce an insoluble fiber fraction, a reduced-fat plant extract and a fat-enriched fraction, comprising:a) milling the non-soy plant material to form a flour, wherein the flour has a particle size of 100 to 1000 mesh, wherein the non-soy plant material is milled using a hammer mill, roller mill or screw-type mill and wherein the non-soy plant material is substantially full fat and has a fat content of at least 30% by weight;
b) aqueously extracting the flour at a temperature between about 80° F. and 200° F. to produce a first extract, wherein the aqueous extraction is performed without promoting emulsification;
c) centrifugally separating the fat and protein in the first extract at a temperature between about 120° F. and 180° F. using a three phase separator to produce an insoluble fiber fraction, a fat-enriched fraction, and a reduced-fat plant extract, the reduced-fat plant extract having 15% or less fat by weight, and
wherein the protein to fat ratio of the reduced-fat plant extract is at least 3 to 1, and
wherein the non-soy plant material is selected from the group consisting of canola (rapeseed), castor bean, cottonseed, flaxseed, palm kernel, linseed, candlenut, sesame seed, peanut, peanut meal, coconut, corn, corn germ, sunflower, safflower, oats, rice bran, almond, hemp seed, mustard seed, wheat and wheat germ.

US Pat. No. 10,555,540

FISH DECAPITATING APPARATUS AND A METHOD FOR DECAPITATING FISH

1. A fish decapitating apparatus, comprising:a fish holder configured to receive a fish at an in-feed station;
at least one cutting station;
a conveying apparatus configured to convey the fish in said fish holder, from the in-feed station, to said at least one cutting station;
wherein the fish holder comprises opposingly arranged guide members moveable in a hinge like manner in relation to each other;
said guide members being configured to clamp the fish head behind the collar bones such that the collar bones are resting on an outer side of said guide members from which the fish head sticks out from the fish holder, the fish decapitating apparatus further comprising:
a measuring unit configured to measure the position of the collar bones when said collar bones are resting on the outer side of said guide members; and
a control unit configured to, in accordance with said measured position of the collar bones, automatically adjust the position of said at least one cutting station.

US Pat. No. 10,555,539

CUTTING DEVICE AND A CUTTING SYSTEM FOR CUTTING FOOD PRODUCTS

MAREL ICELAND EHF, Garda...

1. A cutting device for cutting a food product that is conveyed by a conveyor means, the cutting device comprising:a first cutting blade;
a moving mechanism attached to said first cutting blade for moving the first cutting blade sideways in either direction across the conveyor means; and
a control unit;wherein said first cutting blade is adapted to cut at least one incision in the product from one side of the product;wherein said control unit is adapted to control said first cutting blade and said moving mechanism based on image data of said food product, including utilizing said image data in instructing said moving mechanism to adjust the position of said first cutting blade across said conveyor means;wherein the cutting device further comprises a second cutting blade adapted to cut at least one incision in the product from a side opposite to the side of the first cutting blade, and where the control unit is further adapted to control the second cutting blade.

US Pat. No. 10,555,538

LOIN PULLER SCRIBE SAW ASSEMBLY

Hall Fabrication, Inc., ...

1. A scribe saw assembly for a loin puller machine, comprising:a standard to drivingly support a scribe saw rotary blade;
a rotary scribe saw blade mounted on the standard for cutting a carcass middle;
a motor operatively connected to the blade for rotating the blade;
a pinion gear and a bevel gear meshingly mounted in the standard, with the motor drivingly connected to the pinion gear and the blade drivingly connected to the bevel gear; and
a shaft interconnecting the bevel gear and the blade, and a pair of bearings on the shaft to eliminate shaft deflection.

US Pat. No. 10,555,536

CROP FORTIFICATION, NUTRITION AND CROP PROTECTION COMPOSITION

1. A water dispersible granular composition comprising at least one algae and at least one of agrochemical excipient comprising at least one or more of surfactant, binder or disintegrant wherein, the weight ratio of algae to at least one of surfactant, binder or disintegrant is 99:1 to 1:99 wherein the algae comprises 0.1% to 90% by weight of the total composition, andwherein the composition has a particle size in the range of 0.1 microns to 60 microns.

US Pat. No. 10,555,526

SUBSTITUTED OXADIAZOLES FOR COMBATING PHYTOPATHOGENIC FUNGI

BASF SE, Ludwigshafen am...

1. A method for combating phytopathogenic harmful fungi, which process comprises treating the fungi or the materials, plants, the soil or seeds to be protected against fungal attack, with an effective amount of at least one compound of formula I
or an N-oxide, or an agriculturally acceptable salt thereof,
wherein:
A is phenyl or a 5- or 6-membered aromatic heterocycle, wherein the ring member atoms of the aromatic heterocycle include besides carbon atoms 1, 2, 3 or 4 heteroatoms selected from N, O and S as ring member atoms; and wherein the cyclic groups A are unsubstituted or substituted by 1, 2, 3 or 4 identical or different groups RA; wherein
RA is halogen, cyano, diC1-C6-alkylamino, C1-C6-alkyl, C1-C6-alkoxy, C1-C6-alkylthio, C1-C6-alkylsulfinyl, C1-C6-alkylsulfonyl, C2-C6-alkenyl, C2-C6-alkynyl, C3-C8-cycloalkyl or C3-C8-cycloalkoxy; and wherein any of the aliphatic or cyclic moieties are unsubstituted or substituted by 1, 2, 3, 4 or up to the maximum possible number of identical or different groups Ra; wherein
Ra is halogen, cyano, C1-C6-alkyl, C1-C6-haloalkyl, C1-C6-alkoxy, C1-C6-haloalkoxy, C1-C6-alkylthio, C1-C6-haloalkylthio or C3-C8-cycloalkyl or C1-C4-alkoxy-C1-C4-alkyl;
L is —C(?O)—, —C(?S)-or—S(?O)p—;
p is 0, 1 or 2;
R1, R2 independently of each other are hydrogen, C1-C6-alkyl, C1-C6-alkoxy, C2-C6-alkenyl, C2-C6-alkynyl, C3-C8-cycloalkyl, C3-C8-cycloalkenyl, —C(?O)—(C1-C6-alkyl), —C(?O)—(C1-C6-alkoxy), C1-C6-alkoxyimino-C1-C4-alkyl, C2-C6-alkenyloxyimino-C1-C4-alkyl, C2-C6-alkynyloxyimino-C1-C4-alkyl, aminocarbonyl-C1-C6-alkyl, C3-C6-cycloalkyl-C1-C4-alkyl, phenyl-C1-C4-alkyl, heteroaryl-C1-C4-alkyl, heterocyclyl-C1-C4-alkyl, phenyl, naphthyl or a 3- to 10-membered saturated, partially unsaturated or aromatic mono- or bicyclic heterocycle, wherein the ring member atoms of said mono- or bicyclic heterocycle include besides carbon atoms further 1, 2, 3 or 4 heteroatoms selected from N, O and S as ring member atoms and wherein 1 or 2 carbon ring member atoms of the heterocycle may be replaced by 1 or 2 groups independently selected from C(?O) and C(?S); and wherein the heteroaryl group in heteroaryl-C1-C4-alkyl is a 5- or 6-membered aromatic heterocycle, wherein the ring member atoms of the heterocyclic ring include besides carbon atoms 1, 2, 3 or 4 heteroatoms selected from N, O and S as ring member atoms; and wherein the heterocyclyl group in heterocyclyl-C1-C4-alkyl is a 3- to 10-membered saturated, partially unsaturated mono- or bicyclic heterocycle, wherein the ring member atoms of said mono- or bicyclic heterocycle include besides carbon atoms further 1, 2, 3 or 4 heteroatoms selected from N, O and S as ring member atoms and wherein 1 or 2 carbon ring member atoms of the heterocycle may be replaced by 1 or 2 groups independently selected from C(?O) and C(?S); and wherein any of the aliphatic or cyclic groups are unsubstituted or substituted by 1, 2, 3, 4 or up to the maximum possible number of identical or different groups R1a;
or R1 and R2 together with the nitrogen atom to which they are bound form a saturated or partially unsaturated mono- or bicyclic 3- to 10-membered heterocycle, wherein the heterocycle includes beside one nitrogen atom and one or more carbon atoms no further heteroatoms or 1, 2 or 3 further heteroatoms independently selected from N, O and S as ring member atoms; and wherein one or two CH2 groups of the heterocycle may be replaced by one or two groups independently selected from the group of C(?O) and C(?S); and wherein the heterocycle is unsubstituted or carries 1, 2, 3, 4 or up to the maximum possible number of identical or different groups R1a; wherein
R1a is halogen, cyano, OH, C1-C6-alkyl, C1-C6-haloalkyl, C1-C6-alkoxy, C1-C6-haloalkoxy, C3-C8-cycloalkyl, —NHSO2—C1-C4-alkyl, —(C?O)—C1-C4-alkyl, —C(?O)—C1-C4-alkoxy, C1-C6-alkylsulfonyl, hydroxyC1-C4-alkyl, —C(?O)—NH2, —C(?O)—NH(C1-C4-alkyl), C1-C4-alkylthio-C1-C4-alkyl, aminoC1-C4-alkyl, C1-C4-alkylamino-C1-C4-alkyl, diC1-C4-alkylamino-C1-C4-alkyl, aminocarbonyl-C1-C4-alkyl or C1-C4-alkoxy-C1-C4-alkyl;
R3, R4 independently of each other are hydrogen, halogen, cyano or C1-C6-alkyl; or
R3 and R4 together with the carbon atom to which they are bound form a vinyl group or a saturated, monocyclic 3- to 5-membered heterocycle or carbocycle, wherein the heterocycle includes beside carbon atoms 1 or 2 heteroatoms independently selected from N, O and S as ring member atoms; and wherein the vinyl group, the heterocycle or the carbocycle is unsubstituted or carries 1, 2, 3, 4 or up to the maximum possible number of identical or different groups R3a; wherein
R3a is halogen, cyano or C1-C2-alkyl.

US Pat. No. 10,555,521

DISPOSABLE WIPES FOR OPTIONAL DISINFECTION, DEODORIZATION, AND/OR STERILIZATION AND METHODS OF USE THEREOF

Micrulia LLC, Salt Lake ...

1. An apparatus, comprising:a wipe, comprising:
a first substrate comprising a flexible membrane;
a first chemical element, compound, or reactive substance associable with, or carried by, said first substrate;
a second chemical element, compound, or reactive substance associable with, or carried by, said first substrate, wherein:
said first substrate is structured to carry a treatment agent comprising Hydroxyl radicals formed as a product of a chemical reaction resulting from combination of said first chemical element, compound, or reactive substance and said second chemical element, compound, or reactive substance at the time of use, and at the location of use, of said first substrate to deodorize, disinfect, and/or sterilize an object; in combination with:
a holder structured to removably couple with said wipe to permit manipulation of said wipe by said holder for disinfecting, deodorizing, and/or sterilizing a surface with said wipe, and to impart an electrical charge onto said first substrate, wherein:
said first substrate carries a biocidal compound or element; and
said holder comprises a power source and circuitry structured to cause generation of areas of positive and negative electrical charge in said wipe, the power source being untethered to permit untethered operation of said wipe, the areas of positive and negative charge to attract respective gram negative and gram positive bacteria.

US Pat. No. 10,555,518

DECOY TETHERING DEVICE

1. A decoy tethering device comprising:a housing defining an interior space, said housing being disc shaped;
a line selectively extensible from and retractable into said housing, said line extending through a hole positioned in a sidewall of said housing;
a fastener selectively couplable to said line;
a coupler coupled to said housing, said coupler being configured for coupling to a keel of a decoy, said coupler comprising
an extension coupled to and extending from said sidewall of said housing,
a first arm coupled to and extending from said extension distal from said housing, said first arm being arcuate,
a second arm pivotally coupled to and extending from said extension distal from said housing, said second arm being complementary to said first arm,
a lock coupled to said extension, said lock being operationally coupled to said second arm, and
wherein said second arm is positioned for selectively pivoting to an open configuration such that said coupler is configured for inserting a ring coupled to the keel, and a closed configuration, wherein said first arm and said second arm are loopedly positioned through the ring for coupling said housing to the decoy, wherein said lock is positioned on said extension such that said lock is positioned for retaining said second arm in the closed configuration wherein said first arm and said second arm are loopedly positioned through the ring for coupling said housing to the decoy;
a connector coupled to a second end of said line, said connector being configured for coupling to a weight; and
wherein said fastener is positioned on said line such that said fastener is positioned for decoupling from said line for extending and retracting said line from said housing and for coupling to said line for retaining said line in an extended configuration, wherein said coupler is positioned on said housing such that said coupler is configured for coupling said housing to the keel of the decoy, wherein said connector is positioned on said line such that said connector is configured for coupling to the weight positioning the weight for retaining the decoy in place on a surface of a body of water in which the weight is positioned.

US Pat. No. 10,555,517

SPRAYING UNIT, COMPACT SPRAYING MODULE INCLUDING SUCH A UNIT, AND SPRAYING AND CONTROL SYSTEM INCLUDING A PLURALITY OF SUCH MODULES

PELLENC SAS, Pertuis (FR...

1. A spraying unit for the spraying of a liquid in droplet form for the treatment of a target, the spraying unit comprising:an exhaust nozzle formed by a pipe that extends along a longitudinal axis by delimiting on the inside a main inner space and being open at ends thereof to form an air inlet opening and an air outlet opening, the main inner space accommodating
at least one rotary atomizer mounted in rotation around a first axis of rotation,
a transport system configured to transport the liquid, coming from a supply system with a controlled variable flow rate, up to the rotary atomizer,
a fan that comprises at least one propeller mounted in rotation around a second axis of rotation enabling generation of a stream of carrier air in the main inner space toward and beyond the air outlet opening, and
an electric motor drive system enabling driving in rotation of said rotary atomizer and the at least one propeller,
said rotary atomizer comprising
a receiving surface configured to receive the liquid and configured to, on a periphery thereof or an end thereof, in a state of rotation of said rotary atomizer, break up the liquid into droplets and propel the droplets into the stream of carrier air and not onto an inner wall of the exhaust nozzle, the receiving surface of the rotary atomizer exclusively breaking up the liquid into the droplets, and
a connector configured to connect to an electrical energy generator to provide electrical energy to the drive system; and
an inner fuselage that has an aerodynamic profile defined by a lateral surface delimiting on the inside a secondary inner space and being kept axially in the main inner space between the fan and the air outlet opening to define, between the fuselage and the exhaust nozzle, an annular channel for circulation of the stream of carrier air surrounding said fuselage, the fuselage comprising a rotary section that is formed by the rotary atomizer such that the periphery or the end of the receiving surface essentially is part of the lateral surface of the fuselage while enabling the rotation of the rotary atomizer and the propulsion, essentially perpendicular to the longitudinal axis, of the droplets in said channel to be incorporated in the air stream.

US Pat. No. 10,555,516

BAIT CUTTING AND CRAB MEASURING APPARATUS

1. A bait cutting and crab measuring apparatus comprises:a bait-cutting channel;
a crab-measuring panel;
the bait-cutting channel comprises a first wall, a second wall, a base panel, a first plurality of segment cuts, and a second plurality of segment cuts;
the crab-measuring panel comprises a third face, a fourth face, a proximal edge, and a distal edge;
the base panel comprises a first face and a second face;
the first wall and the second wall being connected perpendicular to the first face;
the first wall and the second wall being positioned opposite to each other across the first face;
the first plurality of segment cuts traversing through the first wall, towards the base panel;
the first plurality of segment cuts being distributed along the first wall;
the second plurality of segment cuts traversing through the second wall, towards the base panel;
the second plurality of segment cuts being distributed along the second wall;
the proximal edge being connected adjacent to the base channel; and
the crab-measuring panel being positioned coplanar to the base panel.

US Pat. No. 10,555,515

ADJUSTABLE FISHING FLOAT

1. An adjustable fishing float comprising:a first female portion having an open end providing access into a cavity thereof, the cavity having a bottom opposite the open end, wherein (1) the first female portion is constructed of a rigid material, (2) the cavity is cylindrical and has a constant inside diameter, and (3) the first female portion has a narrowed portion adjacent the open end, wherein the narrowed portion has a diameter that is smaller than the diameter of the cavity;
a second male portion having a cylindrical configuration with an outside diameter that is larger than the diameter of the narrowed portion adjacent the open end of the first female portion so that it is sized to fit through and be squeezed by the narrowed portion adjacent the open end of the first portion, the second portion inserted into the first female portion defining an air space between an inner end of the second male portion and the bottom of the first female portion, the air space providing a buoyancy to the float, the second male portion having a unitary, single-piece construction, the second male portion having a solid, cylindrical configuration extending along a longitudinal axis, and the second male portion being constructed of foam, the foam second portion being resilient and deformable, and adapted to being twisted during insertion into the first female portion such that it deforms and its outside diameter temporarily is reduced to permit air to pass through the open end of the first female portion and into and out of the air space;
the first female and second male portions defining a water resistant seal adjacent the open end to prevent water from entering the air space;
the second male portion being reusably, adjustably slidable back and forth into and out of the first female portion to permit the re-adjustable alternation of size of the air space and air volume displaced by the float to change the buoyancy of the float;
wherein the second male portion has a nose with a width smaller than the outside diameter of the second male portion and a length extending along the longitudinal axis of the second male portion and protruding from a side of the second male portion in a radial direction with respect to the longitudinal axis of the second male portion;
wherein said narrowed portion adjacent the open end of the first female portion engages and squeezes a resilient deformable outer surface of the second male portion, including the nose: (1) coupling the second male portion to the first female portion, (2) sealing the air space and resisting intrusion of water, and (3) venting air out of the air space as the second male portion is moved into the cavity while twisting the second male portion and deforming the nose.

US Pat. No. 10,555,514

FLY FISHING LINE AND METHOD FOR MANUFACTURING SAME

Scientific Anglers LLP, ...

1. A fly fishing line comprising:an elongated core; and
a coating disposed around the elongated core, wherein the coating comprises a polymer resin, a co-polymer of silicone, and one or more other polymeric materials,
wherein the co-polymer of silicone is a fluorinated polydimethylsiloxane, a fluorinated polydimethylsiloxane propylhydroxy copolymer, or a combination thereof.

US Pat. No. 10,555,513

METHOD AND APPARATUS FOR MEASURING TROLL DEPTHS

1. An instrument for measuring troll depths of a line drawn through water and having a proximal line end out of the water and a weighted, distal line end in the water, the instrument accounting for a curve of the line in the water, the instrument comprising:a reference to align with the line near the proximal line end;
a length designation identifying a length of the line extending in the water between the proximal line end and the distal line end; and
a depth scale having depth markings marking the troll depths at angles relative to the reference, wherein the depth markings exhibit nonlinear angular spacings relative to the reference, the depth markings marking the troll depths of the weighted, distal line end of the line accounting for the curve of the line in the water.

US Pat. No. 10,555,512

SPINNING REEL

Shimano Inc., Osaka (JP)...

1. A spinning reel, comprising:a reel body;
a handle disposed on the reel body so as to be rotatable;
a spool shaft supported by the reel body;
a spool configured to move in an axial direction of the spool shaft together with the spool shaft;
a rotor configured to rotate about the spool by rotation of the handle and wind a fishing line around the spool;
a reciprocating mechanism configured to move the spool shaft back and forth in the axial direction when the rotation of the handle is transmitted thereto; and
a clutch mechanism configured to be switched between a transmitting state to transmit the rotation of the handle to the reciprocating mechanism and a non-transmitting state to terminate the transmission,
the reciprocating mechanism enabling the spool shaft to move in the axial direction when the clutch mechanism is in the non-transmitting state.

US Pat. No. 10,555,511

STEERABLE FISHING LURE

1. A method of redirecting a track of a fishing lure on a fishing line, the fishing lure having a body, a fishing lure longitudinal axis extending along a length of the body, a line tie extending outwardly from the body, and a re-positioning mechanism connected to the line tie, the re-positioning mechanism being activated by the fishing line,the method comprising the steps of:
(a) using a fishing pole, casting the fishing lure into a body of water;
(b) while the fishing lure is in the water, reeling in the fishing lure; and
(c) moving the line tie between a first position and a second position such that, exteriorly of the body, the only movement is of the line tie, wherein the movement of the line tie between the first position and the second position changes a direction of travel of the fishing lure during step (b); wherein the re-positioning mechanism comprises a rotor assembly located in the fishing lure, the rotor assembly being operatively coupled to the line tie, and wherein step (b) comprises rotating the rotor assembly inside the fishing lure.

US Pat. No. 10,555,510

FISH PUMPING SYSTEM AND METHOD

COOKE AQUACULTURE INC., ...

1. A fish pumping system for moving upload water and fish, comprising:a) an upload pipe section, a buffer pipe section downstream of the upload pipe section, and a fish delivery pipe section downstream of the buffer pipe section,
b) an inlet valve assembly between the upload pipe section and the buffer pipe section, and an outlet valve assembly between the buffer pipe section and the fish delivery pipe section
c) an inlet branch pipe extending from the inlet valve assembly and providing a water inlet to the inlet valve assembly, and an outlet branch pipe extending from the outlet valve assembly and providing a water outlet from the outlet valve assembly;
d) a production water reservoir; and
e) a production water piping circuit connected to said inlet branch pipe, to said outlet branch pipe, and to said production water reservoir, the production water piping circuit forming a loop with said buffer pipe section, said production water circuit comprising a pump and valves for alternatingly (i) pumping production water from said production water reservoir into said buffer pipe section through said inlet branch pipe, and (ii) pumping production water out from said buffer pipe section through said outlet branch pipe into said production water reservoir, for moving said upload water and fish from said upload pipe section through said buffer pipe section into said fish delivery pipe section.

US Pat. No. 10,555,509

NESTING CRAB TRAP

1. A nesting crab trap comprising: a top ring and a bottom ring with an outer diameter that is slightly smaller than the inner diameter of the top ring connected to each other by at least six vertical support bars; a semi-circular top bar; at least two rounded nesting supports; at least two tunnels that are each attached to two of the vertical support bars; at least two escape rings attached to the top ring; steel netting; nylon netting; and at least two cathodic bars attached to the bottom ring; wherein the round nylon netting is stretched over and securely attached to one half of the top ring and to the entire semi-circular top bar such that when the semi-circular bar is placed over the other half of the top ring, a flat nylon netting top is created; steel netting is stretched across and securely attached to the entire bottom ring and between the vertical support bars from the bottom ring to the top ring except over the two tunnels and the escape rings; steel netting is securely attached to the top, bottom and two sides of the tunnels; the interior walls of the two tunnels have inwardly rotatable prongs that allow crabs to enter but not to exit; the rounded nesting supports are attached to the vertical support bars that are not attached to entry cages such that the tops of the rounded nesting supports are at the same height as the top of the tunnels and the rounded nesting supports protrude toward the center to a diameter that is smaller than the outer diameter of the bottom ring.

US Pat. No. 10,555,505

BEEHIVE STATUS SENSOR AND METHOD FOR TRACKING PESTICIDE USE IN AGRICULTURE PRODUCTION

1. A method of monitoring the health of an insect environment and its natural ecosystem surrounding comprising:monitoring the insect environment for the presence of at least one chemical using at least one sensor located within the insect environment, the at least one sensor operative to generate data in response to the presence of at least one chemical in the environment and communicate the data to an associated data processing device;
monitoring a population of insects in the insect environment to detect a change in the population or health of individual insects that make up the population; and
generating a correlation between a detected change in the population of insects or health of the insects that make up the population in the insect environment with an increase or decrease of the at least one chemical;
monitoring one or more environments external to the insect environment with which the insect population interacts for the at least one chemical; and
taking remedial action to increase or decrease the at least one chemical in the insect environment based at least in part on the correlation between a detected change in the population or health of insects in the insect environment with an increase or decrease of the at least one chemical;
wherein the remedial action includes increasing or decreasing a concentration of the at least one chemical in the one or more environments external to the insect environment.

US Pat. No. 10,555,504

SENSOR APPARATUS AND ASSOCIATED SYSTEMS AND METHODS

ST Reproductive Technolog...

1. A sensor apparatus for attachment to an animal, comprising:a flexible enclosure formed from an upper flexible sheet and a bottom flexible sheet and having at least one interior cavity;
a retaining mechanism for securing the upper flexible sheet to the bottom flexible sheet; and
a sensor assembly disposed within the internal cavity, the sensor assembly including a pressure sensor arranged to detect pressure data representative of a physiological state of the animal.

US Pat. No. 10,555,503

ANIMAL CONTROL DEVICE

Lucas Keller, Mapleton, ...

1. An animal control device, comprising:a stem having a gripping portion at a first end and an electric prod head connected to a second end;
a paddle body connected to a hollow stem between the gripping portion and the electric prod head; and
a flap door formed from a portion of a top wall that extends from a fold line.

US Pat. No. 10,555,502

STUFFED TOY CONTAINING CAT ATTRACTANT MATERIAL

THE HARTZ MOUNTAIN CORPOR...

1. A stuffed toy, comprising:a body and a head connected to the body, the body and the head together defining an internal space and forming an exterior of the stuffed toy; and
a container at least partially filled with a cat attractant material which emits an aroma, wherein the container is irremovably disposed within the internal space of the stuffed toy,
wherein the container includes a first opening located in a portion of the internal space corresponding to the head, in a portion of the internal space corresponding to a boundary between the body and the head, or in a portion of the internal space corresponding to the body but at a vicinity of the head,
wherein the first opening of the container is configured to remain open within the internal space of the stuffed toy, and the exterior of the stuffed toy is at least partially permeable to air such that the aroma emitted from the cat attractant material is greater at the head of the stuffed toy as compared to along the body.

US Pat. No. 10,555,501

COLLAR FOR MOUNTING AROUND THE NECK OF AN ANIMAL

16. A collar for mounting around a neck of an animal, said collar including:a first part with an inside for receiving the head of said animal, said first part having a flared shape and including a peripheral flexible wall defining said flared shape, said wall extending between a first opening leading into said inside and an opposite second opening leading into said inside,
a second part joined to said first part at said second opening, said second part defining a sleeve for extending around said neck, wherein said peripheral flexible wall includes a recess extending towards said first opening and defining an enlargement of said second opening, and
a patch joined to said flexible wall and covering said recess.

US Pat. No. 10,555,500

DRINKING BUCKET

1. A drinking bucket for feeding livestock a liquid food, the drinking bucket comprising:a holding area configured to hold the liquid food and further configured to couple to at least one teat;
an activity sensor configured to detect sucking activity on the at least one teat;
an electronic control connected to the activity sensor and configured to evaluate signals from the activity sensor to obtain activity information; and
at least one of a remote data transmission apparatus configured to transmit the activity information obtained from the electronic control and a display apparatus configured to display the activity information obtained from the electronic control, wherein the electronic control is connected to the at least one of a remote data transmission apparatus and the display apparatus.

US Pat. No. 10,555,499

VEHICLE-MOUNTABLE SPREADER

Wilson Customs, Evant, T...

7. An animal feed spreader for mounting to a tow hitch of a vehicle, the animal feed spreader comprising:an annular floor frame having an inner ring defining a first aperture, the annular floor frame having at least two fastening members;
a hopper comprising sidewalls coupled to the annular floor frame, at least a portion of the sidewalls defining a funnel-shaped portion of the hopper above the annular floor frame;
a floor plate removably coupled to the annular floor frame at the at least two fastening members, the floor plate having a second aperture with a circumference that is less than half of the circumference of the first aperture;
an arm having a first end portion affixed to the floor plate and a second end portion of the arm affixed to a clamp assembly;
a motor releasably coupled to the clamp assembly with a bottom face of the motor at least 2 cm above the circumference of the second aperture, the motor having a drive shaft traversing both the bottom face of the motor and the second aperture;
a spinning plate coupled to a distal end portion of the drive shaft opposite the bottom face of the motor, the spinning plate being at least 1 cm below the circumference of the second aperture, wherein the drive shaft and the spinning plate spin when the motor is in an active running state;
a pedestal assembly coupled to the annular floor frame, the pedestal assembly encasing the spinning plate with a plurality of columnar supports and a plurality of beam supports, the plurality of columnar supports coupling the plurality of beam supports to the annular floor frame, wherein the plurality of beam supports has a generally rectilinear toroidal shape with a base that is at least 4 cm below the spinning plate; and
a hitch assembly having a proximal end portion coupled to at least one of the pedestal assembly or the annular floor frame, the hitch assembly having a distal end portion operable to couple to the tow hitch of the vehicle.

US Pat. No. 10,555,498

METHOD AND SYSTEM FOR REMOTE MONITORING, CARE AND MAINTENANCE OF ANIMALS

Botsitter, LLC, Rowlett,...

1. A system for remote care of an animal comprising:a robotic animal caregiver including:
a housing;
a wireless data communication system disposed within the housing and wirelessly communicatively coupled with an external data communications system; and
a microprocessor in communication with the wireless data communication system disposed within the housing;
an aerial drone wirelessly communicatively coupled to the wireless data communication system of the robotic animal caregiver, the aerial drone comprising a microprocessor, a wireless communication module, a video camera, the aerial drone configured to act in response to instructions issued by the microprocessor of the robotic animal caregiver; and
wherein at least one of the robotic animal caregiver and the aerial drone comprises a dispenser configured to dispense at least one of food, water, and medication according to a pre-programmed schedule.

US Pat. No. 10,555,466

MODULAR AUTOMATED GROWING SYSTEM

1. A growth system for growing vegetation, the system comprising:a plurality of modular growing units configured for supporting vegetation, wherein each of the plurality of modular growing units define a root zone and a vegetative zone;
a lighting system comprising a plurality of lighting units configured to maintain a constant intensity of light within at least two spectral regions, wherein each of the plurality of lighting units is associated with a respective modular growing unit of the plurality of the modular growing units, wherein each of the plurality of lighting units includes at least one lighting node, wherein the at least one lighting node is configured for selectively emitting one or both of a first wavelength of light from a first spectral region of the at least two spectral regions into the vegetative zone and a second wavelength of light from a second spectral region of the at least two spectral regions into the vegetative zone so as to maintain the constant intensity of light;
an unpressurized reservoir configured for housing a fluid containing one or more nutrients;
a nutrient feeding system configured for fluidly connecting each of the plurality of modular growing units to the unpressurized reservoir in parallel, wherein the nutrient feeding system includes a respective quick connect valve associated with each of the plurality of modular growing units; and
a pump in fluid communication between the unpressurized reservoir and the plurality of modular growing units, wherein the pump is configured for drawing the fluid from the unpressurized reservoir to the nutrient feeding system,
wherein when one or more of the plurality of modular growing units is connected to the respective quick connect valve, the nutrient feeding system directs the fluid to the modular growing unit,
wherein when one or more of the plurality of modular growing units is disconnected from the respective quick connect valve, the quick connect valve is configured for preventing the fluid from flowing from the unpressurized reservoir through the respective quick connect valve, and the other modular growing units connected to the nutrient feeding system remain fluidly connected to the unpressurized reservoir.

US Pat. No. 10,555,465

SINGLE STEP HYDROPONIC PLANTING CUP

1. A hydroponic planting cup system comprising:a hydroponic planting cup comprising:
a body having an outer-surface;
a hollow first-inner-volume with an inner-surface integral to the body including;
a bottom-opening configured to allow or remove nutrient solution from the hollow first-inner-volume,
an inner-opening with dimensions smaller than the bottom-opening, and
a hollow second-inner-volume configured to provide smaller dimensions with respect to the first inner-volume and in linear alignment above the hollow first-inner-volume forming a coupling through the inner-opening, the hollow second-inner-volume provides an outer-opening at the top of the body and is configured to allow a developing plant access through and outside of the body; and
at least one medium within the hollow first-inner-volume, the at least one medium having wicking and anti-fungal properties.

US Pat. No. 10,555,464

SELF-REGULATING, PLANT WATERING, INSERT ASSEMBLY FOR GROWING CONTAINERS

1. A self-regulating, wicking insert assembly for plant growing use in association with a reservoir-providing waterproof container having side wall structure between an open top end and a closed bottom end, water or water-nutrient, and grow media, said insert assembly comprising:a) a substantially planar and horizontally extending platform with a perimeter edge and a thickness dimension;
b) at least one vertically extending cylinder permanently fixed to and downwardly depending from said platform and positioned at least in part below said platform, said at least one cylinder also having an open top end, an open bottom end, a cylinder wall between said top end and said bottom end with an interior surface and an exterior surface, said cylinder wall also having small mesh openings therethrough;
c) at least some of said small mesh openings associated with said cylinder wall-positioned adjacent to said bottom end of said cylinder; and
d) gasket material outwardly depending from said perimeter edge of said platform and extending completely around said perimeter edge, said gasket material having a thickness dimension greater than said thickness dimension of said platform and extending above, below, and outwardly beyond said perimeter edge of said platform, wherein when said platform is placed into the reservoir-providing waterproof container having side wall structure between an open top end and a closed bottom end, and the reservoir-providing waterproof container has a cross-sectional configuration similar in size and shape to that of said perimeter edge of said platform, said bottom end of said at least one cylinder engages the closed bottom end of the reservoir-providing waterproof container while said gasket material engages the side wall structure of the reservoir-providing waterproof container, sealing any gaps between said perimeter edge and the side wall structure against downward movement of grow media therethrough, said at least one cylinder and said gasket material together securing said platform into a usable position within the reservoir-providing waterproof container, and when grow media is placed on and above said platform and also into said at least one cylinder, and when water or water-nutrient is placed into the reservoir-providing waterproof container below said platform, the water or water-nutrient passes through said small mesh openings and into said at least one cylinder, thereafter wicking upward into the grow media above said platform for plant growing use.

US Pat. No. 10,555,463

METHOD FOR MAINTAINING SOIL MOISTURE FOR A GARDEN VIA A SUMP PUMP

1. A method for maintaining soil moisture for a garden via a sump pump, said method comprising the steps of:installing an irrigation sump pump in a sump pit;
providing a water storage container;
connecting a first conduit to said irrigation sump pump and said water storage container, said first conduit promoting water transfer from said sump pit to said water storage container;
disposing at least one water distribution member at a predetermined area of a garden;
connecting a second conduit to said water storage container and said at least one water distribution member, said second conduit promoting water transfer from said water storage container to said at least one water distribution members;
controlling the water level in said sump pit;
controlling the high water level in said water storage container;
determining moisture level for at least one predetermined area of the garden; and
distributing water upon the at least one predetermined area of the garden when the moisture content is measured to be lower than a predetermined moisture parameter, whereby water in said sump pit is distributed upon the at least one predetermined area of the garden to increase soil moisture when a soil moisture parameter for the at least one predetermined area of the garden is determined to be below a predetermined low limit parameter.

US Pat. No. 10,555,462

AUTOMATED SPRINKLER ADJUSTMENT SYSTEM

Comcast Cable Communicati...

1. A method comprising:receiving, by a computing device, a water sensor measurement for a first sprinkler controller associated with a first geographic region;
determining, by the computing device, that the water sensor measurement satisfies a threshold;
determining a geographic association based on a geographic distance between the first geographic region and a second geographic region associated with a second sprinkler controller; and
based on the water sensor measurement satisfying the threshold and based on the geographic association, sending, by the computing device and to the second sprinkler controller, a message indicating an adjustment to a sprinkling schedule of the second sprinkler controller.

US Pat. No. 10,555,461

SYSTEMS AND METHODS FOR ESTIMATING EFFECTIVE PEST SEVERITY INDEX

Tata Consultancy Services...

1. A computer implemented method for estimating effective pest severity index, the method comprising:receiving a first set of inputs pertaining to weather associated with a geo-location under consideration;
receiving a second set of inputs pertaining to agronomic information associated with the geo-location under consideration;
generating a pest forecasting model and a natural enemies forecasting model for each pest associated with the geo-location under consideration, the pest forecasting model and the natural enemies forecasting model being based on the received first set of inputs and the second set of inputs, wherein the pest forecasting model is generated based on weather parameters derived from the first set of inputs, vegetation, soil and water indices derived from the second set of inputs, season of a year and a geographical region and wherein the natural enemies forecasting model is generated based on the pest forecasting model, the weather parameters derived from the first set of inputs, the vegetation, soil and water indices derived from the second set of inputs, the season of the year and the geographical region;
receiving participatory sensing information and crowdsourcing information associated with each pest and natural enemies in the geo-location under consideration for a period of time, wherein the participatory sensing information and crowdsourcing information comprise events from the geo-location under consideration during a life cycle of pests and natural enemies and images with geo-coordinates of pest affected areas;
dynamically updating the pest forecasting model and the natural enemies forecasting model based on the participatory sensing information and crowdsourcing information; wherein the pest forecasting model and the natural enemies forecasting model are dynamically updated based on a historical data lookup table of actual effective pest severity index detected for the corresponding first set of inputs and the second set of inputs for a given period of time; and
estimating the effective pest severity index based on the dynamically updated pest forecasting model and the natural enemies forecasting model, whereby a quantity and a timing of a pesticide application is recommended based on the estimated effective pest severity index, when the estimated effective pest severity index is greater than an Economic Threshold Level and the effective pest severity index is estimated as:
EP(n)=P(n)??NE(n),
wherein, EP(n) is Effective pest severity on nth day, P(n) is Pest severity forecasted for nth day, NE(n) is Population of Natural Enemies forecasted for nth day and a is scaling factor dependent on the season and a stage of pest as well as natural enemy.

US Pat. No. 10,555,460

AUTOMATED DRONE FOR HARVESTING PRODUCE

Amrita Vishwa Vidyapeetha...

1. A system for harvesting produce, comprising:a drone having a body, and capable of hovering flight;
a first video camera on the body of the drone gathering visual data;
global positioning system (GPS) circuitry in the drone reporting GPS position of the drone;
an articulated arm extending from the body of the drone, the arm capable of extension, retraction and lateral movement relative to the body of the drone;
a second video camera mounted at an end of the articulated arm away from the body of the drone;
a laser gun cutting implement mounted to rotate under power to sweep a laser beam around a vertical axis, the laser gun having a laser controller with a transceiver, the laser gun cutting implement mounted at the end of the articulated arm;
a remote control station having a display screen, wireless communication circuitry, and input mechanisms enabling an operator to manually enter commands to control flight movement of the drone, operation of the articulated arm, and power and movement of the laser gun cutting implement;
software executing on a processor in the remote control station;
a pre-stored flight path followed by the software, that accomplishes an automated flight path for the drone, guiding the drone to a tree having fruit to be harvested, according to a stored GPS location; and
circuitry in the body of the drone enabling two-way communication with the remote control station, transmission of video data from the video camera, and response to manually-entered commands from the remote control station;
wherein the software is configured to automatically guide the drone to a tree, cause the drone to enter an observation pattern, determine if there is produce available, and determine if the produce is ready to harvest, and wherein, if there is produce ready to harvest, the drone is guided by manually-entered commands by the operator to position the laser gun cutting implement proximate a stem supporting the produce ready to harvest, to power on the laser, and to operate the laser gun cutting implement to sweep the laser beam horizontally, cutting the supporting stem, separating the produce from the tree.

US Pat. No. 10,555,459

ADJUSTABLE SHIELD FOR A STRING TRIMMER

1. A string trimmer comprising:a line trimmer and a supplemental guard;
wherein the supplemental guard attaches to the line trimmer;
wherein the line trimmer further comprises a cutting line, a rotating head, a primary guard disk, and an extension shaft;
wherein the supplemental guard adjusts the arc of the working range of the cutting line of the line trimmer;
wherein the primary guard disk further comprises a primary open inferior face, a primary closed superior face, and a primary lateral face;
wherein the primary lateral face further comprises an open primary vertical face and a closed primary vertical face;
wherein the supplemental guard is a mechanical structure;
wherein the supplemental guard is an adjustable structure;
wherein the supplemental guard rotates relative to the line trimmer such that the supplemental guard will modify the arc of the working range of the cutting line of the line trimmer;
wherein the supplemental guard comprises a supplemental guard disk, a telescopic shaft, a plurality of universal joints, and a pipe clamp;
wherein one of the plurality of universal joints attaches the telescopic shaft to the supplemental guard disk;
wherein another of the plurality of universal joints attaches the telescopic shaft to the pipe clamp.

US Pat. No. 10,555,458

LEAF SHREDDER TRIMMER ATTACHMENT

1. A modular leaf shredder, the modular leaf shredder comprising:a housing comprising an upper portion and a lower portion, the housing comprising a plurality of interlocking housing subsections; and
a trimmer connector that is mounted on the housing and forms a physical connection with a cooperating member of a trimmer, thereby allowing the housing to physically join the trimmer;
wherein the upper portion comprises an approximately dome shaped structure arranged above the lower portion, and the lower portion comprises an approximately tubular structure, with the upper portion being tapered from a border with the lower portion towards the trimmer connector;
wherein the housing of the modular leaf shredder is fully encloses a trimmer head arranged at the end of a shaft, the trimmer head comprising a rotating head and a plurality of cutting wire sets protruding from the rotating head within the perimeter of the housing, the plurality of cutting wire sets being oriented to protrude from the rotating head at multiple angles such that a first set of cutting wires protrudes parallel to ground when the trimmer is activated, a second set of cutting wires protrudes below the first set of cutting wires, and a third set of wires protrudes above the first set of cutting wires; and
wherein the housing comprises at least one opening at a bottom edge of the housing allowing leaves to enter the housing through the at least one opening.

US Pat. No. 10,555,457

LAWN MOWER ROBOT

LG ELECTRONICS INC., Seo...

1. A lawn mower robot, comprising:an inner body;
an outer cover configured to surround an outer side of the inner body;
a plurality of blades rotatably provided on a bottom surface of the inner body to cut grass;
casters pivotably provided near front sides of the inner body to be pivotable about a rotation shaft;
wheels rotatably provided near rear sides of the inner body and configured to roll on a surface;
a driving unit configured to drive the wheels; and
a sensor unit configured to sense whether one or more of the casters is lifted off the surface to stop rotation of the wheels by the driving unit,
wherein the sensor unit includes a drop switch configured to sense a downward movement of one or more of the casters when the one or more of the casters is lifted off the surface to be suspended in air,
wherein the sensor unit includes:
a shaft supporter received in a lower portion of the inner body and configured to be movable up and down, the shaft supporter provided to surround the rotation shaft of each caster and support the rotation shaft to rotate in place; and
a lowering protrusion formed on an outer circumferential surface of the shaft supporter,
wherein, when one or more of the casters is lowered relative to the inner body, the lowering protrusion is brought into contact with the drop switch to activate the drop switch and stop rotation of the wheels.

US Pat. No. 10,555,456

AUTO MOWING SYSTEM

Positec Power Tools (Suzh...

1. A robotic mowing system comprising a station and a robotic mower, wherein the robotic mower has a controller, a memorizer, a power source and a drive motor, the memorizer configured to store a fixed working procedure and the controller configured to execute the fixed working procedure after receiving a start command input by a user so as to control the robotic mower to automatically and repeatedly mow and return to the station to be charged until the controller receives a stop command input by the user without a working parameter input by the user to define completion of mowing.

US Pat. No. 10,555,455

WORK VEHICLE WITH COMMODITY METERING SYSTEM AND AIRFLOW SYSTEM

1. A work vehicle comprising:a commodity container;
a volumetric metering assembly configured to meter a commodity by volume out from the commodity container along an axis;
a fan and an airflow structure that defines at least one air passage for an airstream at least in part from the fan, the airflow structure supported for movement relative to the volumetric metering assembly between a first position and a second position,
the airflow structure, in the first position, configured to receive units of the commodity travelling generally along the axis to be introduced into the airstream;
the airflow structure, in the second position, being spaced away from the volumetric metering assembly to provide unobstructed access to the volumetric metering assembly along the axis in an upstream direction.

US Pat. No. 10,555,454

PLANTER ROW UNIT FURROW DEPTH SENSING APPARATUS AND METHOD

1. A row unit for a seeding machine, the row unit comprising:a frame;
a first gauge wheel arm pivotally coupled to the frame;
a first gauge wheel coupled to the first gauge wheel arm;
a second gauge wheel arm pivotally coupled to the frame;
a second gauge wheel coupled to the second gauge wheel arm; and
a depth sensor having a potentiometer coupled to the first gauge wheel arm.

US Pat. No. 10,555,453

AGRICULTURAL TOOLBAR APPARATUS, SYSTEMS, AND METHODS

Precision Planting LLC, ...

1. An agricultural implement with a weight shifting system, comprising:a center section, including:
a center toolbar supported above a ground surface by a center wheel assembly, said center wheel assembly having a center wheel actuator movable between an extended position and a retracted position;
a left wing section, including:
a left inner wing toolbar having a proximal end and a distal end, said proximal end of said left inner wing toolbar pivotally coupled to said center section about a left vertical axis;
a left outer wing toolbar having a proximal end and a distal end, said proximal end of said left outer wing toolbar pivotally coupled to said distal end of said left inner wing toolbar about a left horizontal axis oriented generally parallel with the forward direction of travel;
a left wing wheel assembly supporting said distal end of said left outer wing toolbar a distance above the ground surface, said left wing wheel assembly having a left wheel actuator movable between an extended position and a retracted position;
a left wing flex actuator having a first end connected to said distal end of said left inner wing toolbar and a second end connected to said proximal end of said left outer wing toolbar, said left wing flex actuator movable between an extended position and a retracted position;
a right wing section, including:
a right inner wing toolbar having a proximal end and a distal end, said proximal end of said right inner wing toolbar pivotally coupled to said center section about a right vertical axis;
a right outer wing toolbar having a proximal end and a distal end, said proximal end of said right outer wing toolbar pivotally coupled to said distal end of said right inner wing toolbar about a right horizontal pivot axis oriented generally parallel with the forward direction of travel;
a right wing wheel assembly supporting said distal end of said right outer wing toolbar a distance above the ground surface, said right wing wheel assembly having a right wheel actuator movable between an extended position and a retracted position;
a right wing flex actuator having a first end connected to said distal end of said right inner wing toolbar and a second end connected to said proximal end of said right outer wing toolbar, said right wing flex actuator movable between an extended position and a retracted position;
a center wheel load sensor configured to measure a load carried by said center wheel assembly;
a left wheel load sensor configured to measure a load carried by said left wheel assembly;
a right wheel load sensor configured to measure a load carried by said right wheel assembly;
a monitor in signal communication with said center wheel load sensor, said left wheel load sensor, said right wheel load sensor, said monitor configured to enable an operator to select a center wheel target load, a left wheel target load, and a right wheel target load;
a fluid control system in signal communication with said monitor, said fluid control system in fluid communication with said center wheel actuator, said left wheel actuator, said right wheel actuator, said left wing flex actuator and said right wing flex actuator;
whereby, when said measured center wheel load exceeds said center wheel target load, said fluid control system shifts weight from said center section to said left and right wing sections by causing said left and right wing flex actuators to extend until said measured center wheel load approaches said center wheel target load, and;
whereby, when said measured center wheel load is less than said center wheel target load, said fluid control system shifts load from said left wing section and said right wing section to said center section by causing said left and right wing flex actuators to retract until said measured center wheel load approaches said center wheel target load.

US Pat. No. 10,555,452

ROW CLEANER/CLOSING WHEEL

10. A row cleaning wheel for mounting to a row cleaning assembly for use in operation of a row planter and adapted to remove debris, the row cleaning wheel comprising:a substantially circular body portion;
a circular center hub opening disposed at the center of the circular body portion for positioning the row cleaning wheel on a hub of a row cleaning mount assembly;
a set of holes for receiving fastening members for mounting the row cleaning wheel to a row cleaning wheel mount assembly; and
a first set of teeth arranged about the outer circumference of the circular body portion;
wherein each of the first set of teeth include a tooth body extending outward along the periphery of the first row cleaning wheel and having an essentially flat surface and a beveled surface that are relatively narrower at a distal end of the tooth and wider proximally toward the center of the row cleaning wheel, each tooth having a profile characterized by essentially parallel lines substantially along the length of the tooth body, wherein during operation of a row planter the parallel lines are essentially parallel with a ground surface when rotating and exiting the ground surface so as to deter debris and soil material from collecting on the surface of the tooth.
US Pat. No. 10,555,903

NEBULIZABLE COMPOSITIONS OF TIOTROPIUM AND FORMOTEROL

GLENMARK SPECIALTY S.A., ...

1. A dual chamber container suitable for use with a nebulizer and prefilled with a nebulizable composition, comprising in one chamber a first solution of tiotropium or a pharmaceutically acceptable salt thereof and in a second chamber a second solution of formoterol or a pharmaceutically acceptable salt thereof,wherein the first and/or second solution further comprises from about 0.1 to about 1 mg/mL of edetate disodium.
US Pat. No. 10,556,929

CYTOTOXIC T LYMPHOCYTE INDUCING IMMUNOGENS FOR PREVENTION TREATMENT AND DIAGNOSIS OF DENGUE VIRUS INFECTION

Emergex Vaccines Holding ...

1. A dengue virus vaccine comprising a peptide consisting of an amino acid sequence selected from the group consisting of VTLLCLIPTV (SEQ ID NO: 2), VTLYLGVMV (SEQ ID NO: 13), VTLVLVGIV (SEQ ID NO: 14), NIQTAINQV (SEQ ID NO: 1), TITEEIAVQ (SEQ ID NO: 3), NIQVAINQV (SEQ ID NO: 11) and NIQAAINQV (SEQ ID NO: 12), or a variant thereof having an improved ability to bind to MHC class I molecules.
US Pat. No. 10,555,904

POUCH-LIKE STRUCTURE WITH PARACRINE ACTIVITY AND METHOD FOR ITS PREPARATION

Georg-August-Universitaet...

1. A method for the preparation of a pouch-like structure suitable for enclosing at least a part of the heart of a mammal and comprising engineered tissue, said engineered tissue comprising genetically engineered cells wherein said cells contain a gene encoding a paracrine factor and said gene being under control of an inducible promoter system or a heterologous promoter system, comprising the steps ofa) providing a matrix having a recess in one surface of the matrix, said recess has appropriate dimensions to hold a defined reconstitution volume for the formation of the pouch-like structure,
b) providing a body having dimensions corresponding to the desired dimensions of the interior of the pouch-like structure to be formed, and positioning the body in said recess of the matrix such that the body is spaced from the walls of said recess to form a space between the body and the walls of the recess corresponding to the reconstitution volume needed for formation of said pouch-like structure,
c) positioning a reconstitution mixture in the recess, said reconstitution mixture comprising mammalian cells, and suitable scaffold material which can be incubated to form an engineered tissue structure comprising said cells,
d) incubating said reconstitution mixture until the tissue construct forms within the matrix recess between the body and the matrix,
e) exchanging culture medium once the pouch-like construct has formed around the body,
f) removing the body with the tissue construct adherent thereto from the matrix recess, and
g) separating the tissue construct from the body,
wherein at least a part of said mammalian cells present in the engineered tissue structure are genetically engineered cells whereby said genetically engineered cells contain a gene encoding a paracrine factor and said gene being under control of an inducible promoter system or a heterologous promoter system.
US Pat. No. 10,556,930

HOST CELLS AND METHODS FOR PRODUCING FATTY ACID-DERIVATIVES WITH HIGH BRANCHED-CHAIN PERCENTAGE

Washington University, S...

1. A transformed host cell for producing a branched-chain acyl-acyl carrier protein (acyl-ACP) comprising: a nucleic acid encoding a branched-chain ?-keto acid dehydrogenase; a nucleic acid encoding a branched-chain-specific ?-ketoacyl-[acyl-carrier-protein] synthase III; and a nucleic acid encoding a lipoyl ligase A; wherein at least one of the nucleic acids is operably linked to a nucleic acid encoding an iron sulfur cluster chaperone.
US Pat. No. 10,556,931

BROAD SPECTRUM CONJUGATE VACCINE TO PREVENT KLEBSIELLA PNEUMONIAE AND PSEUDOMONAS AERUGINOSA INFECTIONS

UNIVERSITY OF MARYLAND, B...

1. A conjugate comprising a Klebsiella pneumoniae surface polysaccharide antigen and a Pseudomonas aeruginosa flagellin protein or antigenic fragment thereof, wherein the conjugate comprises i) Pseudomonas aeruginosa flagellin type A (FlaA) or an antigenic fragment thereof and/or Pseudomonas aeruginosa flagellin type B (FlaB) or an antigenic fragment thereof and ii) OPS from Klebsiella pneumoniae selected from the group consisting of Klebsiella pneumoniae serovars 01, 02a, 03, 05.
US Pat. No. 10,557,187

MAGNESIUM-LITHIUM ALLOY, ROLLED STOCK MADE OF MAGNESIUM-LITHIUM ALLOY, AND PROCESSED PRODUCT INCLUDING MAGNESIUM-LITHIUM ALLOY AS MATERIAL

SUBARU CORPORATION, Toky...

1. A magnesium-lithium alloy that contains not less than 10.50 mass % and not more than 16.00 mass % lithium, not less than 7.20 mass % and not more than 12.00 mass % aluminum, and not less than 2.00 mass % and not more than 8.00 mass % calcium.
US Pat. No. 10,555,906

ORAL SOLID CANNABINOID FORMULATIONS, METHODS FOR PRODUCING AND USING THEREOF

GELPELL AG, Gahwil (CH) ...

1. A gelatin matrix pellet comprising a pre-defined amount of an active ingredient in hemp oil or linseed oil,wherein said active ingredient is homogenously distributed in the absence of a water-miscible solvent,
wherein said active ingredient comprises at least one synthetic, semi-synthetic or natural cannabinoid, an extract of a cannabis plant, a combination of cannabis plant constituents, or a combination thereof, said at least one cannabinoid is selected from the group consisting of Tetrahydrocannabinol (THC), Cannabidiol (CBD), Cannabinol (CBN), Cannabigerol (CBG), Cannabichromene (CBC), Cannabicyclol (CBL), Cannabivarin, (CBV), Tetrahydrocannabivarin (THCV), Cannabidivarin (CBDV), Cannabichromevarin (CBCV), Cannabigerovarin (CBGV), Cannabigerol Monomethyl Ether (CBGM), and a combination thereof, and
wherein said gelatin matrix pellet is gastro-resistant and has a preferential intestinal dissolution.
US Pat. No. 10,556,932

COMPOSITIONS AND METHODS FOR SUPPRESSION OF INHIBITOR FORMATION AGAINST COAGULATION FACTORS IN HEMOPHILIA PATIENTS

The Trustees of the Unive...

1. An isolated recombinantly produced nucleic acid encoding Factor VIII having the sequence of SEQ ID NO: 15 or a sequence having 90% identity therewith.
US Pat. No. 10,555,907

CONTROLLED-RELEASE SOLID DOSAGE FORMS OF MESALAMINE

Santarus, Inc., Bridgewa...

1. A controlled-release solid dosage form, comprising a plurality of mini-tablets, wherein each mini-tablet comprises:(a) a core, comprising mesalamine; and
(b) a coating, comprising low-viscosity ethyl cellulose; and a pore-forming agent selected from the group consisting of hydroxypropyl cellulose and hydroxypropyl methylcellulose; wherein the coating surrounds the core.
US Pat. No. 10,555,908

DOSAGE FORM ARTICLES FOR DELAYED RELEASE

Capsugel Belgium NV, Bor...

1. A comestible dosage form article for administration to a target subject, the dosage form comprising:an outer capsule comprising a first cap telescopically engageable with a first body; and
an inner capsule, within the outer capsule, comprising a second cap telescopically engageable with a second body,
the inner capsule being in an inverted position with respect to the outer capsule such that, in an assembled state, the second cap is proximal to the first body and distal to the first cap;
wherein the outer and inner capsules are sized such that substantially no compartment is present between the inner and outer capsule.
US Pat. No. 10,556,934

CRYSTAL STRUCTURE OF THE LARGE RIBOSOMAL SUBUNIT FROM S. AUREUS

Yeda Research and Develop...

1. A composition-of-matter comprising a crystallized Staphylococcus aureus 50S large ribosomal subunit, wherein the crystallized 50S large ribosomal subunit effectively diffracts X-rays for calculating an electron density map and determination of atomic coordinates to a resolution of at least 4 ? and forms in a hexagonal space group with unit cell dimensions of a=279.6±10 ?, b=279.6±10 ?, c=872.7±10 ?, ?, ?=90°, ?=120°.
US Pat. No. 10,555,909

MICROENCAPSULATION OF B-ALANINE

INNOBIO CORPORATION LIMIT...

1. A microencapsulated ?-alanine using ?-alanine as a core material and a mixture of a wall material and an additive as a release material, wherein:the additive comprises a fatty acid-based saturated or unsaturated fatty glyceride containing 12 to 22 carbon atoms and a phospholipid,
the fatty glyceride is a monoglyceride, a diglyceride, or a mixture thereof in any ratio,
a dosage of the fatty glyceride is 0.2 to 5% of a mass of the wall material; and
a dosage of the phospholipid is 0.5 to 10% of a mass of the wall material.
US Pat. No. 10,556,935

COMPOSITIONS FOR IMPROVING CELLS AND ORGANISMS

PRIMORDIAL GENETICS INC.,...

1. A nucleic acid molecule comprising:(a) the nucleotide sequence SEQ ID NO: 47;
(b) the nucleotide sequence that is complementary to the nucleotide sequence of SEQ ID NO: 47; or
(c) a nucleotide sequence encoding an amino acid sequence that is at least 90% identical to SEQ ID NO: 110.
US Pat. No. 10,555,910

OLIGONUCLEOTIDE LIPID NANOPARTICLE COMPOSITIONS, METHODS OF MAKING AND METHODS OF USING THE SAME

Ohio State Innovation Fou...

1. A method of inhibiting miRNA activity in vitro in a cell from a subject or in vivo to a cell in a subject, comprising:introducing an inhibitor composition to a location in vitro or in vivo where miRNA activity exists,
wherein the composition comprises at least one oligonucleotide encapsulated in a lipid nanoparticle;
the lipid nanoparticle being comprised of a combination of permanently ionized quaternary amine-cationic lipids and conditionally ionized tertiary amine-cationic lipids; the lipid nanoparticle having a formulation comprising at least:
quaternary amine 1,2-dioleoyl-3-dimethylammonium-propane (DOTAP);
tertiary amine 1,2-dioeyloxy-N,N-dimethyl-3-aminopropane (DODMA);
neutral lipid 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC);
helper lipid cholesterol (CHOL); and,
PEGylating agent N-(carbonyl-methoxypolyethyleneglycol 2000)-1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine (DPPE-PEG),
wherein DOTAP and DODMA each constitute 40 mol percent of the total amount of lipids in the composition, or
wherein the lipids in the composition consist of DOTAP, DODMA, DOPC, CHOL, and PEG-DPPE present in respective molar ratios of 15:25:36:20:4; and,
inhibiting miRNA activity in vitro or in vivo.
US Pat. No. 10,556,936

IMMUNOGENIC PROTEINS AND FRAGMENTS THEREOF FROM ALLERGENIC MITES

LA JOLLA INSTITUTE FOR AL...

1. A method of treating allergy in a patient, where signs and/or symptoms of said allergy are elicited in the patient by exposure to house dust mites or storage mites and/or exposure to at least one protein allergen present in house dust mites or storage mites, the method comprising administering, to the patient, a therapeutically effective amount of a polypeptide consisting of(a) an amino acid sequence of SEQ ID NO: 41 or 42, or
(b) an amino acid sequence consisting of at least or exactly 12 contiguous amino acid residues from the amino acid sequence of SEQ ID NO: 41 or 42.
US Pat. No. 10,555,911

HIGHLY PENETRATIVE NANOCARRIERS FOR TREATMENT OF CNS DISEASE

Yale University, New Hav...

1. A formulation comprising nanoparticles consisting of a core and shell which can be suspended in a pharmaceutically acceptable carrier for convection enhanced delivery (CED),wherein the core of the nanoparticles consist of biodegradable hydrophobic polymer selected from the group consisting of poly(lactic acid) (PLA), poly(lactic-co-glycolic acid) (PLGA), poly(lactic acid)-polyethyleneglycol (PLA-PEG) block copolymers, polyanhydrides, poly(ester anhydrides), polyglycolide (PGA), poly-3-hydroxybutyrate (PHB) and copolymers thereof, poly-4-hydroxybutyrate (P4HB), blends thereof and copolymers thereof, and a therapeutic, diagnostic, or prophylactic agent, and
have an average diameter of between 25 and 100 nm, and
wherein the shell is on the surface of the nanoparticle core and the shell comprises a pharmaceutically acceptable sugar selected from the group consisting of trehalose, glucose, sucrose and lactose in an amount of between 10 and 50% by mass of the nanoparticle, effective to increase penetration of the nanoparticles through brain tissue.
US Pat. No. 10,556,937

METHODS FOR THE PRODUCTION OF A COSMETIC COMPOSITION COMPRISING LEUKOLECTIN AND USES THEREOF

AQUA BIO TECHNOLOGY ASA, ...

1. A method for improving the cosmetic appearance of a scar in the skin of a mammalian animal, said method comprising administering topically to said scar an effective amount of a cosmetic composition comprising(i) a polypeptide comprising:
(a) an amino acid sequence as set forth in any one of SEQ ID NOS: 1-4 or a sequence which is at least 90% identical to said sequence; or
(b) a portion of any of said sequences comprising at least 100 contiguous amino acids of said sequence; and
(ii) one or more pharmaceutically acceptable excipients and/or diluents, thereby improving the cosmetic appearance of a scar in the skin of a mammalian animal.
US Pat. No. 10,555,912

USE OF POLYMERIC EXCIPIENTS FOR LYOPHILIZATION OR FREEZING OF PARTICLES

Abraxis BioScience, LLC, ...

1. A method of preparing a lyophilized or frozen preparation of a composition comprising particles comprising a drug, wherein the particles are liposomes or micelles, and wherein the particles are coated with polyethylene glycol (PEG), the method comprising adding polyvinyl alcohol (PVA) to an aqueous composition comprising the particles, and lyophilizing or freezing the aqueous composition.
US Pat. No. 10,556,938

COMPOSITIONS AND METHODS OF USE FOR RECOMBINANT HUMAN SECRETOGLOBINS

APC Research Assets, LLC,...

1. A method of preventing hospitalization due to a severe respiratory exacerbation in a patient with acute lung injury comprising the steps of:(a) administering recombinant human SCGB3A2 (rhSCGB3A2) protein, wherein the rhSCGB3A2 protein consists of the amino acid sequence set forth in SEQ ID NO: 3, to a patient having an acute lung injury,
wherein the patient is not re-hospitalized for at least ten months after administration of rhSCGB3A2.
US Pat. No. 10,559,757

HOST MATERIAL FOR DELAYED FLUORESCENT MATERIALS, ORGANIC LIGHT-EMITTING DEVICE AND COMPOUND

KYULUX, INC., Fukuoka (J...

1. An organic light-emitting device comprising a layer that contains a delayed fluorescent material and a host material represented by the following general formula (1):(Tr)n-Z  General Formula (1)
wherein:
Tr represents a substituted or unsubstituted triphenylenyl group, and plural Tr's existing in the general formula (1) may be the same as or different from each other; Z represents a carbonyl group or a substituted or unsubstituted, n-valent aromatic hydrocarbon group; n represents an integer of 2 to 6, but when Z is a carbonyl group, then n is 2; and the substituted n-valent aromatic hydrocarbon group is a n-valent aromatic hydrocarbon group substituted by a hydroxy group, a halogen atom, a cyano group, an alkyl group having 1 to 20 carbon atoms, an alkoxy group having 1 to 20 carbon atoms, an alkylthio group having 1 to 20 carbon atoms, an alkyl-substituted amino group having 1 to 20 carbon atoms, an acyl group having 2 to 20 carbon atoms, an aryl group having 6 to 40 carbon atoms, an alkenyl group having 2 to 10 carbon atoms, an alkynyl group having 2 to 10 carbon atoms, an alkoxycarbonyl group having 2 to 10 carbon atoms, an alkylsulfonyl group having 1 to 10 carbon atoms, a haloalkyl group having 1 to 10 carbon atoms, an amide group, an alkylamide group having 2 to 10 carbon atoms, a trialkylsilyl group having 3 to 20 carbon atoms, a trialkylsilylalkyl group having 4 to 20 carbon atoms, a trialkylsilylalkenyl group having 5 to 20 carbon atoms, a trialkylsilylalkynyl group having 5 to 20 carbon atoms, a nitro group, or a substituent represented by the following general formula (2):
Tr4-CO—  General Formula (2)wherein Tr4 represents a substituted or unsubstituted triphenylenyl group,provided that when Z is a substituted or unsubstituted, n-valent aromatic hydrocarbon group, then at least one of the following conditions is satisfied:<1> at least one Tr is a substituted triphenylenyl group, and<2> Z is the substituted aromatic hydrocarbon group, and provided that at least one of the following conditions is satisfied Z is an n-valent aromatic hydrocarbon group substituted with a substituted or unsubstituted alkyl group or a substituted or unsubstituted aryl group, Z is a carbonyl group, at least one Tr has a substituent represented by the following general formula (2):Tr4-CO—  General Formula (2)wherein Tr4 represents a substituted or unsubstituted triphenylenyl group, and at least one Tr is a triphenylenyl group substituted with a substituted or unsubstituted alkyl group or a substituted or unsubstituted aryl group.
US Pat. No. 10,555,913

CLADRIBINE REGIMEN FOR TREATING MULTIPLE SCLEROSIS

MERCK SERONO SA, Coinsin...

1. A method of treating patients suffering from multiple sclerosis and who are refractory to at least one conventional therapy for multiple sclerosis comprising administering IFN-? in combination with cladribine, wherein cladribine is orally administered following the sequential steps below:(i) An induction period wherein cladribine is administered and wherein the total dose of cladribine reached at the end of the induction period is from about 1.7 mg/kg to about 3.5 mg/kg;
(ii) A cladribine-free period wherein no cladribine is administered;
(iii) A maintenance period wherein cladribine is administered and wherein the total dose of cladribine administered during the maintenance period is lower than or equal to the total dose of cladribine reached at the end of the induction period (i); and
(iv) A cladribine-free period wherein no cladribine is administered.
US Pat. No. 10,556,939

GLUCAGON/GLP-1 AGONISTS FOR THE TREATMENT OF OBESITY

MEDIMMUNE LIMITED, Cambr...

1. A method of treating a disease or condition caused or characterized by excess body weight, comprising administering to a subject in need of treatment an effective amount of the peptide HSQGTFTSDKSEYLDSERARDFVAWLEAGG (SEQ ID NO: 19).
US Pat. No. 10,555,914

METHODS OF PRODUCING ANIONIC CANNABINOID MOLECULES DISSOLVED IN WATER

Natural Extraction System...

1. A method to solubilize a cannabinoid in water, comprising:providing a cannabinoid molecule, the cannabinoid molecule is cannabidiol and comprises an aromatic ring and a hydroxyl group, and the hydroxyl group is a substituent on the aromatic ring;
providing a Brønsted base and ethanol;
providing water;contacting the cannabinoid molecule with the Brønsted base and the ethanol to deprotonate the hydroxyl group and to produce an anionic cannabinoid molecule; anddissolving the anionic cannabinoid molecule in the water to produce a solution comprising the anionic cannabinoid molecule;
the solution comprising the anionic cannabinoid molecule has a pH of at least 8.5; and the anionic cannabinoid molecule is selected from the group consisting of:2-[(1R,6R)-6-isopropenyl-3-methylcyclohex-2-en-1-yl]-3-hydroxy-5-pentylphenolate; 2-[(1R,6R)-6-isopropenyl-3-methylcyclohex-3-en-1-yl]-3-hydroxy-5-pentylphenolate; 2-[(1R,6R)-6-isopropenyl-3-methylcyclohex-2-en-1-yl]-5-pentyl-1,4-benzoquinone-3-oxide;3-[(1R,6R)-6-isopropenyl-3-methylcyclohex-2-en-1-yl]-6-pentyl-1,2-benzoquinone-4-oxide;2-[(1R,6R)-6-isopropenyl-3-methylcyclohex-3-en-1-yl]-5-pentyl-1,4-benzoquinone-3-oxide;3-[(1R,6R)-6-isopropenyl-3-methylcyclohex-3-en-1-yl]-6-pentyl-1,2-benzoquinone-4-oxide; and(6aR,10aR)-6,6,9-trimethyl-3-pentyl-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-1-oxide.
US Pat. No. 10,556,940

T CELL RECEPTORS RECOGNIZING HLA-CW8 RESTRICTED MUTATED KRAS

The United States of Amer...

1. An isolated or purified TCR comprising:(I) an ? chain complementarity determining region (CDR) 1 comprising the amino acid sequence of SEQ ID NO: 3, an ? chain CDR2 comprising the amino acid sequence of SEQ ID NO: 4, and an ? chain CDR3 comprising the amino acid sequence of SEQ ID NO: 5; and
(II) a ? chain CDR1 comprising the amino acid sequence of SEQ ID NO: 6, a ? chain CDR2 comprising the amino acid sequence of SEQ ID NO: 7, and a ? chain CDR3 comprising the amino acid sequence of SEQ ID NO: 8.
US Pat. No. 10,555,915

METHODS FOR TREATING ACUTE ACOUSTIC TRAUMA

Hough Ear Institute, Okl...

1. A method for treating sensorineural hearing loss, comprising orally delivering to a patient in need thereof a composition comprising a pharmaceutically effective amount of 2,4-disulfonyl ?-phenyl tertiary butyl nitrone.
US Pat. No. 10,556,941

POLYPEPTIDES AND USES THEREOF FOR REDUCING CD95-MEDIATED CELL MOTILITY

1. A nucleic acid sequence encoding for a fusion protein comprising a polypeptide having an amino acid sequence having at least 96, 97, 98, 99, or 100% identity with an amino acid sequence ranging from an amino acid residue at position 175 to an amino acid residue at position 209 or 210 as set forth in SEQ ID NO: 1, wherein said polypeptide is fused to a heterologous cell-penetrating polypeptide.
US Pat. No. 10,556,942

PROCESS FOR THE PURIFICATION OF TNFR:FC FUSION PROTEIN

LUPIN LIMITED, Mumbai (I...

1. A process for purifying the TNFR:Fc fusion protein from the protein mixture comprising TNFR:Fc fusion protein and at least one HCP impurity containing protein degrading enzyme, the said process comprising:a) obtaining protein mixture from the suitable mammalian expression system comprising TNFR:Fc fusion protein and host cell protein (HCP) impurities containing at least one protein degrading enzyme;
b) applying the protein mixture to Protein A affinity chromatography column;
c) eluting the TNFR:Fc fusion protein from Protein A affinity chromatography column wherein the eluted TNFR:Fc fusion protein is present in second protein mixture containing reduced amount of HCP impurity;
d) applying the second protein mixture to Hydrophobic interaction chromatography column;
e) eluting the TNFR:Fc fusion protein from a Hydrophobic interaction chromatography column wherein the eluted TNFR:Fc fusion protein is present in third protein mixture contains reduced amount of HCP impurity;
f) applying the third protein mixture to anion exchange chromatography column;
g) eluting the TNFR:Fc fusion protein from a anion exchange chromatography column wherein the eluted protein of interest is present in fourth protein mixture containing reduced amount of HCP impurity;
h) applying the fourth protein mixture to mixed-mode chromatography column;
i) eluting the TNFR:Fc fusion protein from a mixed-mode chromatography column wherein the eluted TNFR:Fc fusion protein is substantially free of HCP impurity containing at least one of the protein degrading enzyme.
US Pat. No. 10,555,917

METHODS OF TREATING A NEUROLOGICAL OR PSYCHIATRIC DISORDER

BNIW Ventures LLC., Chic...

1. A method of treating a neurological or psychiatric disorder in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of ketamine or a pharmaceutically acceptable salt thereof in combination with an amount of one or more compounds effective to increase the level of nicotinamide adenine dinucleotide (NAD+) in the subject.
US Pat. No. 10,556,943

HLA-DR BINDING PEPTIDES AND THEIR USES

Mayo Foundation for Medic...

1. A method for eliciting an immunogenic response in a mammal, wherein the method comprises administering to the mammal a composition comprising a pharmaceutical excipient and isolated immunogenic HLA-DR binding peptides having the sequences set forth in SEQ ID NOS:86, 90, 109, and 145 such that an immunogenic response occurs in the mammal.
US Pat. No. 10,555,918

2-AMINO-N?-BENZYLIDENEACETOHYDRAZIDES AND DERIVATIVES FOR THE MANAGEMENT OF CFTR PROTEIN MEDIATED DISEASES

Emory University, Atlant...

1. A method of treating cystic fibrosis comprising administering an effective amount of ((E)-N?-(3,5-dibromo-2,4-dihydroxybenzylidene)-2-(m-tolylamino)acetohydrazide or salt thereof to a human subject diagnosed with cystic fibrosis.
US Pat. No. 10,556,944

FAB REGION-BINDING PEPTIDE

KANEKA CORPORATION, Osak...

1. A Fab region-binding peptide represented by any one of the following (1) to (3):(1) a Fab region-binding peptide having an amino acid sequence of SEQ ID NO: 1 derived from the ?1 domain of protein G with substitution of an amino acid residue at not less than one position selected from the 13th, 19th, 30th and 33rd positions, and having a higher binding force to the Fab region of immunoglobulin than that before introduction of the substitution,
wherein the amino acid residue at the 13th position is substituted by Thr or Ser,
the amino acid residue at the 30th position is substituted by Val, Leu or Ile,
the amino acid residue at the 19th position is substituted by Val, Leu or Ile,
the amino acid residue at the 33rd position is substituted by Phe;
(2) a Fab region-binding peptide having an amino acid sequence specified in the (1) with deletion, substitution and/or addition of not less than 1 and not more than 7 amino acid residues at a region other than the 13th, 19th, 30th and 33rd positions, and having a higher binding force to the Fab region of immunoglobulin than the peptide having the amino acid sequence of SEQ ID NO: 1;
wherein the position of deletion, substitution and/or addition of an amino acid residue is at least one position selected from the group consisting of the 2nd, 10th, 15th, 18th, 21st, 22nd, 23rd, 24th, 25th, 27th, 28th, 31st, 32nd, 35th, 36th, 39th, 40th, 42nd, 45th, 47th, 48th and 50th positions;
the amino acid residue at the 2nd position is substituted by Arg,
the amino acid residue at the 10th position is substituted by Arg,
the amino acid residue at the 15th position is substituted by Gln or Thr,
the amino acid residue at the 18th position is substituted by Ala,
the amino acid residue at the 21st position is substituted by Ile, Ala or Asp
the amino acid residue at the 22nd position is substituted by Asn or Glu,
the amino acid residue at the 23rd position is substituted by Thr or Asp,
the amino acid residue at the 24th position is substituted by Thr,
the amino acid residue at the 25th position is substituted by Ser or Met,
the amino acid residue at the 27th position is substituted by Asp or Gly,
the amino acid residue at the 28th position is substituted by Arg, Asn or Ile,
the amino acid residue at the 31st position is substituted by Arg,
the amino acid residue at the 32nd position is substituted by Arg,
the amino acid residue at the 35th position is substituted by Phe or Tyr,
the amino acid residue at the 36th position is substituted by Gly,
the amino acid residue at the 39th position is substituted by Leu or Ile,
the amino acid residue at the 40th position is substituted by Val or Glu,
the amino acid residue at the 42nd position is substituted by Leu, Val or Gln,
the amino acid residue at the 45th position is substituted by Phe,
the amino acid residue at the 47th position is substituted by His, Asn, Ala, Gly or Tyr,
the amino acid residue at the 48th position is substituted by Thr, and
the amino acid residue at the 50th position is substituted by Arg or Glu,
(3) a Fab region-binding peptide having an amino acid sequence having not less than 85% sequence identity to the amino acid sequence specified in the (1), and having a higher binding force to the Fab region of immunoglobulin than the peptide having the amino acid sequence of SEQ ID NO: 1, wherein the substituted amino acid residue at not less than 1 position selected from the 13th, 19th, 30th, and 33rd positions of the amino acid sequence specified in the (1) is not further mutated in the (3).
US Pat. No. 10,555,919

MELATONIN IN AUTOIMMUNE DISEASE

1. A method of reducing seasonal worsening of MS in a subject who has MS, the method comprising:identifying a subject who has a history of seasonal worsening of MS;
detecting a level of melatonin in a sample from the subject;
comparing the level of melatonin in the sample to a reference level of melatonin;
identifying the subject as having a level of melatonin below the reference level; and
administering a therapeutically effective amount of a melatonin agonist to the subject who has a level of melatonin below the reference level.
US Pat. No. 10,556,945

ANTAGONIST ANTIBODIES DIRECTED AGAINST CALCITONIN GENE-RELATED PEPTIDE AND METHODS USING SAME

Teva Pharmaceuticals Inte...

1. A method of treating or reducing incidence of headache in a subject, the method comprising:administering to the subject an amount of a monoclonal antibody that inhibits the calcitonin gene-related peptide (CGRP) pathway,
wherein the monoclonal antibody comprises a CDR H1 as set forth in SEQ ID NO:3; a CDR H2 as set forth in SEQ ID NO:4; a CDR H3 as set forth in SEQ ID NO:5; a CDR L1 as set forth in SEQ ID NO:6; a CDR L2 as set forth in SEQ ID NO:7; and a CDR L3 as set forth in SEQ ID NO:8,
wherein the monoclonal antibody is administered at a dose of about 225 mg at one month intervals, and
wherein the monoclonal antibody is formulated at a concentration of at least 150 mg/mL, thereby treating or reducing incidence of headache in the subject.
US Pat. No. 10,556,946

HUMAN DERIVED ANTI-HUNTINGTIN (HTT) ANTIBODIES AND USES THEREOF

Neurimmunie Holding AG, ...

1. A human-derived monoclonal anti-huntingtin (HTT) antibody, or an HTT-binding fragment, synthetic derivative, or biotechnological derivative thereof, wherein the antibody, or fragment or derivative thereof, comprises:(a) (i) in its variable heavy (VH) chain and variable light (VL) chain the following six complementarity determining regions (CDRs):
(1) VH-CDR1: positions 31-35 of SEQ ID NO: 173, or a variant thereof, wherein the variant comprises one or two amino acid substitutions,
(2) VH-CDR2: positions 50-66 of SEQ ID NO: 173, or a variant thereof, wherein the variant comprises one or two amino acid substitutions,
(3) VH-CDR3: positions 99-108 of SEQ ID NO: 173, or a variant thereof, wherein the variant comprises one or two amino acid substitutions,
(4) VL-CDR1: positions 23-36 of SEQ ID NO: 175, or a variant thereof, wherein the variant comprises one or two amino acid substitutions,
(5) VL-CDR2: positions 52-58 of SEQ ID NO: 175, or a variant thereof, wherein the variant comprises one or two amino acid substitutions,
(6) VL-CDR2: positions 91-101 of SEQ ID NO: 175, or a variant thereof, wherein the variant comprises one or two amino acid substitutions; or
(ii) an amino acid sequence of the VH region set forth in SEQ ID NO: 173, or an amino acid sequence that is at least 90% identical to SEQ ID NO: 173; and an amino acid sequence of the VL region set forth in SEQ ID NO: 175, or an amino acid sequence that is at least 90% identical to SEQ ID NO: 175; and
(b) wherein the antibody, fragment or derivative thereof is
(i) a fusion protein comprising a polypeptide sequence which is heterologous to the VH region or VL region, or at least one CDR; or
(ii) a non-natural variant of a polypeptide derived from an immunoglobulin, said non-natural variant comprising a heavy chain constant region that comprises one or more amino acid deletions, substitutions, or additions relative to a wild type polypeptide.
US Pat. No. 10,555,921

AMINO ACID COMPOSITIONS

ThermoLife International,...

1. An oral composition for human ingestion comprising:at least one isolated nitrate salt selected from the group consisting of a salt of an amino acid and an inorganic nitrate salt; and
at least one constituent amino acid selected from the group consisting arginine, agmatine, beta alanine, citrulline, creatine, glutamine, L-histidine, isoleucine, leucine, norvaline, ornithine, valine, aspartic acid, cysteine, glycine, lysine, methionine, proline, tyrosine, and phenylalanine,
wherein the isolated nitrate salt is a separate constituent from the at least one constituent amino acid and the oral composition is in a dosage form selected from the group consisting of a capsule, a cachet, a pill, a tablet, a pellet, a bead, a troche, a lozenge, and a gel.
US Pat. No. 10,556,947

BINDING MOLECULE THAT BINDS SPECIFICALLY TO THE PRECURSOR OF BRAIN-DERIVED NEUROTROPHIC FACTOR

Shanghai Yile Biotechnolo...

1. A method for mitigating or treating rheumatoid arthritis comprising administering to a subject in need thereof a binding molecule which specifically binds to a precursor of brain-derived neurotrophic factor, wherein the binding molecule is a monoclonal antibody comprising a heavy chain variable region having a CDR1 region with at least 95% sequence homology to SEQ ID NO: 1, a CDR2 region with at least 95% sequence homology to SEQ ID NO: 2 and a CDR3 region with at least 95% sequence homology to SEQ ID NO: 3; and a light chain variable region having a CDR1 region with at least 95% sequence homology to SEQ ID NO: 4, a CDR2 region with at least 95% sequence homology to SEQ ID NO: 5 and a CDR3 region with at least 95% sequence homology to SEQ ID NO: 6.
US Pat. No. 10,556,948

IP-10 ANTIBODIES AND THEIR USES

BRISTOL-MYERS SQUIBB COMP...

1. An isolated monoclonal antibody, or an antigen-binding portion thereof, that binds human IP-10, comprising heavy and light chain variable regions, wherein the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 16.
US Pat. No. 10,556,949

ANTIGEN-BINDING MOLECULE INDUCING IMMUNE RESPONSE TO TARGET ANTIGEN

Chugai Seiyaku Kabushiki ...

1. A method of inducing humoral immunity to a target antigen, the method comprising identifying a subject as being in need of induction of humoral immunity to the target antigen, and administering to the subject a pharmaceutical composition comprising an antibody as an active ingredient, wherein the antibody comprises an antigen-binding domain identified by (a) and an FcRn-binding domain identified by (b):(a) identification of an antigen-binding domain that comprises a complementary determining region (CDR) comprising at least one histidine residue, and has higher antigen-binding activity to the target antigen at pH 7.4 than its antigen-binding activity to the target antigen at pH 5.8;
(b) identification of an FcRn-binding domain that binds to a human FcRn at pH 7.4 and has a higher binding affinity to the human FcRn at pH 7.4 than the binding affinity of a native human IgG1 Fc region to the human FcRn at pH 7.4;
wherein, when administered to the subject, the antibody induces humoral immunity to the target antigen in the subject.
US Pat. No. 10,555,924

METHODS OF REDUCING THE RISK OF A CARDIOVASCULAR EVENT IN A SUBJECT AT RISK FOR CARDIOVASCULAR DISEASE

Amarin Pharmaceuticals Ir...

1. A method of reducing risk of unstable angina in a subject with established cardiovascular disease, the method comprising administering to said subject about 4 g of ethyl icosapentate per day for a period effective to reduce risk of unstable angina in the subject.
US Pat. No. 10,556,950

HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE DISORDERS, PROCESS FOR PRODUCING THE SAME, AND AGENT FOR TREATING OR PREVENTING COGNITIVE DISORDERS USING THE SAME

TEIJIN PHARMA LIMITED, (...

1. An anti-pSer413 tau antibody comprising:(A) (i) a variable heavy (VH) domain having an amino acid sequence of SEQ ID NO:20, and
(ii) a variable light (VL) domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(B) (i) a VH domain having an amino acid sequence of SEQ ID NO:22, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(C) (i) a VH domain having an amino acid sequence of SEQ ID NO:24, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(D) (i) a VH domain having an amino acid sequence of SEQ ID NO:26, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(E) (i) a VH domain having an amino acid sequence of SEQ ID NO:28, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(F) (i) a VH domain having an amino acid sequence of SEQ ID NO:116, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114; or
(G) (i) a VH domain having an amino acid sequence of SEQ ID NO:117, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114.
US Pat. No. 10,555,925

METHODS OF REDUCING THE RISK OF A CARDIOVASCULAR EVENT IN A SUBJECT AT RISK FOR CARDIOVASCULAR DISEASE

Amarin Pharmaceuticals Ir...

1. A method of reducing risk of stroke in a subject with established cardiovascular disease, the method comprising administering to said subject about 4 g of ethyl icosapentate per day for a period effective to reduce risk of stroke in the subject.
US Pat. No. 10,556,951

ANTI-CD33 ANTIBODIES AND IMMUNOCONJUGATES

Genentech, Inc., South S...

1. An isolated antibody that binds to CD33, wherein the antibody comprises:(i) (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:39; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:40; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:41; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:36; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:37; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:38;
(ii) (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:45; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:46; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:47; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:42; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:43; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:44;
(iii) (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:45; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:51; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:52; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:48; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:49; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:50;
(iv) (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:56; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:57; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:58; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:53; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:54; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:55; or
(v) (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:62; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:64; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:59; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:60; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:61.
US Pat. No. 10,555,926

USE OF CABAZITAXEL IN THE TREATMENT OF PROSTATE CANCER

Erasmus University Medica...

1. A method of treating a patient suffering from prostate cancer comprising determining the androgen receptor mRNA splice variant 7 (AR-V7)-status in said patient and administering a therapeutically effective amount of cabazitaxel in base form or in the form of an hydrate or a solvate, to an AR-V7-positive patient, in combination with a corticoid.
US Pat. No. 10,556,952

HEAVY CHAIN CONSTANT REGIONS WITH REDUCED BINDING TO FC GAMMA RECEPTORS

Regeneron Pharmaceuticals...

1. An immunoglobulin heavy chain comprising a constant region, wherein amino acid positions 233-236 of a hinge domain are G, G, G and unoccupied; G, G, unoccupied, and unoccupied; G, unoccupied, unoccupied, and unoccupied; or all unoccupied, with amino acid positions numbered by EU numbering.
US Pat. No. 10,555,927

COMPOSITIONS AND METHODS FOR ENHANCING SEXUAL PLEASURE AND PERFORMANCE

ILYSM, LLC, Murray, UT (...

1. A method of treating sexual dysfunction in a human in need thereof comprising:a) administering orally by ingestion which is not smoking or applying topically to said human in need thereof a therapeutically effective amount of a cannabinoid component comprising at least one of tetrahydrocannabinol and cannabidiol;
b) administering orally by ingestion which is not smoking or applying topically to said human in need thereof a therapeutically effective amount of a sexual response component selected from the group consisting of sildenafil, tadalafil, and vardenafil; and
c) the cannabinoid component and the sexual response component effectively treating said sexual dysfunction in said human in need thereof.
US Pat. No. 10,556,953

AGENT CAPABLE OF DEPLETING CD8 T CELLS FOR THE TREATMENT OF MYOCARDIAL INFARCTION OR ACUTE MYOCARDIAL INFARCTION

1. A method for treating myocardial infarction (MI) or acute myocardial infarction (AMI) in a subject in need thereof comprising the step of administering to said subject within 14 days of the infarction a therapeutically effective amount of an anti-CD8 antibody capable of depleting CD8 T cells.
US Pat. No. 10,555,928

CANNABIS EXTRACTS AND METHODS OF PREPARING AND USING SAME

United Cannabis Corp., G...

1. A method for relieving symptoms associated with anxiety, post traumatic stress disorder, chronic pain, or opiate dependency, paralysis, neuropathy, Crohns disease, inflammatory bowel disorders, glaucoma, seizures, epilepsy, autism, or cancer comprising administering to a subject at least four daily doses of a cannabinoid formulation, wherein at least two of the at least four daily doses comprise different cannabinoid formulations selected from the group of cannabinoid formulations consisting of:a. a formulation wherein at least 95% of the total cannabinoids in the formulation is tetrahydrocannabinolic acid (THCa);
b. a formulation wherein at least 95% of the total cannabinoids in the formulation is tetrahydrocannabinol (THC);
c. a formulation wherein at least 95% of the total cannabinoids in the formulation is cannabidiol (CBD);
d. a formulation wherein at least 95% of the total cannabinoids in the formulation are THCa and cannabidiolic acid (CBDa);
e. a formulation wherein at least 95% of the total cannabinoids in the formulation are THC and CBD;
f. a formulation wherein at least 95% of the total cannabinoids in the formulation are CBD, cannabinol (CBN) and THC;
g. a formulation wherein at least 95% of the total cannabinoids in the formulation is cannabidiol (CBDa);
h. a formulation wherein at least 95% of the total cannabinoids in the formulation is cannabichromene (CBC);
i. a formulation wherein at least 95% of the total cannabinoids in the formulation is cannabichromenic acid (CBCa);
j. a formulation comprising at least 95% tetrahydrocannabinol (THC) as the only cannabinoid in the formulation; and
k. a formulation wherein at least 95% of the total cannabinoids in the formulation is tetrahydrocannabinol (THC) from cannabis indica or cannabis ruderalis.
US Pat. No. 10,556,954

ANTI-PD-L1 NANOBODY, CODING SEQUENCE AND USE THEREOF

NANOMAB TECHNOLOGY LIMITE...

1. A VHH chain of an anti-PD-L1 nanobody, wherein the amino acid sequence of the VHH chain is shown in any one of SEQ ID NOs.: 18, 9, 63, 1, 12, 45, 70, 20, 74, and 50.
US Pat. No. 10,557,978

COMPOSITION, OPTICAL FILM INCLUDING COMPOSITION, AND METHOD OF PRODUCING OPTICAL FILM

SUMITOMO CHEMICAL COMPANY...

1. A composition comprising smectic liquid crystal compounds, each having a 1,4-cyclohexyl group,wherein the composition contains 0.1 parts by mass to 10 parts by mass of a smectic liquid crystal compound having a cis-1,4-cyclohexyl group relative to 100 parts by mass of a smectic liquid crystal compound having a trans-1,4-cyclohexyl group,
the smectic liquid crystal compound having the trans-1,4-cyclohexyl group and the smectic liquid crystal compound having the cis-1,4-cyclohexyl group are represented by the following formula (1-1) and formula (2-1), respectively:
P1-F1-B1-CyH-G1-E1-G2-E2-B2-F2-P2  (1-1)
P1-F1-B1-CyH?-G1-E1-G2-E2-B2-F2-P2  (2-1)
wherein in each of the formulas (1-1) and (2-1):
P1 and P2 each independently represent a polymerizable group, P1 in the formula (1-1) and P1 in the formula (2-1) are identical groups, and P2 in the formula (1-1) and P2 in the formula (2-1) are identical groups;
at least one of F1 and F2 represents a C6-C12 linear alkanediyl group, a hydrogen atom contained in the alkanediyl group can be substituted by a halogen atom, and —CH2— contained in the alkanediyl group can be substituted by —O—, F1 in the formula (1-1) and F1 in the formula (2-1) are identical groups, and F2 in the formula (1-1) and F2 in the formula (2-1) are identical groups;
B1 and B2 each independently represent a single bond or a bivalent linking group, B1 in the formula (1-1) and B1 in the formula (2-1) are identical groups, and B2 in the formula (1-1) and B2 in the formula (2-1) are identical groups;
CyH represents a substituted or unsubstituted trans-1,4-cyclohexyl group;
CyH' represents a substituted or unsubstituted cis-1,4-cyclohexyl group;
G1 and G2 each independently represent a single bond or a bivalent linking group, G1 in the formula (1-1) and G1 in the formula (2-1) are identical groups, and G2 in the formula (1-1) and G2 in the formula (2-1) are identical groups; and
E1 and E2 each independently represent a group selected from a substituted 1,4-phenyl group, an unsubstituted 1,4-phenyl group, a substituted trans-1,4-cyclohexyl group, and an unsubstituted trans-1,4-cyclohexyl group, E1 in the formula (1-1) and E1 in the formula (2-1) are identical groups, and E2 in the formula (1-1) and E2 in the formula (2-1) are identical groups.
US Pat. No. 10,556,955

METHOD FOR PURIFYING ACTIVE POLYPEPTIDES OR IMMUNOCONJUGATES

MedImmune Limited, Cambr...

1. A method of treating a B cell malignancy comprising intravenously administering to a subject in need of treatment for a B cell malignancy a composition comprising a purified protein comprising the VH-PE38 subunit of SEQ ID NO: 1 and the VL subunit of SEQ ID NO: 2, wherein the composition comprises less than 25% deamidated species of the protein, and wherein said administration is at a dose of 20-50 ?g/kg per day.
US Pat. No. 10,556,956

PHARMACEUTICAL COMPOSITIONS COMPRISING HUMANIZED ANTI-CCR4 IGG4 ANTIBODY

DANA-FARBER CANCER INSTIT...

1. A pharmaceutical composition comprising a humanized anti-CCR4 antibody in an amount effective to increase the ratio of effector T-cells to regulatory T-cells in or associated with a tumor present in a human subject to whom the pharmaceutical composition is administered one or more times,wherein the regulatory T-cells comprise CD4+ CD25highCD127dim/? Tregs and the effector T-cells comprise CD4+ CD25? Teffs,
wherein the humanized anti-CCR4 antibody has a heavy chain with three CDRs comprising the amino acid sequences GYTFASAW (SEQ ID NO: 9), INPGNVNT (SEQ ID NO: 11), and STYYRPLDY (SEQ ID NO: 13) respectively and a light chain with three CDRs comprising the amino acid sequences QSILYSSNQKNY (SEQ ID NO: 10), WASTRE (SEQ ID NO: 12), and HQYMSSYT (SEQ ID NO: 14) respectively, and
wherein the humanized anti-CCR4 antibody has an IgG4 heavy chain constant region.
US Pat. No. 10,557,212

ELECTROPOLISHING METHOD AND PRODUCT

Chemeon Surface Technolog...

1. A method for electropolishing an aluminum substrate comprising:submerging at least part of the aluminum substrate in an electrolyte solution comprising:
phosphoric acid;
at least one hydroxyalkyl (meth)acrylate monomer and/or hydroxyalkyl (meth)acrylate polymer;
supplying electrical current to the aluminum substrate from a power supply;
wherein the aluminum substrate is electrically coupled to a positive terminal of the power supply.
US Pat. No. 10,555,931

PHARMACEUTICAL COMBINATION FOR THE TREATMENT OF CANCER

PIRAMAL ENTERPRISES LIMIT...

1. A method of treating cancer comprising administering to a subject in need thereof voruciclib in a therapeutically effective amount to treat cancer, and a thioredoxin reductase inhibitor in a therapeutically effective amount to treat cancer, wherein:the cancer is selected from head and neck cancer, lung cancer, gastrointestinal cancer, blood or lymphatic system cancer, and breast cancer; and
the thioredoxin reductase inhibitor is selected from auranofin, ebselen, and arsenic trioxide.
US Pat. No. 10,556,957

ANTI-CD27 ANTIBODIES

1. An antibody or antigen binding fragment thereof that binds to human CD27, wherein the antibody or antigen binding fragment comprises:a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1, wherein X1=M;
a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2, wherein X1=N, X2=T, X3=N and X4=T;
a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, wherein X1=M;
a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4, wherein X1=M;
a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, wherein X1=D and X2=T; and
a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, wherein X1=W, X2=N and X3=S.
US Pat. No. 10,555,932

METHOD OF RESTORING ANALGESIC EFFICACY OF ALPHA2-ADRENOCEPTOR AGONISTS IN NEUROPATHIC PAIN TREATMENT

KOREA INSTITUTE OF SCIENC...

1. A method of relieving chronic neuropathic pain of a subject, the method comprising:administering 0.1 to 200 ?g/kg of an alpha 2 (?2)-adrenoceptor agonist to the subject in need thereof; and
administering an effective amount of an inhibitor selected from an inhibitor of a regulator of a G-protein signaling (RGS), an endocytosis inhibitor, or a combination thereof to the subject in need thereof,
wherein an effective amount of the inhibitor causes the administered alpha 2 (?2)-adrenoceptor agonist to relieve the chronic neuropathic pain,
wherein the subject is a mammal, and
wherein the endocytosis inhibitor is dynasore or chloroquine.
US Pat. No. 10,556,958

CD37-BINDING MOLECULES AND IMMUNOCONJUGATES THEREOF

Debiopharm International,...

1. An antibody or antigen binding fragment thereof that specifically binds to CD37, wherein said antibody or fragment comprises a variable heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO:171, a variable heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO:172 or SEQ ID NO:181, and a variable heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO:173, a variable light chain CDR1 comprising the amino acid sequence of SEQ ID NO:174, a variable light chain CDR2 comprising the amino acid sequence of SEQ ID NO:175, and a variable light chain CDR3 comprising the amino acid sequence of SEQ ID NO:176.
US Pat. No. 10,555,933

PHARMACEUTICAL COMPOSITIONS COMPRISING 4-[1-(2,3-DIMETHYLPHENYL)ETHYL]-3H-IMIDAZOLE DERIVATIVES FOR TREATING RETINAL DISEASES

ALLERGAN, INC., Irvine, ...

1. A method of treating geographic atrophy in a subject in need of such treatment, the method comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of (5) [3-(1-(1H-imidazol-4-yl)ethyl)-2-methylphenyl] methanol, or a tautomer thereof, or a pharmaceutically acceptable salt of any one of the foregoing.