US Pat. No. 10,556,150

GROUP PERFORMANCE MONITORING SYSTEM AND METHOD

adidas AG, Herzogenaurac...

1. A system for monitoring a plurality of individuals engaged in an athletic activity, the system comprising:an individual monitor coupled to an individual engaged in the athletic activity, the individual monitor configured to transmit individual data indicative of a characteristic of the individual;
an object monitor coupled to a sports object used in the athletic activity, the object monitor configured to transmit object data indicative of a characteristic of the object; and
a garment having an illuminable area,
wherein the system is configured to compare the individual data with the object data and make a determination based on the comparison, and
wherein the garment is configured to illuminate based on the determination.

US Pat. No. 10,556,146

PILATES EXERCISE SYSTEM AND METHOD OF USE

1. A pilates exercise system, comprising:an elongated frame extending from a first end to a second end, the first end and the second end both having cord attachments, the elongated frame having a first track and a second track that extends from the first end to the second end;
a platform assembly slidingly engaged with the elongated frame, the platform assembly is configured to slide on the first track and the second track, the platform assembly, having:
a lower section configured to engage with the first track and the second track, the lower section is configured to move solely in a direction parallel to the first track and the second track of the elongated frame, the lower section having a first channel and a second channel;
a middle section slidingly engaged with the lower section, the middle section is configured to slide solely in a direction parallel to the first track and the second track, the middle section having a first member that engages with and slides within the first channel of the lower section and a second member that engages with and slides within the second channel of the lower section; and
an upper section, having:
a first cushion platform pivotally attached to the first member; and
a second cushion platform pivotally attached to the second member, the second cushion platform is configured to move independent of the first cushion platform; and
a plurality of cords secured to both the first end of the frame via the cord attachments;
wherein the plurality of cords are configured to resist movement of the platform assembly.

US Pat. No. 10,556,142

CORE MUSCLE EXERCISE SYSTEM

1. An exercise system enabling a user to perform therewith a modified plank exercise, the exercise system comprising:a top element having an interface for the user to hold or rest thereon, wherein the top element comprises a platform with means for attaching one or plural accessories to the platform;
a bottom element having an interface with a ground surface, the top and bottom elements interconnected and separated from each other with a middle element having a variable height, the exercise system configured therewith for the user to adjust the exercise system between at least a first position in which about 0% of the user's body weight is orthogonal to the user's back in usage of the exercise system and a second position in which about 100% of the user's body weight is orthogonal to the user's back in usage of the exercise system, the top element being pivotally coupled to the middle element with a swivel that allows the top element to pivot relative to the middle element in left and right directions, and in fore and aft directions; and
a lock that prevents the top element from pivoting relative to the middle element in at least one of the left and right directions, and the fore and aft directions,
wherein at least one of the top and bottom elements is interchangeably coupled to the middle element, and wherein the top and bottom elements each include one or plural elements of instability that are unstable at equilibrium and configured to be overcome by involving core muscles of the user, and wherein the top and bottom elements are both unstable at equilibrium.

US Pat. No. 10,556,138

SEALED SELF-RETRACTING LIFELINE

HONEYWELL INTERNATIONAL I...

1. A self-retracting lifeline assembly comprising:a housing;
a shaft fixed to the housing against rotation relative to the housing about a central axis of the shaft;
a drum mounted for rotation on the shaft and including a compartment within the drum;
a spring configured to apply a winding force to the drum;
a lifeline wound on the drum for selective deployment and retraction from and to the housing;
a brake module carried on the shaft and mounted within the compartment of the drum, the brake module comprising a disk mount removably receivable on the shaft and fixed against rotation to the shaft, at least two frictional elements mounted on the disk mount, at least one of the at least two frictional elements mounted on the disk mount for rotation relative to the other, and a securing element secured to the disk mount for maintaining the at least two frictional elements held in forced frictional engagement against each other and retained against axial movement within the brake module;
a pawl mechanism mounted on the drum for rotation therewith, the pawl mechanism mounted within the compartment and configured to selectively engage the brake module in response to a pre-determined rotational speed of the drum relative to the shaft; and
wherein the brake module is configured to be assembled to and removed from the self-retracting lifeline assembly without moving either the lifeline or the spring relative to an axial direction of the shaft.

US Pat. No. 10,556,132

METHODS AND DEVICES FOR MODULATING CELLULAR ACTIVITY USING ULTRASOUND

Arizona Board of Regents ...

1. A method for modulating neuronal cellular activity of a neuronal cellular site in a subject, comprising:(i) acoustically coupling at least one component for generating ultrasound waves to an external surface of the subject, and
(ii) driving the at least one component for generating ultrasound waves to form at least one stimulus waveform at the neuronal cellular site, the stimulus waveform comprising a plurality of pulses, each pulse of the plurality comprising a plurality of acoustic cycles having a plurality of frequencies in a range from about 0.02 to about 100 MHz at the site of the cells to be modulated, wherein pulses of the plurality are repeated to produce spatial-peak temporal-average intensities of no more than 100 W/cm2 to modulate neuronal cellular activity at the neuronal cellular site.

US Pat. No. 10,556,128

APPARATUS FOR AN X-RAY DEVICE

Siemens Healthcare GmbH, ...

1. An apparatus, comprising:a filter unit for homogenizing x-ray beams output by an x-ray source;
an alignable screen-filter-mirror unit for localizing an x-ray window and having a base plate with at least one cutout formed therein, said filter unit disposed in said at least one cutout; and
said filter unit having a filter layer with a light-reflecting layer and/or light-reflecting surface, said light-reflecting layer and/or light-reflecting surface of said filter unit is formed on a side of said base plate facing a light source.

US Pat. No. 10,556,127

NEUTRON THERAPY APPARATUS

NEUBORON MEDTECH LTD., N...

1. A neutron therapy apparatus, comprising:a beam shaping assembly including a moderator and a reflector surrounding the moderator, wherein the moderator moderates neutrons to a predetermined energy spectrum and the reflector guides deflected neutrons back to enhance the neutron intensity in the predetermined energy spectrum;
a neutron generator embedded inside the beam shaping assembly, wherein the neutron generator generates neutrons after irradiated by an ion beam;
at least a tube for transmitting the ion beam to the neutron generator, wherein the tube defines at least an axis, the tube comprises a first tube portion defining a first axis and a second tube portion defining a second axis and connected with the first tube portion, the beam shaping assembly rotates around the first axis of the first tube portion or the second axis of the second tube portion;
deflection magnets for changing the transmission direction of the ion beam;
a collimator for concentrating neutrons;
a supporting frame for holding the beam shaping assembly, wherein the supporting frame comprises a first supporting part and a first track set in the first supporting part, and the beam shaping assembly is retained on the first track of the supporting frame; and
an irradiation room for receiving a irradiated object, wherein the first track is recessed in the supporting frame so as to form a containing room connected with the irradiation room, and the collimator extends into the irradiation room through the containing room,
wherein the beam shaping assembly rotates around the axis of the tube and/or moves along the supporting frame.

US Pat. No. 10,556,112

SPINAL CORD MODULATION FOR INHIBITING PAIN VIA SHORT PULSE WIDTH WAVEFORMS, AND ASSOCIATED SYSTEMS AND METHODS

Nevro Corp., Redwood Cit...

1. A spinal cord stimulation system for reducing or eliminating pain in a patient, the system comprising:an implantable signal generator that, in operation, generates a non-paresthesia-producing therapy signal, wherein at least a portion of the therapy signal is at a frequency of from 500 Hz to 1,200 Hz, with a pulse width in a pulse width range from 10 microseconds to 50 microseconds, and a current amplitude in a current amplitude range from 0.5 mA to 7 mA; and
a signal delivery device electrically coupled to the implantable signal generator to deliver the therapy signal to the dorsal column of the patient's spinal cord.

US Pat. No. 10,556,107

SYSTEMS, METHODS AND KITS FOR PERIPHERAL NERVE STIMULATION

EBT Medical, Inc., Toron...

1. A method of assessing stimulation and treating an overactive bladder of a patient comprising:establishing at least one stimulator adapted to treat an overactive bladder of the patient;
establishing a neurostimulator configurable to provide a treatment stimulation signal to said at least one stimulator according to a stimulation protocol that is adapted to stimulate a saphenous nerve of the patient for the treatment of the patient's overactive bladder;
positioning the at least one stimulator on the inner side of the patient's leg and adjacent the saphenous nerve in the area near an upper calf region of the patient's leg;
actuating said neurostimulator to provide a test stimulation signal and assessment; and
determining by response from the patient if at least one sensation is experienced which radiates away from the location of the at least one stimulator; whereby (1) when application of the test stimulation signal fails to produce a radiating sensation indicating that the saphenous nerve has been stimulated, then performing the step of either increasing the test stimulation signal or adjusting the position of the at least one stimulator, and (2) when the test stimulation signal produces the radiating sensation, then providing stimulation treatment using a stimulation signal strength which is set to a value strength that produces the radiating sensation and is below a value strength that is painful to the patient.

US Pat. No. 10,556,104

IMPLANTABLE MEDICAL ELONGATED MEMBER WITH ADHESIVE ELEMENTS

Medtronic, Inc., Minneap...

1. A method comprising:inserting a medical elongated member into a patient, wherein the medical elongated member comprises one or more electrodes and an adhesive element disposed on a longitudinal outer surface of the medical elongated member, the adhesive element being disposed on and pre-bonded to the longitudinal outer surface of the elongated member, wherein the adhesive element is disposed on the outer surface of the elongated member at a location distal to all of the one or more electrodes of the medical elongated member;
positioning the medical elongated member adjacent to or at a target therapy delivery site; and
subsequent to inserting the medical elongated member into the patient, exposing the adhesive element to moisture to activate the adhesive element and secure the elongated member adjacent to the target therapy delivery site.

US Pat. No. 10,556,103

UNWRAPPED 2D VIEW OF A STIMULATION LEAD WITH COMPLEX ELECTRODE ARRAY GEOMETRY

Medtronic, Inc., Minneap...

1. An external programmer for a medical device, the programmer comprising:a display;
processing circuitry configured to:
present, via the display, a representation of a plurality of non-contiguous electrodes of an implantable lead, the plurality of non-contiguous electrodes located at different angular positions about a circumference of the implantable lead; and
present, via the display, a triangular orientation marker with respect to the representation of the plurality of non-contiguous electrodes, the triangular orientation marker indicative of a circumferential orientation of the plurality of non-contiguous electrodes of the implantable lead; and
a user interface configured to receive user selection of a value of one or more stimulation parameters that at least partially define electrical stimulation deliverable via one or more electrodes of the plurality of non-contiguous electrodes.

US Pat. No. 10,556,102

AUTOMATIC ADJUSTMENT OF ELECTRODE SURFACE IMPEDANCES IN MULTI-ELECTRODE CATHETERS

Biosense Webster (Israel)...

1. An apparatus, comprising:a controllable signal source configured to apply an Alternating Current (AC) signal to multiple electrodes of a multi-electrode catheter immersed in an aquatic solution; and
a processor, configured to:
responsively to the applied AC signal, estimate a respective surface impedance or a respective electrical noise level of each of the electrodes; and
disconnect each electrode, independently of other electrodes, when the estimated surface impedance or electrical noise level of the electrode drops below a preset value.

US Pat. No. 10,556,098

MICRONEEDLE ARRAY COATED WITH DRUG COMPOSITION

MEDRX CO., LTD., Kagawa ...

1. A microneedle array having a pin frog shape which is coated on a surface of microneedles with a drug composition comprising a drug and at least one additive, wherein:the at least one additive is (i) an additive mixture comprising an adhesive additive having a Vickers hardness of less than 3 and an additive having a Vickers hardness of 10 or more which acts as a hardness-imparting additive, or (ii) an additive mixture comprising an adhesive additive having a Vickers hardness of less than 3 and an additive having a Vickers hardness of 3 to 10,
the drug composition after being coated and dried has a Vickers hardness of 3 or more,
the coated drug composition amount is 50 to 250 ?g per 100 microneedles,
wherein the drug composition does not cover the entire microneedles, and
wherein an amount of the adhesive additive is 5 to 20 w/w % relative to a total amount of the additive mixture.

US Pat. No. 10,556,084

MASK ASSEMBLY

ResMed Pty Ltd, Bella Vi...

1. A mask assembly to provide pressurized air to nasal passages of a patient, comprising:a nasal assembly shaped to seal around the nasal passages and above a mouth of the patient and deliver pressurized air to the nasal passages, a portion of the nasal assembly that is shaped to seal around the nasal passages of the patient being formed of silicone, the nasal assembly defining a breathing chamber and including:
a first nasal assembly connector portion at a first lateral side of the nasal assembly, the first nasal assembly connector portion defining a first passage permitting introduction of pressurized air into the breathing chamber, wherein the first nasal assembly connector portion is formed of a different material than the portion of the nasal assembly shaped to seal around the nasal passages, wherein the portion of the nasal assembly shaped to seal around the nasal passages of the patient is more flexible than the first nasal assembly connector portion, wherein the silicone of the portion of the nasal assembly that is shaped to seal around the nasal passages of the patient surrounds the first nasal assembly connector portion such that the silicone surrounds the first passage that permits introduction of pressurized air into the breathing chamber, and
a second nasal assembly connector portion at a second lateral side of the nasal assembly that is opposite the first lateral side of the nasal assembly, the second nasal assembly connector portion defining a second passage permitting introduction of pressurized air into the breathing chamber, wherein the second nasal assembly connector portion is formed of a different material than the portion of the nasal assembly shaped to seal around the nasal passages, wherein the portion of the nasal assembly shaped to seal around the nasal passages of the patient is more flexible than the second nasal assembly connector portion, wherein the silicone of the portion of the nasal assembly that is shaped to seal around the nasal passages of the patient surrounds the second nasal assembly connector portion such that the silicone surrounds the second passage that permits introduction of pressurized air into the breathing chamber;
a pair of inlet conduits, including a first inlet conduit and a second inlet conduit, to deliver pressurized air from a flow generator to the breathing chamber of the nasal assembly through the first passage of the first nasal assembly connector portion and the second passage of the second nasal assembly connector portion;
a first inlet conduit connector portion that is attached to an end of the first inlet conduit and is removably attachable to the first nasal assembly connector portion, the first inlet conduit connector portion defining a third passage to provide fluid communication between the first inlet conduit and the breathing chamber when the first inlet conduit connector portion is attached to the first nasal assembly connector portion, wherein the first inlet conduit connector portion is formed of a different material than the first inlet conduit; and
a second inlet conduit connector portion that is attached to an end of the second inlet conduit and is removably attachable to the second nasal assembly connector portion, the second inlet conduit connector portion defining a fourth passage to provide fluid communication between the second inlet conduit and the breathing chamber when the second inlet conduit connector portion is attached to the second nasal assembly connector portion, wherein the second inlet conduit connector portion is formed of a different material than the second inlet conduit.

US Pat. No. 10,556,073

THERAPY DEVICE FOR TREATMENT OF RESPIRATORY DISEASES

1. A therapeutic device (1) for the treatment of human respiratory illnesses, said therapeutic device (1) comprising:a mouthpiece (2) having a distal end, a proximal end, and a passage duct (3) extending therebetween, said passage duct (3) having a distal opening on said distal end of said mouthpiece (2) and a proximal opening on said proximal end of said mouthpiece (2), and said passage duct (3) defining a longitudinal axis extending between said distal end of said mouthpiece (2) and said proximal end of said mouthpiece (2);
a hose (5) formed out of a flexible elastic material, said hose (5) comprising a distal end, a proximal end, and a lumen extending therebetween, said proximal end of said hose (5) being mounted to said mouthpiece (2) with said proximal end of said hose (5) being aligned with said distal opening of said passage duct (3) such that said hose is fluidically connected to said passage duct (3), and such that said distal end of said hose is open to atmosphere;
a support body (11) having a proximal portion mounted to said mouthpiece (2) and a distally-extending curved portion for supporting said hose (5) wherein said proximal portion of said support body extends distally from said mouthpiece in a direction that is parallel to said longitudinal axis of said mouthpiece, and said distally-extending curved portion of said support body (11) comprises an arc extending away from said longitudinal axis of said mouthpiece, said arc of said support body defining a radius of curvature; and
an adjusting device (12) having a proximal end and a distal end, said adjusting device (12) passing through said distally-extending curved portion of said support body (11) at a distance from said mouthpiece (2) such that said distal end of said adjusting device (12) engages said hose; a guide plate (14) having a distal end, a proximal end, and a body extending therebetween, said body of said guide plate (14) being disposed between said distal end of said adjusting device (12) and said hose (5), such that said distal end of said adjusting device (12) contacts said body of said guide plate (14) and such that at least a portion of said hose (5) lies loose on said body of said guide plate (14); wherein
said adjusting device (12) is configured to be selectively moved relative to said support body (11), such that a distance between said hose (5) and said support body (11), and a distance between said guide plate (14) and said support body (11) are configured to be selectively adjusted, whereby to selectively vary an arc of said hose relative to said longitudinal axis of said mouthpiece, said adjusting device being configured to adjust a radius of curvature of said guide plate independently to said radius of curvature of said distally-extending curved portion of said support body (11).

US Pat. No. 10,556,068

INJECTION DEVICE

Consort Medical PLC, Hem...

1. An injection device comprising:an outer housing configured to receive a syringe, the syringe having a barrel for containing a medicament and a needle in fluid communication with the barrel;
a needle shield axially moveable relative to the outer housing between a needle covering position and a needle exposing position to selectively provide a needle enclosure, the needle exposing position being axially rearward of the needle covering position;
a biasing means for biasing the needle shield axially forwardly toward the needle covering position;
a locking means; and
a locking sleeve axially movable relative to the outer housing between a non-locking position and a locking position, the locking position being axially rearward of the non-locking position, in which axial movement of the locking sleeve is selectively limited by the locking means;
wherein in a first configuration, the needle shield is in the needle covering position and the locking sleeve is in the non-locking position so that at least a portion of the needle shield is axially slideable within the locking sleeve to permit rearward axial movement of the needle shield from the needle covering position to the needle exposing position; and
in a subsequent configuration, the needle shield is in the needle covering position and the locking sleeve is in the locking position so that the needle shield is prevented from moving axially rearwardly by interference with the locking sleeve.

US Pat. No. 10,556,062

ELECTRONIC MEDICATION ORDER TRANSFER AND PROCESSING METHODS AND APPARATUS

Baxter International Inc....

1. A pharmacy system for the automated transfer and processing of electronic medication order information to and from a computerized patient care system associated with a healthcare facility, the system comprising:a pharmacy HL7 interface configured to
receive a first HL7 message including information relating to an electronic medication order for a medication that is to be prepared for intravenous administration to a patient, and
transmit a second HL7 message including information relating to preparation of the medication corresponding to the electronic medication order, the information from the second HL7 message being used to bill for the medication corresponding to the electronic medication order;
a pharmacy computer communicatively coupled to the pharmacy HL7 interface and configured to
process the electronic medication order, including accessing electronically at least one medication database or file using information included with the electronic medication order to identify one or more ingredients required to prepare the medication corresponding to the electronic medication order, and
transmit the information, the information including data indicative of the identified one or more ingredients relating to the preparation of the medication corresponding to the electronic medication order; and
a pharmacy workstation located at least in part within an environment suitable for preparing intravenously administered medications and communicatively coupled to the pharmacy computer, the pharmacy workstation configured to
provide instructions for preparing the medication corresponding to the electronic medication order, and
capture the information relating to preparation of the medication corresponding to the electronic medication order.

US Pat. No. 10,556,053

SYSTEM FOR COLLECTING MONONUCLEAR CELLS HAVING A SUITABLE HEMATOCRIT FOR EXTRACORPOREAL PHOTOPHERESIS

Fenwal, Inc., Lake Zuric...

1. A system for collecting mononuclear cells to be treated with UV irradiation, comprising: a disposable fluid circuit comprising a processing container, a product container configured to receive a mononuclear cell product comprising mononuclear cells, red blood cells, and plasma, a tubing connecting the processing container to the product container; a separator configured to work in association with the disposable fluid circuit, the separator comprising a chamber configured to receive the processing container, rotate about a rotational axis and convey whole blood into an inlet region of the chamber for separation into a red blood cell constituent, a plasma constituent, and an interface constituent carrying mononuclear cells between the red blood cell constituent and the plasma constituent, a valve for selectively permitting fluid flow through the tubing, an optical or hematocrit sensor configured to detect transmission levels of light passing through separated blood components flowing out of the processing container through the tubing; a microprocessor-based controller in communication with the separator, wherein the controller is programmed to: receive input of a target hematocrit for the mononuclear cell product, wherein hematocrit is determined by a ratio of the red blood cells per volume within the mononuclear cell product; receive input for a total volume of whole blood to be processed and a number of cycles to be performed; direct the interface constituent and a portion of the red blood cell constituent into the product container by opening the valve disposed between the processing container and the product container to collect a resulting mononuclear cell product volume comprising a volume of mononuclear cells and a volume of red blood cells; and automatically adjust the volume of red blood cells flowed to the product container based on input from the optical or hematocrit sensor so that a ratio of total volume of red blood cells within the mononuclear cell product to a total volume of mononuclear cell product equals the target hematocrit.

US Pat. No. 10,556,050

LOW COST VENTRICULAR DEVICE AND SYSTEM THEREOF

Thorvascular Pty Ltd, Fr...

1. A centrifugal blood pump device comprising:an impeller having a plurality of blades, the blades including blade magnets; and
a pump housing having an inlet, an outlet, a cavity, and housing magnets; and
a detachable drive unit;
wherein the inlet is for receiving blood and directing the blood onto the impeller,
wherein the impeller rotates around a central axis thereof in the cavity of the pump housing, and
wherein the impeller, in use, is suspended in the cavity by the blades which generate a centrifugal force acting on the blades in a radial direction away from the central axis and a magnetic repulsive force induced between the blade magnets of the blades and the housing magnets of the pump housing.

US Pat. No. 10,556,049

TWISTING BIVENTRICULAR CARDIAC ASSIST DEVICE

1. A cardiac assist device, comprising:a structure surrounding at least a portion of a heart, wherein the structure comprises:
a first ring on a first side of the structure;
a second ring on a second side of the structure; and
a plurality of columns connecting the first ring to the second ring;
an inner cup enclosing at least a portion of the structure;
an outer cup enclosing at least a portion of the inner cup, wherein; the outer cup comprises an opening; and
a pump, wherein the pump is configured to:
conduct gas into a space between the outer cup and the inner cup via the opening of the outer cup, wherein the conduction of the gas into the space between the outer cup and the inner cup causes a first motion of the structure comprising a first rotation of the second ring in a first direction; and
conduct the gas from the space between the outer cup and the inner cup to outside of the outer cup via the opening of the outer cup, wherein the conduction of the gas from the space between the outer cup and the inner cup to the outside of the outer cup causes a second motion of the structure comprising a second rotation of the second ring in a second direction, different than the first direction.

US Pat. No. 10,556,047

HEART HELP DEVICE, SYSTEM, AND METHOD

1. An implantable device for improving a pump function of a heart of a human patient by applying an external force on a heart muscle, said device comprising at least one pump device adapted to assist in the pump function of the heart comprising:a heart contacting organ adapted to be located onto the heart muscle,
an operating device for operating the heart contacting organ, and
an implantable pressurized fluid system comprising:
a first implantable chamber adapted to hold a pressurized fluid, wherein said first chamber is adapted to hold a fluid having a high pressure and
a second implantable chamber adapted to hold a pressurized fluid, wherein said second chamber is adapted to hold a fluid having a lower pressure, and
wherein said implantable operating device is adapted to use said first implantable chamber for operating the heart contacting organ in two directions with high pressure fluid, and wherein said operating device is further adapted to use said implantable second chamber for lowering a pressure on one side of said operating device, and
wherein a movement of the heart contacting organ assists the pump function of the heart.

US Pat. No. 10,556,043

REDUCED-PRESSURE, MULTI-ORIENTATION, LIQUID-COLLECTION CANISTER

KCI Licensing, Inc., San...

1. A canister for collecting liquid from a tissue site to which reduced pressure treatment is applied, the canister comprising:at least one canister wall defining a first space configured to collect liquid from the tissue site;
a canister outlet configured to allow communication between a reduced pressure source and the first space;
an elongated member fluidly connected to the canister outlet and extending away from the canister outlet into the first space, the elongated member having a membrane defining a second space along at least a portion of a length of the elongated member, at least a portion of the membrane allowing gaseous communication between the first space and the second space; and
a biasing member surrounded by the membrane and configured to reduce collapse of the elongated member when the second space is exposed to reduced pressure.

US Pat. No. 10,556,033

SURFACE COATING FOR A MEDICAL INSTRUMENT, MEDICAL INSTRUMENT HAVING A SURFACE COATING, AND METHOD FOR PRODUCING A SURFACE COATING FOR A MEDICAL INSTRUMENT

IMT MASKEN UND TEILUNGEN ...

1. A surface coating for a medical instrument, the surface coating comprising:an interference filter having at least one dielectric layer and at least one metallic layer arranged one above another,
wherein at least one of the at least one metallic layer and the at least one dielectric layer is adapted to be structurally altered by action of a corrosive environment on the surface coating such that the surface coating is convertible from a first state to a second state,
wherein, in the first state, the surface coating has a first spectral reflectivity and, in the second state, the surface coating has a second spectral reflectivity that is different from the first spectral reflectivity, and
wherein the first spectral reflectivity has a first reflectivity maximum at a first wavelength, and the second spectral reflectivity has a second reflectivity maximum at a second wavelength, a difference between the second wavelength and the first wavelength being at least 100 nm.

US Pat. No. 10,556,017

LIPID-BASED DRUG CARRIERS FOR RAPID PENETRATION THROUGH MUCUS LININGS

The Johns Hopkins Univers...

1. A method of administering a therapeutic, prophylactic, or diagnostic agent to cervicovaginal mucosa (CVM) comprising intravaginally administering mucus penetrating particles, wherein the mucus penetrating particles comprise:one or more PEG-conjugated phospholipids,
one or more lipids,
one or more stabilizers selected from the group consisting of cholesterol and ganglioside GM1, and
one or more therapeutic, prophylactic, and/or diagnostic agents,
wherein the concentration of the PEG-conjugated phospholipid is at least 10 mole percent of the total of the PEG-conjugated phospholipids, the lipids and the stabilizers,
wherein the stabilizer physically and/or chemically stabilizes the mucus penetrating particles and the concentration of the stabilizer is between about 10 mole percent and about 70 mole percent of the total of the PEG-conjugated phospholipids, the lipids, and the stabilizers,
wherein the mucus penetrating particles have an average diameter of between about 100 nm and about 500 nm, and
wherein at least 50% of the mucus penetrating particles are mobile in freshly collected, undiluted human CVM at 2 hours and at least 30% of the particles are mobile in freshly collected, undiluted human CVM at 15 hours.

US Pat. No. 10,556,005

ADJUVANT COMPOSITION CONTAINING CITRULLINE

THE CHEMO-SERO-THERAPEUTI...

1. A process for enhancing the immunogenicity of an antigen comprising adding an adjuvant effective amount of citrulline to a vaccine comprising said antigen, wherein the adjuvant effective amount of citrulline ranges from 1 mg/mL to 50 mg/mL, wherein the citrulline is at least one member selected from the group consisting of L-citrulline, D-citrulline, L-thiocitrulline, L-thiohomocitrulline, S-methyl-L-thio-citrulline and S-ethyl-L-thiocitrulline.

US Pat. No. 10,555,950

BILE ACID RECYCLING INHIBITORS FOR TREATMENT OF OBESITY AND DIABETES

SATIOGEN PHARMACEUTICALS,...

1. A method of treating diabetes comprising administering to the distal ileum, the colon, or the rectum of a diabetic individual, a single pharmaceutical composition consisting of a therapeutically effective amount of an Apical Sodium-dependent Bile Transporter Inhibitor (ASBTI) and one or more pharmaceutical carriers, wherein the ASBTI isor a pharmaceutically acceptable salt thereof.

US Pat. No. 10,555,946

3-(SUBSTITUTED-4-OXOQUINAZOLIN-3(4H)-YL)-3-DEUTERO-PIPERIDINE-2,6-DIONE DERIVATIVES AND COMPOSITIONS COMPRISING AND METHODS OF USING THE SAME

DeuteRx, LLC, Andover, M...

1. A method for treating a disorder selected from the group consisting of multiple myeloma, leprosy, and non-Hodgkin's lymphoma, the method comprising administering to a patient in need thereof a therapeutically effective amount of a deuterium-enriched compound of formula I to treat the disorder, wherein formula I is:
or a pharmaceutically acceptable salt, solvate, or stereoisomer thereof, wherein:
Z is H or D, provided that the abundance of deuterium in Z is at least 30%;
R1, R2, R3, R4, R5, and R10 are independently selected from H and D;
R6 is selected from: H; D; —(CH2)nOH; phenyl; —O(C1-C6)alkyl; and (C1-C6)alkyl optionally substituted with one or more halo;
R7, R8, and R9 are independently selected from: H; D; halo; —(CH2)nOH; (C1-C6)alkyl optionally substituted with one or more halo; (C1-C6)alkoxy optionally substituted with one or more halo; and —(CH2)nNHRa;
alternatively, two of R7, R8, R9, and R10 are taken together with the atoms to which they are attached to form a 5-6 membered ring optionally substituted with one or more groups independently selected from halo; (C1-C6)alkyl optionally substituted with one or more halo; and (C1-C6)alkoxy optionally substituted with one or more halo;
Ra is selected from: H; D; (C1-C6)alkyl optionally substituted with one or more halo; —(CH2)n-(6 to 10 membered aryl); —C(O)(CH2)n-(6 to 10 membered aryl); —C(O)(CH2)n-(6 to 10 membered heteroaryl); —C(O)(C1-C8)alkyl optionally substituted with one or more halo; —C(O)(CH2)n—(C3-C10-cycloalkyl); —C(O)(CH2)n—NRbRc, —C(O)(CH2)n—O—(C1-C6)alkyl; and —C(O)(CH2)n—O—(CH2)n-(6 to 10 membered aryl); wherein the aryl and heteroaryl are optionally substituted with one or more groups independently selected from: halo; —SCF3; (C1-C6)alkyl optionally substituted with one or more halo; and (C1-C6)alkoxy optionally substituted with one or more halo;
Rb and Rc are each independently selected from: H; D; (C1-C6)alkyl optionally substituted with one or more halo; (C1-C6)alkoxy optionally substituted with one or more halo; and 6 to 10 membered aryl; the aryl being optionally substituted with one or more groups independently selected from: halo; (C1-C6)alkyl optionally substituted with one or more halo; and (C1-C6)alkoxy optionally substituted with one or more halo;
n is independently selected from 0, 1, and 2; and
a hydrogen atom present in any substituent is optionally replaced by D.

US Pat. No. 10,555,943

TEMOZOLOMIDE POWDER FORMULATION

AMPLIPHARM PHARMACEUTICAL...

1. A method of administering temozolomide comprising orally administering a temozolomide powder with a separate drink of water, wherein the temozolomide powder is readily dispersible in an aqueous solution suitable for oral administration and the temozolomide powder comprises:(a) granules of temozolomide and one or more emulsifiers, the granules coated with a pH dependent coating composition comprising a pH dependent coating material; and
(b) a dispersant,
wherein at least 80% of the temozolomide powder dissolves within 30 minutes when tested according to USP I dissolution test (basket) in 900 mL of 0.1 N HCl at 37° C.±0.5° C. and a speed of 100 rpm.

US Pat. No. 10,555,941

ALKYL LINKED QUINOLINYL MODULATORS OF ROR?T

Janssen Pharmaceutica NV,...

1. A method for treating or ameliorating a ROR?t mediated inflammatory syndrome, disorder or disease, wherein the disease is selected from the group consisting of: inflammatory bowel diseases, rheumatoid arthritis, psoriasis, chronic obstructive pulmonary disorder, psoriatic arthritis, ankylosing spondylitis, neutrophilic asthma, steroid resistant asthma, multiple sclerosis, and systemic lupus erythematosus, comprising administering to a subject in need thereof an effective amount of a compound of Formula I:wherein:R1 is azetidinyl, imidazolyl, pyrimidinyl, triazolyl, tetrahydropyranyl, thiazolyl, pyridyl, piperidinyl, phenyl, oxazolyl, or isoxazolyl; wherein said piperidinyl, pyridyl, imidazolyl, and phenyl are optionally substituted with SO2CH3, C(O)CH3, CH3, CF3, Cl, F, —CN, OCH3, or N(CH3)2; and optionally substituted with up to one additional group independently selected from Cl, OCH3, and CH3; and wherein said triazolyl, oxazolyl, isoxazolyl, and thiazolyl are optionally substituted with one or two CH3 groups; and wherein said azetidinyl is optionally substituted with CO2C(CH3)3, or C(O)CH3;
R2 is C(1-6)alkyl, cyclopropyl, or alkynyl;
R3 is OH;
R4 is H;
R5 is Cl, —CN, CF3, CH3, OH, N(CH3)OCH3, N(CH3)2, azetidin-1-yl, or OCH3;
R6 is pyridyl or phenyl, wherein said phenyl is optionally substituted with Cl, F, CF3, SO2CH3, or OCF3; or R6 is —O-phenyl, wherein said —O-phenyl is optionally substituted with Cl, F, or —CN; or R6 is —CH2R6?, wherein R6? is pyridyl, or phenyl, wherein said pyridyl or phenyl is optionally substituted with pyrazol-1-yl, 1,2,4-triazol-1-yl, CF3, OCH3, SO2CH3, Cl, F, or —CN;
R7 is Cl, —CN, C(1-4)alkyl, OC(1-2)alkyl, or NA1A2;
A1 is C(1-2)alkyl;
A2 is C(1-2)alkyl, CH2CH2OCH3, or OCH3; or A1 and A2 may be taken together with their attached nitrogen to form a ring selected from the group consisting of:

Ra is OH, OCH3, F;
R8 is H;
R9 is H;and pharmaceutically acceptable salts thereof.

US Pat. No. 10,555,865

TORQUE CONTROL METHODS FOR AN EXOSKELETON DEVICE

Carnegie Mellon Universit...

1. A method of controlling an exoskeleton, comprising:receiving a measurement of a first torque applied to a rotational joint coupling a first component to a second component, the first torque being applied by a motor via a cable;
determining, based on the measurement of the first torque, a first portion of a second torque to apply to the rotational joint;
determining, based on the measurement of the first torque, a second portion of the second torque to apply to the rotational joint by:
determining, for an interval of a cycle, a target value as a function of an error value measured at the same interval of one or more previous cycles; and
determining, from the target value, a feed-forward response portion of the second torque;
determining a value of the second torque to apply to the rotational joint based on the first portion and the second portion including the feed-forward response portion; and
controlling the motor for applying the second torque to the rotational joint by the cable.

US Pat. No. 10,555,864

TRAINING APPARATUS, CALCULATING METHOD, AND PROGRAM

Murata Machinery, Ltd., ...

1. A training apparatus for training a user's four limbs including upper limbs and/or lower limbs according to a predetermined training program, the apparatus comprising:an operating rod for moving a held limb, the operating rod being supported to a stationary frame placed on or near a floor surface to be movable at two or more degrees of freedom;
a plurality of strength detectors for detecting strength components that are components of a strength applied to the operating rod in freedom degree directions where the operating rod is movable, and outputting strength component signals based on magnitudes of the detected strength components;
a plurality of motion position detectors for detecting motion positions of the operating rod in the freedom degree directions where the operating rod is movable;
a boundary direction speed calculator for calculating a boundary direction speed that is a speed component in a direction along a mobile region boundary line for defining a boundary of an operating rod mobile region for setting a range where the operating rod is movable;
a motion position predicting unit for calculating a predicted motion position where the operating rod is predicted to arrive when a resultant strength obtained by synthesizing the strength components in the freedom degree directions is applied to the operating rod on a current motion position of the operating rod; and
a motion speed calculator for calculating a speed including the boundary direction speed as a motion speed at which the operating rod moves when the predicted motion position is predicted to be outside the operating rod mobile region.

US Pat. No. 10,555,863

CRYOTHERAPY COMPRESSION SYSTEM

Jacob Randy Hall, Midway...

1. A therapy system, comprising:an inner layer having an inner surface and an outer surface;
an outer layer whose overall length is adjustable, the outer layer including first and second portions that are not part of, but are attached to, the inner layer, wherein an end of the first portion is completely separable from an end of the second portion so as to define a separation that takes the form of a gap in a material of the outer layer and wherein the gap is spanned by a spanning material, and wherein the outer layer includes a first free end and second free end that are releasably attachable to each other;
a therapeutic device removably positioned so that the inner surface of the inner layer is disposed between the therapeutic device and an extremity of a user when the extremity is positioned in an opening defined by the inner layer; and
an adjustable and manually operable tightening mechanism comprising a lace connected to the first and second portions of the outer layer and the lace is engaged with a mechanical lace tensioner that is operable to change, by either drawing the first and second portions toward each other or by allowing the first and second portions to move away from each other, a magnitude of a compressive force exerted by the outer layer on the extremity when the extremity is positioned within the opening defined by the inner layer, wherein the tightening mechanism is further operable to translate part of one of the first and second portions of the outer layer relative to the inner layer so as to vary a width of the gap.

US Pat. No. 10,555,856

PATIENT LIFT SYSTEM

Amico Mobility Solutions ...

1. A patient lift system comprising:a trolley arranged to form a mechanical connection to a track, the trolley having a connection member; and
a lift unit chassis distinct from the trolley, the lift unit chassis defining a latching post operable to form a mechanical connection with the trolley responsive to the connection member connecting to the latching post, the lift unit chassis enclosing: a strap hub; and a motor.

US Pat. No. 10,555,850

PATIENT SUPPORT SYSTEMS AND METHODS OF USE

Hill-Rom Services, Inc., ...

1. A patient support system adapted to provide a hospital bed having a head end, a foot end, a left side, and a right side, the system comprisinga patient support apparatus adapted to provide a bed frame, the patient support apparatus including a deck adapted to underlie a support surface, the deck being made up of a seat deck section, a foot deck section mounted to move relative to the seat deck section, and a head deck section mounted to pivot about an axis and to slide away from the seat deck section forming a gap between the seat deck section and the head deck section, and
a patient support surface adapted to provide a mattress, the patient support surface including a plurality of internal components, a ticking that provides a cover encasing the internal components, and a plurality of lugs configured to couple the patient support surface to the deck for movement therewith,
wherein the plurality of lugs include a first pair of lugs coupled to a head-end section of the ticking that extend from the ticking into apertures formed in the head deck section to couple the head-end section of the ticking to the head deck section for movement therewith during sliding of the head deck section away from the seat deck section, a second pair of lugs that extend from a foot-end section of the ticking into apertures formed in the foot deck section to couple the foot-end section of the ticking to the foot deck section for movement therewith relative to the seat deck section, and a third pair of lugs that extend from a section of the ticking between the head-end section and the foot-end section into apertures formed in the seat deck section to couple the ticking to the seat deck section.

US Pat. No. 10,555,847

MULTI-FUNCTION CHAIR ATTACHMENT FOR DISABLED PERSONS

1. A multi-function attachment to assist a user to perform one or more tasks, the attachment comprising:an arm member having forward and back ends;
one or more coupling members provided to the arm member and configured to detachably secure the arm member to a chair; and
a support member configured to be detachably coupled to the second end of the arm member;
wherein at least a portion of the support member is configured to extend laterally from a point proximate the front end of the arm member to provide support for a device forward and above a seat portion of the chair;
a positioning insert formed substantially in an L-shape and configured to couple the arm member to the support member at a plurality of positions;
wherein the positioning insert includes a first portion configured to be inserted into the arm member, and a second portion configured to be inserted into the support member;
wherein the first portion of the positioning insert is provided with a plurality of pairs of through holes along a length of the first portion;
the arm member is provided with a pair of through holes configured to correspond with any of the pairs of through holes of the first portion of the positioning insert such that the positioning insert is arranged in one of a plurality of positions by receiving a pin through the through holes of the arm member and the first portion of the positioning insert;
wherein the first portion of the positioning insert is provided with three pairs of the through holes along the length of the first portion such that the positioning insert is selectively positionable at three different lengths of insertion into the arm member;
wherein the second portion of the positioning insert is provided with a pair of through holes; and
the support member is provided with a pair of through holes at a first end thereof to correspond with the pair of through holes in the second portion of the positioning insert such that the support member is secured to the second portion of the positioning insert by receiving a pin through the through holes of the support member and the second portion of the positioning insert.

US Pat. No. 10,555,845

WHEELCHAIR REAR WHEEL SUPPORT ASSEMBLY AND DETACHABLE ARMREST

1. A detachable armrest assembly for a chair, said armrest assembly comprising a support housing, a detachable coupling for removably securing said support housing to a side member of a seat frame, an armrest secured to said support housing, vertical displacement means securing said armrest to said support housing to adjust the height of said armrest relative to said support housing, and connectable hinge means securable to said support housing for pivoting said housing in a rearward direction with said support housing disengaged from said detachable coupling, the detachable coupling having a latch actuator mechanism to permit said support housing to be pivoted in said rearward direction, said latch actuator mechanism having an external hand operable lever movable in a same direction as the rearward direction of the housing to initiate the pivoting of said housing in the rearward direction.

US Pat. No. 10,555,842

UNDERPANTS-TYPE DISPOSABLE DIAPER

DAIO PAPER CORPORATION, ...

1. An underpants-type disposable diaper comprising an outer body constituting individually or integrally a front body and a back body, and an inner body including an absorber provided on an inner side of the outer body ranging from the front body to the back body, the outer body of the front body and the outer body of the back body being joined together at side edges to form side seal portions, thereby forming a waist opening and a pair of right and left leg openings, whereinthe outer body of the back body has a waist part defined as a front-back direction range having the side seal portions and an intermediate portion defined as the front-back direction range forming the leg openings,
the intermediate portion has cover parts positioned closer to lateral sides of the inner body,
the cover parts are formed at least by stacking an elastic sheet layer between a first sheet layer and a second sheet layer,
when the elastic sheet layer is extended in a width-direction, the first sheet layer and the second sheet layer are joined together directly or indirectly at a large number of dot-like joint portions arranged at intervals left in the width-direction and front-back direction, and
at least the intermediate portion of the cover parts in the front-back direction are configured such that an arrangement density of the dot-like joint portions becomes higher stepwise or continuously from width-direction outer edges to a width-direction central side.

US Pat. No. 10,555,835

LASER EYE SURGERY SYSTEMS AND METHODS OF TREATING VITREOUS AND OCULAR FLOATERS

OPTIMEDICA CORPORATION, ...

1. A laser surgical system for making incisions in ocular tissues, the system comprising:a laser system comprising a scanning assembly, a laser operable to generate a laser beam configured to incise ocular tissue, and an imaging device configured to generate images of ocular tissues; and
a control system operably coupled to the laser system and configured to:
operate the imaging device to locate a posterior of a lens in an eye;
operate the imaging device to locate a retina in the eye;
operate the imaging device to locate a vitreous body in a vitreous humor in the eye;
process the image data to determine, based on the location of the vitreous body, a treatment scanning pattern for scanning a focal zone of the laser beam for performing one or more incisions in the vitreous humor, wherein the one or more incisions are surfaces that collectively form closed boundaries completely surrounding a volume that completely contains the vitreous body to isolate the vitreous body, without any focal zone locations or incisions cutting through the volume; and
operate the laser system, wherein positioning of the focal zone is guided by the control system based on the treatment scanning pattern to perform the one or more incisions in the vitreous humor.

US Pat. No. 10,555,827

MULTIFUNCTIONAL ORTHOSIS DEVICE AND METHOD OF USE

FastForm Research Ltd., ...

24. An orthosis device comprising:a substantially rigid thermo-formable substrate having a substrate profile defined by a substrate top edge, an opposite substrate bottom edge, and opposite substrate side edges interconnecting the substrate top and bottom edges, the substrate profile being substantially symmetrical about a centerline thereof, the centerline being centered vertically along the substrate from the substrate top edge to the substrate bottom edge, the substrate having a main body portion and opposite lower wing portions, each of the lower wing portions being joined to the main body portion along a substantially angled hinge relative to the centerline, the substrate further having a central portion formed having a substrate thumb hole and a selectively removable thumb hole cover installed within the substrate thumb hole; and
a liner pad coupled to the substrate in a substantially abutting arrangement, the liner pad having a pad profile defined by a pad top edge, an opposite pad bottom edge, and opposite pad side edges interconnecting the pad top and bottom edges, the pad profile substantially corresponding to the substrate profile, the liner pad further having a pad thumb hole substantially corresponding to the substrate thumb hole;
wherein the device becomes moldable when activated by a forming temperature above ambient, and the symmetry of the substrate enables the device to be used in both left hand and right hand applications; and
wherein the thumb hole cover is configured to be selectively retained within the substrate thumb hole to provide a substantially continuous support surface for a hand of a patient during use of the device in an ulnar gutter application and to be selectively removed from the substrate thumb hole to allow a thumb of a patient to be inserted through the substrate thumb hole during use of the device in a radial gutter application, such that the device may be used in both radial and ulnar gutter applications.

US Pat. No. 10,555,826

HEMOSTASIS VALVE AND DELIVERY SYSTEMS

Bolton Medical, Inc., Su...

1. An x-valve, comprising:a) a valve housing;
b) at least one sealing component within the valve housing, the sealing component defining a plurality of slots that intersect with each other; and
c) a support layer that includes nitinol and partitions the sealing component, the support layer including a peripheral ring and a plurality of arms extending from the peripheral ring to points proximate to intersection of the plurality of slots, the plurality of arms embedded within the sealing component, whereby the x-valve can form a seal about a guidewire extending through the x-valve.

US Pat. No. 10,555,825

ROTATION OF A MEDICAL DEVICE DURING CRIMPING

ABBOTT CARDIOVASCULAR SYS...

1. A method, comprising:using a stent or scaffold, the stent or scaffold having an outer diameter and the outer diameter having a before crimping size;
using a balloon of a balloon catheter;
using a crimping device having a plurality of blades configured to form an aperture, wherein the blades are displaced relative to each other to increase or decrease the size of the aperture during crimping, and wherein the aperture has an axis surrounded by the blades; and
crimping the stent or scaffold to the balloon, the crimping comprising:
placing the stent or scaffold on the balloon,
aligning the stent or scaffold and balloon catheter with the aperture axis, including supporting the balloon catheter using a bearing having a bearing axis parallel to the aperture axis,
wherein when the blades of crimping device rotate about the aperture axis the aperture size changes, whereupon the catheter rotates about the bearing axis in response to the rotation of the blades about the aperture axis, and
reducing the stent or scaffold outer diameter from the before crimping size to a first size.

US Pat. No. 10,555,824

STENT DEVICE DELIVERY SYSTEM WITH INWARDLY TAPERING STENT BED

C. R. Bard, Inc., Murray...

1. A method of making a stent device delivery system, comprising:loading a device into a retractable outer sheath comprising a sleeve, the retractable outer sheath having a delivery position that retains the device and a deployed position that radially frees the device;
positioning an inner catheter radially and axially within a lumen of the device, wherein the inner catheter comprises an inwardly tapered bed; and
cold-drawing the sleeve:
to reduce a diameter of the sleeve;
to squeeze the device from an expanded configuration into a reduced delivery configuration; and
to engage a radially inner surface of the device with a radially outer surface of the inwardly tapered bed.

US Pat. No. 10,555,813

IMPLANTABLE DEVICE AND DELIVERY SYSTEM FOR RESHAPING A HEART VALVE ANNULUS

BOSTON SCIENTIFIC SCIMED,...

1. An implant for reducing heart valve regurgitation comprising:a frame having upper crowns, lower crowns and struts between the upper and lower crowns, the frame having a tissue engaging configuration having a tissue engaging diameter and an annulus remodeling configuration where the frame has an annulus remodeling diameter that is less than the tissue engaging diameter;
a plurality of anchoring members coupled with the lower crowns of the frame for engaging cardiac tissue proximate the heart valve annulus; and
a plurality of collars coupled with the upper crowns of the frame, wherein when force is applied to the collars, the collars slide along the upper crowns and the struts to move the frame from the tissue engaging configuration towards the annulus remodeling configuration and wherein each collar includes at least one flex section configured to reduce friction between the collar and the upper crowns and the struts.

US Pat. No. 10,555,804

THERAPEUTIC DEVICE FOR PAIN MANAGEMENT AND VISION

JOURNEY1, INC., Brisbane...

1. A covering to treat a cornea of an eye of a patient, said cornea comprising an epithelium, and said covering comprising:an inner portion comprising an inner rigidity, an inner thickness, and an inner durometer; and
an outer portion comprising an outer rigidity,
wherein said inner rigidity is greater than said outer rigidity,
wherein said inner durometer is within a range of Shore 20A to Shore 70A, and
wherein said covering, when applied to said cornea, is configured to adhere to said cornea to reduce swelling of said cornea.

US Pat. No. 10,555,801

GASTROINTESTINAL-TRACT CONSTRICTING METHOD

OLYMPUS CORPORATION, Tok...

1. A gastrointestinal-tract constricting method comprising:while observing the gastrointestinal tract by inserting an endoscope into the gastrointestinal tract, forming a spreading block that blocks infiltration of a substance, which damages a mucosa basal layer of the gastrointestinal tract, into the muscular layer underlying the mucosa basal layer, the spreading block being formed along a circumferential direction of the gastrointestinal tract and between the mucosa basal layer and the muscular layer; and
supplying the substance along the circumferential direction of the gastrointestinal tract and to a surface of the mucosa that lies within a region that overlaps an inner side of the gastrointestinal tract with respect to the spreading block out of the entire circumference of the gastrointestinal tract in a transverse section of the gastrointestinal tract.

US Pat. No. 10,555,786

OPERATION INPUT DEVICE AND MEDICAL MANIPULATOR SYSTEM

OLYMPUS CORPORATION, Tok...

11. An operation input device for inputting an operating command to a manipulator for observing or treating an affected area, the operation input device comprising:a grip configured to be gripped by a hand of an operator; and
an arm comprising at least two link members and at least one joint for linking adjacent link members of the at least two link members so that the adjacent link members can tilt about a joint axis intersecting longitudinal axes of the adjacent link members, the arm movably supporting the grip, wherein the at least one joint comprises:
a shaft fixed to one of the adjacent link members, the shaft extending along the joint axis;
a spring fixed to an other of the adjacent link members, the spring being wound around an outer circumferential surface of the shaft to tighten the shaft radially inward; and
the shaft and the spring being configured to generate a frictional torque in an opposite direction to a direction in which a torque is applied; and
an adjustment section for adjusting the tightening force generated by the spring.

US Pat. No. 10,555,782

SYSTEMS AND METHODS FOR PERFORMING MINIMALLY INVASIVE SPINAL SURGERY WITH A ROBOTIC SURGICAL SYSTEM USING A PERCUTANEOUS TECHNIQUE

Globus Medical, Inc., Au...

1. A method of operating a robotic surgical system, the method comprising:detecting, by a force sensor, movement of a surgical instrument guide attached to a robotic arm of the robotic surgical system, wherein the surgical instrument guide defines a trajectory comprising a location and an orientation for insertion of a medical implant in a vertebra of a patient, wherein the surgical instrument guide includes a dilator and the dilator defines a working channel for accessing the vertebra;
storing, by a processor of a computer device, a planned trajectory based on the trajectory of the surgical instrument guide at a defined time;
after the planned trajectory is defined, detecting, by the force sensor, movement of the surgical instrument guide towards the vertebra;
increasing a size of the working channel of the dilator;
inserting a dilator adapter into the dilator to adjust a diameter of a portion of the dilator to allow for different sized tools to be guided by the dilator,
wherein the processor is configured to execute instructions within the computing device based upon the planned trajectory stored by the processor to prevent the surgical instrument guide from moving away from the planned trajectory.

US Pat. No. 10,555,776

MAGNETIC RESONANCE THERMOMETRY DURING ABLATION

BIOSENSE WEBSTER (ISRAEL)...

1. A method, comprising the steps of:inserting a probe into a heart of a living subject, the probe having a distal portion, a position sensor and an ablation electrode being disposed on the distal portion;
navigating the probe into a contacting relationship with a target tissue of the heart and activating the ablation electrode;
obtaining a first reading of the position sensor to obtain a first position of the probe in the heart;
acquiring a first magnetic resonance thermometry image of the target tissue at the first position; and
thereafter during ablation iteratively performing the steps of:
taking new readings of the position sensor to obtain second positions of the probe in the heart;
acquiring a new magnetic resonance thermometry image of the target tissue only when a distance between the first position and one of the second positions is less than a predetermined distance; and
analyzing the first magnetic resonance thermometry image and the new magnetic resonance thermometry image to determine a temperature of the target tissue.

US Pat. No. 10,555,773

SIMULATOR, INJECTION DEVICE OR IMAGING SYSTEM PROVIDED WITH SIMULATOR, AND SIMULATION PROGRAM

HIROSHIMA UNIVERSITY, Hi...

1. A simulator, which is configured to predict a change with time of a pixel value in a tissue of an object, comprising:an object information acquisition unit configured to acquire information on the object;
a protocol acquisition unit configured to acquire an injection protocol for a contrast medium;
a tissue information acquisition unit configured to acquire information on the tissue; and
a prediction unit configured to predict, based on the information on the object, the injection protocol, and the information on the tissue, a change with time of a pixel value of each of a plurality of compartments obtained by dividing the tissue along a blood flow direction, the prediction unit predicting the pixel value of a time point when a predetermined time elapses from a time point of a start of injection.

US Pat. No. 10,555,772

LASER ABLATION CATHETERS HAVING EXPANDED DISTAL TIP WINDOWS FOR EFFICIENT TISSUE ABLATION

Ra Medical Systems, Inc.,...

1. A laser ablation catheter to ablate blockages in body lumens using high energy and high power laser pulses, comprising:a liquid filled waveguide including an elongate catheter body tube having an inner layer with a first index of refraction and a biocompatible ultraviolet transparent optical fluid disposed within and completely filling an inner lumen of the elongate catheter body tube, with the optical fluid having a second index of refraction which is greater than the first index of refraction; and
an ultraviolet grade elongated distal optical window disposed in liquid sealed relation to a surface of the elongate catheter body tube at a distal end of the elongate catheter body tube, the distal optical window including:
a feed fiber optic made of ultraviolet grade silica including a core and a cladding and configured to act as a waveguide,
an insert segment which is disposed within a distal section of the elongate catheter body tube and which includes the core and the cladding configured to act as the waveguide, and
an expanded segment which is expanded from a nominal outer diameter of the feed fiber optic with the cladding melted and mixed with the core resulting in no cladding or dead space, which is larger in transverse dimension than the feed fiber optic so as to cover an outer diameter of the elongate catheter body tube, which is disposed distally of the insert segment, which is not configured to act as a waveguide, which has an outer diameter which is greater than an outer diameter of the insert segment, which has an output surface that has an area which is equal to or greater than an area of a transverse section of the elongate catheter body tube proximally adjacent the distal optical window and which has an axial length sufficient to allow optical energy expansion within the expanded segment such that optical energy emitted from the output surface ablates a hole in target tissue having a diameter equal to or greater than an outer diameter of the elongate catheter body tube proximally adjacent the distal optical window.

US Pat. No. 10,555,770

ELECTROSURGICAL TUBULAR SHAFT, SURGICAL INSTRUMENT GRIP AND ELECTROSURGICAL TUBULAR SHAFT INSTRUMENT

Aesculap AG, Tuttlingen ...

11. An electrosurgical tubular shaft instrument, comprising:a surgical instrument grip and an electrosurgical tubular shaft,
the surgical instrument grip comprising:
at least one coupling element for interacting with at least one corresponding coupling element of the electrosurgical tubular shaft for releasably coupling the electrosurgical tubular shaft to the instrument grip, and
at least one connecting element for releasably fixing at least one electric connection line of the electrosurgical tubular shaft to the instrument grip, wherein the instrument grip is void of any internal electrical contact members, and
the electrosurgical tubular shaft comprising:
a tube,
an electrosurgical tool arranged at a distal end of the tube,
the at least one electric connection line, which is electrically connected to the tool and extending in the tube,
the at least one corresponding coupling element, which is arranged at a proximal end of the tube for interacting with the at least one coupling element of the instrument grip for releasably coupling the instrument grip to the tubular shaft,
the tube comprising an outlet opening which is arranged distally of the at least one coupling element and through which the at least one connection line issues from the tube,
an electric connection element for an electric energy supply, which is arranged at the proximal end on the at least one connection line, and
at least one connecting element for interacting with the at least one connecting element of the instrument grip,
at least one contact member which extends from the connection element and is electrically connected to the at least one connection line,
the connection element of the electrosurgical tubular shaft comprises or forms the at least one connecting element of the electrosurgical tubular shaft, and
the at least one contact member of the electrosurgical tubular shaft extends from a portion of the at least one connecting element of the electrosurgical tubular shaft that is remote from the instrument grip.

US Pat. No. 10,555,763

DYNAMIC CERVICAL PLATE

Stryker European Holdings...

1. A spinal implant comprising:a first member having a ramp portion defining a first surface and a sidewall defining a second surface adjacent the first surface, the first member being configured to be mounted to a first vertebra;
a second member configured to be mounting to a second vertebra, the second member having an interference portion defining a third surface and being slidably coupled to the first member such that the first and third surfaces of the respective ramp and interference portions are disposed opposite each other and form a space therebetween, and wherein the second surface of the sidewall extends between the first and third surfaces and at least partially defines the space;
a bearing member disposed in the space situated between the first and third surfaces, the bearing member having a first position such that the bearing member is rotatable within the space and the first and second members are translatable with respect to one another and a second position in which the bearing member directly contacts both the first and third surfaces and prevents rotation of the bearing member and movement of the first and second members with respect to one another; and
an access hole extending through the sidewall and the second surface thereof such that the access hole is in communication with the space so as to permit access of an instrument therethrough such that when the bearing member is locked between the first and third surfaces, the instrument may extend through the second surface into the space between the first and third surfaces to dislodge the bearing member from being locked between the first and third surfaces.

US Pat. No. 10,555,760

BONE ATTACHMENT ASSEMBLY

Globus Medical, Inc., Au...

1. A bone attachment assemblycomprising: an attachment head;
a set screw configured to attach to the attachment head; and
a rod carrier pivotably coupled to the attachment head and having a rod surface with a first raised portion and a second raised portion that define a lowered portion positioned between the first raised portion and the second raised portion, wherein the rod carrier is pivotable about a lateral axis perpendicular to an axis of the attachment head,
wherein the first raised portion, the second raised portion, and the set screw are configured to directly contact a rod in order to retain the rod within the attachment head,
wherein a threaded screw shaft is attached to a base region of the attachment head, wherein, when the rod is positioned on a portion of the rod surface and the longitudinal axis of the rod is substantially perpendicular to the longitudinal axis of the threaded screw shaft, the first raised portion, the second raised portion, and a pointed tip of the set screw define three points of contact of the rod within the attachment head, wherein the rod is held within the attachment head by only the three points of contact.

US Pat. No. 10,555,756

MEDICAL DEVICES HAVING COAXIAL CANNULAE

Cook Medical Technologies...

1. A medical device, comprising:an outer cannula having an outer cannula lengthwise axis and an outer cannula circumferential wall extending between an outer cannula proximal end and an outer cannula distal end, the outer cannula circumferential wall defining an outer cannula interior lumen and a first side port opening extending through the outer cannula circumferential wall;
an inner cannula disposed within the outer cannula interior lumen and secured to the outer cannula, the inner cannula having an inner cannula lengthwise axis, an inner cannula circumferential wall extending between an inner cannula proximal end and an inner cannula distal end, the inner cannula circumferential wall defining an inner cannula interior lumen, a pattern of openings extending along a spiral path about the inner cannula lengthwise axis, and a second side port opening extending through the inner cannula circumferential wall and aligned with the first side port opening with respect to the inner cannula lengthwise axis;
a side port joint disposed between the outer cannula and the inner cannula and adjacent the second side port opening, the side port joint forming an attachment between the outer cannula and the inner cannula; and
a ramp member disposed within the inner cannula interior lumen and defining a ramp surface aligned with the second side port opening.

US Pat. No. 10,555,755

RETRACTABLE DEVICE

1. A self-locking retractable surgical knife, comprising:a sheath member having front and rear ends;
a retractable member including a support member and a blade supported by the support member, wherein the support member has a front end, a rear end and an elongated interior space;
the retractable member being partially disposed in the sheath member and telescopically received in the sheath member for movement between a guarded position wherein the blade is guarded in the sheath member, and an exposed position wherein the blade extends out of the sheath member;
top and bottom elongated and longitudinally extended slots formed on the support member, wherein the top slot is defined in a top wall of the support member and the bottom slot is defined in a bottom wall of the support member,
a biasing member disposed in the interior space of the support member;
a latch member disposed in the interior space of the support member, the latch member having a release button projecting through the top slot of the support member and an opening defined in a top wall of the sheath member in this order, the latch member having a bottom section projecting through the bottom slot of the support member and abut an inner surface of a bottom wall of the sheath member;
a compression member attached to the rear end of the sheath member at an attachment portion of the compression member, the compression member being tapered rearward from the rear end of the sheath member, the compression member being configured to bias the biasing member toward the rear end of the support member, wherein the rear end of the support member has a slot that allows the compression member to pass by; and
a self-locking mechanism configured to translate an axial movement of the retractable member when the retractable member is moving from the exposed position to the guarded position to rotation, thereby preventing the retractable member from moving forward relative to the sheath member and self-locking the retractable member in the guarded position.

US Pat. No. 10,555,750

ULTRASONIC SURGICAL INSTRUMENT WITH REPLACEABLE BLADE HAVING IDENTIFICATION FEATURE

Ethicon LLC, Guaynabo, P...

1. An apparatus comprising:(a) a body;
(b) a shaft assembly extending distally from the body, wherein the shaft assembly includes a support portion;
(c) an end effector portion, wherein the end effector portion is configured to selectively couple with the support portion of the shaft assembly;
(d) a data storage component associated with the end effector portion, the data storage component comprising a set of use data associated with the end effector portion, wherein the data storage component comprises a non-volatile electronic memory;
(e) a non-volatile electronic memory reader operable to receive the set of use data from the data storage component when positioned to allow a proximity connection to the non-volatile electronic memory; and
(f) a use control module comprising a processor and positioned within the body, wherein the processor is configured to:
(i) receive the set of use data from the non-volatile electronic memory reader,
(ii) determine that the end effector portion is usable based upon the set of use data and a set of usage parameters, and
(iii) where the end effector portion is usable, enable the end effector portion,
wherein the support portion is adapted to render the data stored on the data storage component unreadable as a result of the end effector portion being coupled to the support portion.

US Pat. No. 10,555,747

POWER MORCELLATION IN A PROTECTED ENVIRONMENT

University of South Flori...

1. A morcellation system, comprising:a pliable retaining carrier or pouch with a specimen-receiving opening that leads from an exterior of said retaining carrier to a substantially hollow interior of said retaining carrier,
said retaining carrier insertable into an operative internal cavity of a subject or patient,
said retaining carrier structured to receive a targeted, excised specimen within said substantially hollow interior; and
a plurality of elongate, flexible laparoscopic tool- or trocar-receiving channels extending externally from a lining of said retaining carrier at a spaced distance away from said specimen-receiving opening and at a spaced distance away from each other,
said plurality of channels each having a proximal end and a distal end, said proximal end configured to be withdrawn external to said body of said subject when said morcellation system has been inserted into said patient or subject,
said retaining carrier having a first position and a second position, said first position being a desufflated position within said operative internal cavity of said subject with said specimen-receiving opening being open, said second position being an insufflated position within said operative internal cavity of said subject with said specimen-receiving opening being closed or cinched, wherein said each channel is extended through a respective laparoscopic port on said body.

US Pat. No. 10,555,745

OBSTRUCTION RETRIEVAL DEVICES

1. A clot retrieval assembly comprising:an elongate wire having a length and a longitudinal axis;
a first retrieval device comprising:
a distal collar fixed stationary on the elongate wire;
a proximal collar being slideable along a portion of the length of the elongate wire; and
a plurality of shape memory elongate clot capturing elements that each has a proximal end coupled to the proximal collar and a distal end coupled to the distal collar, each of the plurality of shape memory elongate clot capturing elements having a proximal end portion and a distal end portion;
the first retrieval device being configured to automatically transition from a radially constrained state to a radially unconstrained expanded rest state, in the radially constrained state no portion of the plurality of shape memory elongate clot capturing elements is located proximal to the proximal collar and the proximal collar is located at a first axial position on the elongate wire proximal to the distal collar and is spaced apart from the distal collar by a first distance, in the radially unconstrained expanded rest state the proximal collar is located at a second axial position on the elongate wire proximal to the distal collar and is spaced apart from the distal collar by a second distance that is less than the first distance and at least some of the proximal portions of the plurality of shape memory elongate clot capturing elements are inverted around the proximal collar with at least some of the proximal portions of the plurality of shape memory elongate clot capturing elements being disposed proximal to the proximal collar, when the proximal collar is in the second axial position no portion of the proximal collar touches the distal end portions of the plurality of shape memory elongate clot capturing elements, when the first retrieval device is in the radially unconstrained expanded rest state the proximal collar is movable distally to a third axial position on the elongate wire proximal to the distal collar and is spaced apart from the distal collar by a third distance that is less than the second distance.

US Pat. No. 10,555,743

METHOD AND DEVICE FOR JOINT REPLACEMENT

Zimmer, Inc., Warsaw, IN...

1. A method of joint replacement of a patient, the method comprising:forming one or more portals adjacent a hip joint that includes, a femur with a femoral head and a pelvis with an acetabulum socket;
distracting the femoral head from the pelvis; and
inserting a hemiarthroplasty cup through one of the one or more portals, between a femoral head outer surface of the femoral head and an acetabulum outer surface of the acetabulum socket, wherein both of the femoral head outer surface and the acetabulum outer surface are unaltered;
wherein after inserting the hemiarthroplasty cup, the hemiarthroplasty cup can freely articulate against both the femoral head outer surface and the acetabulum outer surface; and
leaving the hemiarthroplasty cup freely articulable within the patient between the femoral head outer surface and the acetabulum outer surface to restore the hip joint.

US Pat. No. 10,555,735

TISSUE COMPRESSION ASSEMBLIES WITH BIODEGRADABLE INTERLINKS

Ethicon LLC, Guaynabo, P...

1. A magnetic anastomosis compression assembly, comprising:(a) a first compression device, comprising:
(i) a first arm,
(ii) a second arm, wherein the first arm and the second arm of the first compression device are pivotably attached to each other at a pair of joints along a single pivot axis at each joint of the pair of joints, wherein each joint of the pair of joints of the first compression device includes a magnet, and
(iii) a resilient member, wherein the resilient member of the first compression device is attached to the first arm and the second arm of the first compression device, wherein the resilient member of the first compression device is configured to bias the first arm and the second arm of the first compression device toward a collapsed configuration; and
(b) a second compression device, comprising:
(i) a first arm,
(ii) a second arm, wherein the first arm and the second arm of the second compression device are pivotably attached to each other at a pair of joints along a single pivot axis at each joint of the pair of joints, wherein each joint of the pair of joints of the second compression device includes a magnet, and
(iii) a resilient member, wherein the resilient member of the second compression device is attached to the first arm and the second arm of the second compression device, wherein the resilient member of the second compression device is configured to bias the first arm and the second arm toward a collapsed configuration;
wherein the first compression device and the second compression device are configured to be magnetically coupled together via the magnets.

US Pat. No. 10,555,730

DEFORMABLE SUTURE BRIDGE HAVING AN INSERT AND METHODS OF MANUFACTURING AND USING SAME

SUTUREGARD Medical, Inc.,...

1. A suture bridge, comprising:an elongated rigid insert having varying thicknesses and including a first material; and
a deformable shell including a second material, the second material being different than the first material, the shell at least partially surrounding the rigid insert,
wherein the insert and the shell collectively form a bridge body, the bridge body consisting of the insert and the shell and having a first leg including a first patient contacting surface configured to contact a patient's skin, a second leg spaced from the first leg and including a second patient contacting surface configured to contact the patient's skin, a first support connected to the first leg, a second support connected to the second leg, a first slot at least partially formed through a portion of the first leg, and a portion of the first support, a second slot at least partially formed through a portion of the second leg, and a portion of the second support, and a traversing member extending between the first support and the second support and configured and arranged to be spaced away from the patient's skin, wherein the bridge body includes a plurality of thicknesses from the first leg to the second leg, and the insert makes up a first percentage of a first thickness of the bridge body at the traversing member and a second percentage at a second thickness of the body at the first leg, the first percentage being greater than the second percentage.

US Pat. No. 10,555,701

PROBE FOR MEASURING LIP CLOSING FORCE

HIROSHIMA UNIVERSITY, Hi...

1. A probe for measuring a lip closing force, the probe comprising:a hollow balloon configured to be disposed between upper and lower lips of a subject, and crushed and deformed by the lip closing force; and
a base which communicates with the inside of the balloon, and is connected to a pressure measurement device for measuring an internal pressure of the balloon, wherein
the balloon is provided with a fixable portion that has the shape of a plate and that is configured to be sandwiched between teeth or gums of the subject, wherein the fixable portion is disposed at a medial portion of the balloon with respect to a vertical direction that is normal to a direction of insertion of the balloon when inserted between the lips.

US Pat. No. 10,555,691

VITAL SIGNS DETECTING DEVICE AND A METHOD FOR DETECTING VITAL SIGNS

Agency for Science Techno...

7. A method for detecting vital signs, the method comprising,inputting light into a first end of a multimode optical fiber;
providing a mechanical structure for disposition between a person's body and a support surface so as to receive a pressure exerted by the person's body as a result of one or more of a group consisting of a movement of the person's body, a respiratory action of the person's body and a heart beat action of the person's body and for causing microbending of the multimode optical fiber and associated bending losses under the exerted pressure, wherein the mechanical structure comprises a first layer and a second layer, and wherein the multimode optical fiber is disposed between the first and second layers and, more particularly, between a first set of microbending elements comprised in the first layer of the mechanical structure and a second set of microbending elements comprised in the second layer of the mechanical structure, substantially in a direction of the exerted pressure; and
detecting light modulation in the multimode optical fiber by a detector coupled to the multimode optical fiber and receiving the light therefrom to determine the one or more of the movement of the person's body, the respiratory action of the person's body and the heart beat action of the person's body based on light intensity variations caused by bending losses induced by the microbending.

US Pat. No. 10,555,690

STANDING POSTURE MEASURING DEVICE

1. A standing posture measuring device, consisting of:a base including a base platform and a base frame;
a right instrument support frame mounted on the base frame;
a left instrument support frame mounted on the base frame;
a shoulder inclination instrument including an upper rear bar supported on the right and left instrument support frames, the upper rear bar having a top surface, the shoulder inclination instrument comprising:
a right acromion pointer mounted on the upper rear bar at a first location that corresponds to a patient's right acromion process;
a left acromion pointer mounted on the upper rear bar at a second location that corresponds to a patient's left acromion process; and
an upper electronic spirit level mounted on the top surface of the upper rear bar and having an upper digital display for indicating shoulder inclination;
a pelvic inclination instrument comprising:
a lower rear bar supported on the right and left instrument support frames;
a first right movable arm;
a first left movable arm; and
a lower electronic spirit level mounted on the top surface of the lower rear bar and having a lower digital display for indicating pelvic inclination;
a leg measuring instrument, wherein the leg measuring instrument comprises:
a right laser ruler having a right laser housing, a right laser support band supported on the right instrument support frame and a right laser display; and
a left laser ruler having a left laser housing, a left laser support band supported on the left instrument support frame and a left laser display.

US Pat. No. 10,555,688

MEASUREMENT SYSTEM THAT INCLUDES AT LEAST ONE MEASUREMENT ASSEMBLY, A HEAD-MOUNTED VISUAL DISPLAY DEVICE, AND A DATA PROCESSING DEVICE

Bertec Corporation, Colu...

1. A measurement system, comprising:at least one measurement assembly, the at least one measurement assembly comprising a force measurement assembly configured to receive a first system user, the force measurement assembly including:
a top surface for receiving the body of the first system user; and
at least one force transducer, the at least one force transducer configured to sense one or more measured quantities and output one or more signals that are representative of forces and/or moments being applied to the top surface of the force measurement assembly by the first system user;
a head-mounted visual display device having an output screen, the head-mounted visual display device configured to display one or more images on the output screen so that the one or more images are viewable by a second system user; and
a data processing device operatively coupled to the force measurement assembly and the head-mounted visual display device, the data processing device configured to receive the one or more signals that are representative of the one or more measured quantities and to convert the one or more signals into force and/or moment output data, the data processing device further configured to generate a visual element for superimposition onto the first system user, and display the superimposed visual element on the head-mounted visual display device so that the second system user is able to visualize a particular parameter or characteristic associated with the first system user when wearing the head-mounted visual display device, wherein the data processing device is configured to generate the visual element using the force and/or moment output data from the force measurement assembly.

US Pat. No. 10,555,676

METHOD FOR GENERATING ALARMS/ALERTS BASED ON A PATIENT'S POSTURE AND VITAL SIGNS

SOTERA WIRELESS, INC., S...

1. A method for generating an alarm while monitoring vital signs and posture of a patient, the method comprising the following steps:(a) detecting a first time-dependent physiological waveform indicative of one or more contractile properties of the patient's heart with a first sensor comprising a first detector configured to be worn on the patient's body;
(b) detecting a second time-dependent physiological waveform indicative of one or more contractile properties of the patient's heart with a second sensor comprising a second detector configured to be worn on the patient's body;
(c) detecting a set of time-dependent motion waveforms with at least one motion-detecting sensor positioned on the patient's torso, wherein the set of time-dependent motion waveforms are indicative of motion of the patient's torso;
(d) receiving and processing the first and second time-dependent physiological waveforms and the set of time-dependent motion waveforms, and generating an alarm therefrom indicative of a need for medical attention, using one or more processing components comprising a microprocessor, the one or more processing components configured to
(i) process the first and second time-dependent physiological waveforms to determine at least one vital sign from the patient;
(ii) analyze at least a portion of the set of time-dependent motion waveforms, or a mathematical derivative thereof, to determine a vector corresponding to motion of the patient's torso;
(iii) compare the vector to a coordinate space representative of how the motion-detecting sensor is oriented on the patient to determine a posture parameter;
(iv) compare the posture parameter to a threshold value to estimate the patient's posture;
(v) compare the at least one vital sign from the patient to a predetermined alarm criteria, wherein an alarm is indicated by a variance of the vital sign relative to the predetermined alarm criteria to determine an alarm parameter; and
(vi) generate the alarm by collectively processing the patient's posture and the alarm parameter, wherein the alarm indicated by a variance of the vital sign relative to the predetermined alarm criteria is regulated according to the patient's posture.

US Pat. No. 10,555,675

METHOD FOR PROJECTING BLOOD LOSS OF A PATIENT DURING A SURGERY

Gauss Surgical, Inc., Me...

1. A method of monitoring a patient in a medical procedure, comprising:at one or more processors:
estimating real-time blood loss of the patient;
selecting at least one reference blood loss data set corresponding to a reference medical procedure;
estimating future blood loss of the patient based at least partially on the estimated real-time blood loss and the at least one reference blood loss data set; and
providing an indication of the estimated future blood loss of the patient on a display associated with the one or more processors.

US Pat. No. 10,555,662

IMAGE RECORDING APPARATUS, METHOD FOR CONFIGURING A CAMERA HEAD OF AN IMAGE RECORDING APPARATUS AND IMAGE RECORDING APPARATUS SET

1. An image recording apparatus comprising:a camera control unit and a camera head,
the camera head including an image signal pre-processing unit for generating an image signal stream, and
the camera control unit has an image signal processing unit,
wherein the camera head is releasably connectable to the image signal processing unit via an interface for transmitting the image signal stream,
a storage device of the camera head that contains camera-head-specific information is connectable via the interface to a configuration unit in the camera control unit, and
the configuration unit is set up
for receiving the camera-head-specific information from the connected storage device and
for reading configuration data for configuring the image signal pre-processing unit, corresponding to the camera-head-specific information, from a configuration data storage device of the camera control unit,
wherein the configuration data is updated and modified independently of the camera head, and for writing the configuration data to the image signal pre-processing unit,
the camera control unit is set up for configuring the image signal pre-processing unit with the configuration data, and
the image signal pre-processing unit is or comprises an FPGA unit or a combination of an FPGA unit and a microcontroller.

US Pat. No. 10,555,657

FLOOR TREATMENT APPARATUS

1. A floor treatment apparatus that is operable to receive inputs from direct contact with an operator and without direct contact with an operator to perform tasks, the floor treatment apparatus comprising:a chassis comprising a front, a back, a lower surface, a front surface adjacent the front, an upper surface, a rear surface located behind a center point of the chassis, a left surface, and a right surface;
a platform located partially between a portion of the right surface and the left surface and at least partially behind the rear surface, wherein the platform includes a top surface adapted to receive the feet of an operator and a throttle;
wherein the throttle comprises a pedal that protrudes above the top surface of the platform;
a steering mechanism associated with the chassis and having a portion accessible to an operator;
a floor treating device connected adjacent to the lower surface of the chassis, the floor treating device configured to at least one of scrub floors, clean carpets, vacuum floors, wax floors, burnish floors, remove wax from a floor, and remove varnish from a floor;
a squeegee that is operable to follow a path of travel of the floor treatment apparatus; and
a sensor having a defined relationship with respect to the chassis capable of generating information or receiving information from a remote location; and
the sensor in electrical communication with at least one of the steering mechanism and the throttle for at least one of controlling cleaning operations, redirecting the floor treatment apparatus, and varying a speed of the apparatus based on input from the sensor.

US Pat. No. 10,555,652

CYCLONE DUST COLLECTOR AND VACUUM CLEANER HAVING THE SAME

SAMSUNG ELECTRONICS CO., ...

1. A vacuum cleaner to collect dust, the vacuum cleaner comprising:a cyclone dust collector including:
a case including a bottom and an upper part;
a first cover couplable to the bottom of the case to selectively open and close the bottom of the case and includes a locking part,
a second cover configured to cover the upper part of the case, and
a grill assembly configured to be detachable from the cyclone dust collector as the first cover coupled to the bottom of the case is being opened to remove dust from the grill assembly while the grill assembly detaches from the cyclone dust collector, wherein the grill assembly is selectively couplable to and detachable from the second cover and includes a locking hole into which the locking part is inserted,
wherein the first cover further includes a sliding hole through which the locking part passes to be inserted into the locking hole to lock the first cover to the grill assembly.

US Pat. No. 10,555,650

CLEANER APPLIANCE

Dyson Technology Limited,...

1. A cleaning appliance comprising a cleaner head rotatably attached to a duct, the cleaner head comprising:a main body having an agitator chamber and an opening;
an end cap attachable to the main body to close the opening, the end cap forming an outer surface of the cleaner head when the end cap is attached to the main body;
an axle that extends into the agitator chamber;
a drive assembly comprising a motor, the drive assembly being mounted on the axle; and
an agitator mounted within the agitator chamber so as to surround the drive assembly, wherein the agitator is mounted at a first end on a bearing or bushing seated within the end cap, and the agitator is removable from the main body and the drive assembly through the opening,
wherein the motor of the drive assembly comprises a shaft that is coupled to the agitator such that torque generated by the motor is transmitted to the agitator via the shaft, the cleaner head rotates relative to the duct about a rotational axis, and the drive assembly is mounted along the axle such that the centre of gravity of the cleaner head is located on a vertical plane containing the rotational axis.

US Pat. No. 10,555,642

COFFEE GRINDING AND PROPORTIONING DEVICE, ESPECIALLY FOR ESPRESSO MACHINES

CGTECNICA S.R.L., Floren...

1. A device for grinding coffee or another grainy material, comprising at least one motor-driven grinding assembly, fed by a hopper and an output mouth, and from the output mouth of which a powder comprising the ground grainy material enters a distributor compartment, wherein said distributor compartment is functionally associated with means that measures the weight of the powder inside the distributor compartment, wherein further said distributor compartment internally accommodates an Archimedean screw, wherein the Archimedean screw is driven by a motor that rotates according to a pushing direction to obtain a precision evacuation of the powder contained inside said distributor compartment, said powder being so delivered to inside a filter of a filter-holder cup, wherein further a plurality of brushes are integrally associated with the lower part of said Archimedean screw, wherein said Archimedean screw rotates in the direction opposite to the pushing direction of the motor to homogenize and mix the powder that had been delivered to inside said distributor compartment by said at least one motor-driven grinding assembly.

US Pat. No. 10,555,635

CONNECTOR FOR REFILLING CONTAINER AND BEVERAGE DISPENSER

Societe des Produits Nest...

1. A connector for connecting a powder refilling container comprising at least one flexible wall with a storing powder tank of a beverage preparation machine wherein the connector is a tube, the tube presenting two ends,a first end is configured for piercing the at least one flexible wall of the powder refilling container and is further configured to attach to the at least one flexible wall,
a second end is configured for introduction in a receiving area of a powder inlet of the storing powder tank, and
wherein an external wall of the tube comprises at least one guiding groove and/or pin designed for guiding the tube in the receiving area of the powder inlet of the storing powder tank and for moving the tube in the receiving area.

US Pat. No. 10,555,626

HIDDEN DISPLAY CASE WITH OFFSET CENTER SEAM GLUE JOINT

INTERNATIONAL PAPER COMPA...

1. A method of forming a display case from a one-piece blank comprising a first panel, a second panel, a third panel and a fourth panel connected in series at respective first, second and third vertical fold lines, the second panel including a tear-away section defining a first portion of the second panel separated from a second portion of the second panel by a separation line, and the fourth panel including a main body and a secondary section connected to the main body at a fourth vertical fold line, the method comprising:applying a first manufacturer's joint strip to the first panel;
folding the first panel about the first fold line to engage the first panel on the tear-away section of the second panel;
applying a second manufacturer's joint strip to the fourth panel;
folding the fourth panel about the third fold line to engage the fourth panel on the first panel; and
pivoting the first and third panels to a position perpendicular to the main body of the fourth panel, wherein the tear-away section moves with the first panel to separate from the second portion of the second panel along the at least one separation line and forms an erected case with a display window.

US Pat. No. 10,555,622

DISPENSING DEVICE

1. A dispensing device comprising:a housing, the housing comprising:
a loading chamber,
a dispensing chamber located beneath the loading chamber and openable to dispense its contents, and
a gate or shutter which forms the base of the loading chamber and the upper wall of the dispensing chamber;
the gate or shutter being manually movable between a first, open position in which it is withdrawn from the housing and allows the contents of the loading chamber to drop into the dispensing chamber and a second, closed position in which it is received in the housing and prevents the contents of the loading chamber from dropping into the dispensing chamber;
wherein whenever the gate or shutter is moved from the closed position to the open position, the whole contents of the loading chamber are displaced into the dispensing chamber,
the dispensing device further comprising:
first indicating means which displays a first visible signal indicative that the gate or shutter has been moved from the closed position to the open position such that the loading chamber is empty, and
second indicating means which can be actuated by a user to display a second visible signal to indicate that the first signal has been observed,
wherein the second indicating means can be actuated only after the first visible signal has been displayed.

US Pat. No. 10,555,620

BABY CARRIER WITH TIES

The Boppy Company, LLC, ...

1. A baby carrier, comprising:a waist belt configured to wrap around a caregiver's waist;
a baby support coupled to the waist belt that is configured to support at least a portion of a baby adjacent the caregiver;
a left and a right shoulder strap that are configured to rest on a left and right shoulder of the caregiver, respectively, wherein the left and right shoulder straps are operably connected to or integrally formed with the baby support and each form a loop through which a left and right arm of the caregiver pass through to permit the left and the right shoulder straps to rest on the caregiver's left and rights shoulders; and
a left tie and a right tie, wherein one end of the left tie and the right tie are operably coupled to the baby support, the waist belt and/or the left and the right shoulder straps, respectively, and wherein the left tie and the right tie each have a free end to permit the left and the rights ties to be tied together to secure the baby carrier to the caregiver separately from the waist belt.

US Pat. No. 10,555,615

CALIBRATION OF DETECTION FEATURES FOR AUTOMATED FURNITURE

1. A non-transitory computer-readable storage medium including instructions that, when executed by a processor, cause the processor to:determine a first noise state associated with an environment of the furniture item based on a first measured noise received from one or more sensors associated with the furniture item;
generate a first baseline noise level for the furniture item based on filtering the first noise state associated with the environment of the furniture item;
determine a second noise state associated with the environment of the furniture item based on a second measured noise received from the one or more sensors associated with the furniture item;
generate a second baseline noise level for the furniture item based on filtering the second noise state associated with the environment of the furniture item; and
adjust the first baseline noise level to the second baseline noise level.

US Pat. No. 10,555,606

STAND FOR HOLDING BOTTLES UPSIDE DOWN

1. A device for holding a bottle upside down, comprising:a. a rigid wire frame comprising a metal-infused plastic, said frame having a plurality of horizontal interconnected layers for increasing the strength of the frame and collectively supporting the weight of said bottle, said plurality of horizontal interconnected layers being connected to each other via a plurality of substantially vertical connecting wires;
b. at least one foot; and
c. at least one bottle support comprising a substantially semi-spherical shape having a concave surface, and an upper edge having a plurality of raised, curving shoulders for contacting said bottle.

US Pat. No. 10,555,605

MODULAR SHELVING

1. A modular shelving apparatus, comprising:a first piece comprising a top surface, a bottom surface, a first end, a second end, a right side, and a left side; wherein a first channel, a second channel, a third channel, and a fourth channel are each formed in the first end or the second end of the first piece and each extend from the top surface to the bottom surface;
wherein a first tine, a second tine, a third tine, and a fourth tine are formed on the first piece, the first tine and the second tine and the third tine and the fourth tine are all on the first end or the second end of the first piece, wherein the first channel is located between the first tine and the second tine, the second channel is between the second tine and a middle section, the third channel is between the middle section and the third tine, the fourth channel is between the third tine and the fourth tine, wherein the middle section is located between the second channel and the third channel;
a second piece comprising a top surface, a bottom surface, a first end, a second end, a right side, and a left side; wherein a fifth channel, a sixth channel, a seventh channel, and an eighth channel are each formed in the second piece and each extend from the top surface to the bottom surface of the second piece;
wherein a fifth tine, a sixth tine, a seventh tine, and an eighth tine are formed on the second piece, the fifth tine and the eighth tine are both located on the second end of the second piece and the sixth tine and the seventh tine are both located on the first end of the second piece opposite the second end, the fifth channel is located between the fifth tine and a middle section, the sixth channel is located between the sixth tine and the middle section, the seventh channel is located between the middle section and the seventh tine, and the eighth channel is located between the middle section and the eighth tine, the sixth channel and the seventh channel are located between the fifth channel and the eighth channel, wherein the middle section is located between the fifth channel and the eighth channel and also between the sixth channel and the seventh channel;
a third piece comprising a top surface, a bottom surface, a first end, a second end, a right side, and a left side; wherein a ninth channel, a tenth channel, an eleventh channel, and a twelfth channel are each formed in the third piece and each extend from the top surface to the bottom surface of the third piece;
wherein a ninth tine, a tenth tine, an eleventh tine, and a twelfth tine are formed on the third piece, the ninth tine and the tenth tine and the twelfth tine are all located on the second end of the third piece and the eleventh tine is located on the first end of the third piece opposite the second end, the ninth channel located between the ninth tine and the tenth tine, the tenth channel is located between the tenth tine and a middle section, the eleventh channel is located between the middle section and the eleventh tine, and the twelfth channel is located between the middle section and the twelfth tine, wherein the middle section is located between the tenth channel and the twelfth channel and also between the tenth channel and the eleventh channel; wherein the third piece further comprises a first pair of grooves in the top and bottom surfaces of the third piece, wherein the first pair of grooves spans between the ninth channel and the first end of the third piece, a second pair of grooves in the top and bottom surfaces of the third piece, wherein the second pair of grooves spans between the tenth channel and the first end of the third piece, a third pair of grooves in the top and bottom surfaces of the third piece, wherein the third pair of grooves spans between the eleventh channel and the second end of the third piece, and a fourth pair of grooves in the top and bottom surfaces of the third piece, wherein the fourth pair of grooves spans between the twelfth channel and the first end of the third piece, wherein the first pair of grooves, the second pair of grooves, the third pair of grooves, and the fourth pair of grooves each have a first width and a first depth, wherein the ninth channel, the tenth channel, the eleventh channel, and the twelfth channel each have a second width and a second depth, wherein the second width is larger than the first width and the second depth is larger than the first depth;
wherein the first piece is configured to slide into the third piece with the first channel engaging the twelfth channel, and wherein the third piece is configured to slide into the second piece with the fifth channel engaging the ninth channel.

US Pat. No. 10,555,603

HEIGHT ADJUSTABLE WORKSTATION

LUMI LEGEND CORPORATION, ...

1. An adjustable workstation, comprising:a table top having an upper side and an opposed underside;
a legs assembly comprising at least a first scissor mechanism including a first leg and a second leg, a top of the first leg pivotally attached to the underside of the table top, a top of the second leg slidingly engaged with a groove attached to the underside of the table top;
a base frame, a bottom of the first leg comprising a roller engaged with a roller tray on the base frame, a bottom of the second leg pivotally attached to the base frame; and
an adjustment mechanism configured to move the legs assembly to adjust a height of the table top relative to the base frame, the adjustment mechanism comprising:
a rack and pinion mechanism comprising a first rack engaged with a pinion gear, the first rack mounted on a slide such that the first rack can move back and forth along the slide as the pinion gear rotates,
a first locking mechanism, comprising a spring loaded locking pawl configured to engage the first rack to prevent movement of the first rack,
a gas spring comprising a cylinder and a piston rod, wherein a free end of the piston rod is attached to the underside of the table, and an end of the cylinder is attached to the first rack, and
a first actuator configured to release the locking pawl to allow the first rack to move, wherein the first actuator comprises an actuator arm extending along an axis, an actuator handle positioned at a first end of the actuator arm, a first surface formed at an angle with respect the axis positioned at a second end of the actuator arm, and a movable housing having a second surface configured to slidingly contact the first surface so as to move along the first surface as the first actuator is actuated, wherein the spring loaded locking pawl is connected to the moveable housing, wherein movement of the moveable housing engages and disengages the locking pawl, wherein the first actuator is actuated by pulling the handle along the axis of actuator arm, and wherein the locking pawl moves along a second axis that is orthogonal to the axis of the actuator arm;
wherein, upon actuation of the actuator, the height of the table top relative to the base frame is adjustable, and upon release of the actuator, the height of the table top relative to the base frame remains fixed.

US Pat. No. 10,555,599

LOADOUT EXCHANGE SYSTEM

AARDVARK, Laverne, CA (U...

1. A loadout exchange system comprising:a back panel comprising a front side with a hook and loop surface, a back side with a MOLLE-compatible surface, and at least one strap; and
a front panel comprising a front side with a MOLLE-compatible surface, a back side with a hook and loop surface, and a first pull tab;
wherein the MOLLE-compatible surface of the back side of the back panel is configured for attachment to a MOLLE-compatible load-bearing platform using the at least one strap;
wherein the hook and loop surface of the front side of the back panel is complementary to the hook and loop surface of the back side of the front panel; and
wherein the MOLLE-compatible surface of the front side of the front panel is configured to receive at least one strap from a MOLLE-compatible pouch.

US Pat. No. 10,555,598

ATTACHMENT APPARATUS FOR MODULAR LOAD-CARRYING DEVICES

1. An apparatus for securing an accessory to a modular load-carrying device, comprising:a plurality of connectors, wherein each of the plurality of connectors comprises a first end, a body portion, and a second end, wherein the plurality of connectors is configured to attach the accessory to the modular load-carrying device;
a bridge comprising one or more openings formed therein; and
an attachment mechanism securing the plurality of connectors to the bridge via the one or more openings.

US Pat. No. 10,555,592

APPLICATION FOR TOPICAL COMPOSITION

SYMBIOTEC PHARMA LAB PVT....

1. An applicator for administering a composition to a target area comprising:an applying portion comprising a cavity with at least one open portion, the cavity comprising a porous volume and defined, at least in part, by at least one side wall, the side wall comprising at least one controlled-adaptation zone;
a dividing portion adjacent to, and opposite the at least one open portion of, the cavity; and
a target-area contacting portion adapted to create a seal between the at least one open portion of the cavity and the target area to which the composition is being applied;
wherein the controlled-adaptation zone is coupled to the target-area contacting portion and adapted to flexibly promote continuous contact between the target-area contacting portion and the target area.

US Pat. No. 10,555,591

EPILATION DEVICE MEASURING CONTACT FORCE AND COMPRISING A FEEDBACK UNIT

Braun GMBH, Kronberg (DE...

1. An epilation device for pinching and pulling out hairs from the skin of a user comprising:an epilation barrel comprising a plurality of clamping elements;
a drive unit for driving the epilation barrel into movement; and
a control unit for analyzing a contact pressure between the epilation barrel and the skin of a user and for determining whether the contact pressure is equal to or smaller than a lower threshold contact pressure and is equal to or larger than a first upper threshold contact pressure, wherein the drive unit is adapted to reduce the movement of the epilation barrel by a predetermined amount when the contact pressure is equal to or larger than the first upper threshold contact pressure.

US Pat. No. 10,555,584

BUTTON COVER AND METHOD OF USE

1. A button cover, comprising in combination:a button cover base;
a resilient button mounting wire having a central mounting section intermediate opposed, spaced-apart bent arms extending from the central mounting section; each bent arm having a resilient button clasp arced section intermediate a curled wire end and a bent section bending transverse to the button clasp arced section; the central mounting section being mounted within the button cover base;whereby the opposed curled wire ends may resiliently spread apart when a button component moves against and into the button clasp arced section.

US Pat. No. 10,555,580

ARTICLE OF FOOTWEAR AND METHOD OF MANUFACTURING AN ARTICLE OF FOOTWEAR

NIKE, Inc., Beaverton, O...

1. An article of footwear comprising:a sole structure including a polymeric bladder element enclosing a fluid-filled interior cavity;
wherein the polymeric bladder element has:
a peripheral flange displaced from a ground-engaging surface of the sole structure and that:
surrounds the fluid-filled interior cavity; and
includes a transverse edge extending from a lateral side of the polymeric bladder element to a medial side of the polymeric bladder element;
a surface of the peripheral flange has a groove that extends continuously and generally parallel with the transverse edge from the lateral side to the medial side and with the transverse edge and the groove disposed at a midfoot region of the article of footwear;
a reduced thickness at the groove;
a first length along a longitudinal midline of the polymeric bladder element from a longitudinal extremity of the polymeric bladder element to the groove; and
a second length along the longitudinal midline of the polymeric bladder element from the longitudinal extremity to the transverse edge;
wherein the first length corresponds with a first footwear size, and the second length corresponds with a second footwear size larger than the first footwear size.

US Pat. No. 10,555,575

PROTECTIVE HEADGEAR AND SHOULDER PAD APPARATUS AND METHODS

1. An apparatus, comprising:a) a helmet component having an interior surface comprising a padding component, and an exterior surface comprising a hard, impact-resistant material,
b) a shoulder pad component structured to cover the shoulder blades of a wearer and comprising a hard shell with foam padding underneath;
c) at least one force-directing member integrated as part of at least one of the front, the back, and the top, of the shoulder pad component;
d) a plurality of piers joined said helmet component and said shoulder pad component, and extending between said helmet component and said shoulder pad component,said plurality of piers being stucturally integrated into the helmet component and extending downward beyond a lower peripheral edge of the helmet component, and each pier of said plurality of piers having an end joined to said shoulder pad component, respectively, to form a unitary engineered network effective to selectively transfer impact forces from the helmet component through the plurality of piers, and the shoulder pad component to a wearer's shoulders and body in preference to a wearer's head, neck and spine;wherein said helmet component is structured to leave sufficient space between an inner surface of the helmet component and an outer surface of a separate, padded inner hat component, when the helmet component and the inner hat component are worn by said wearer, to permit the wearer to turn his or her head up, down and from side to side within the helmet component without the helmet component itself moving.

US Pat. No. 10,555,574

SUNSHADE CAP WITH MULTIPLE RETRACTABLE SUNSHIELD MEMBERS

1. A sunshade cap, comprising:(a) a cap body comprising
a crown configured for covering the top of a wearer's head, said crown including an exterior crown surface, an interior crown surface; a front crown portion, a rear crown portion, a left crown portion, a right crown portion, a bottom crown edge, a vertex, a front centerline, and a rear centerline;
a visor extending forwardly from the front crown portion adjacent to the bottom crown edge;
(b) a left sunshield member and a right sunshield member made of flexible foldable fabric permanently attached to said crown and configured for shading the left and right side of the wearer's face and being retractable on said crown, said left and right sunshield members being mirror images of each other having a shape, and wherein the left and right sunshield members each include a first side facing outward when retracted onto said crown, a second side facing toward said crown when retracted thereon, a front edge, a top edge, a bottom edge and a rear edge;
(c) a rear sunshield member made of flexible foldable fabric permanently attached to said crown configured for shading the hack of the wearer's neck and ears and being retractable on said crown, said rear sunshield member having a shape, and including a first side facing outward when retracted onto said crown, a second side facing inward toward said crown when retracted thereon, a top edge, a bottom edge, a left edge and a right edge;
(d) a plurality of permanent fastening members that permanently attach at least a portion of the second side of each of said left, right and rear sunshield members adjacent to said left, right, and rear bottom edges respectively onto said exterior crown surface adjacent to said bottom crown edge;
wherein said left sunshield member is attached on a left side of the front crown portion as well as on the left crown portion, and said right sunshield member is attached on a right side of the front crown portion as well as on the right crown portion, and forward of any attaching positions of said rear sunshield member; whereby said left and right sunshield members drape forwardly down a left and a right side respectively of said visor where in said left and right sunshield members are configured to forwardly shade the sides of the wearer's face and cheeks during deployment, and wherein the left and right sunshield members include an angle that is also configured to provide shading to the rear portion of the wearer's face and the ears;
wherein said rear sunshield member is attached on said left and right crown portions and/or on said rear crown portion adjacent to said left and right crown portions respectively, and rearward of any attaching position of said left and right sunshield members on said crown; whereby said rear sunshield member drapes down adjacent to the rear crown portion below the bottom crown edge and is configured to shade the back of the wearer's neck during deployment;
(e) at least one detachable fastening member configured at a position on each of said left and right sunshield members, and a plurality of detachable fastening members configured at positions on said rear sunshield member that secure in a position of retraction at least one angled folded flap formed on and extending outwardly from each of said left and right sunshield members and at least two angled folded flaps formed on and extending either outwardly or inwardly from said rear sunshield member;
wherein at least one detachable fastening member is disposed on an exterior side of each of said at least one angled folded flaps formed on said left and right sunshield members for coupling with at least one of the following: at least one detachable fastening member attached to said left and right sunshield members respectively; at least one detachable fastening member attached to said rear sunshield member; and at least one detachable fastening member attached to said crown;
wherein at least one detachable fastening member is disposed on either an exterior or an interior side of each of said at least, two angled folded flaps formed on said rear sunshield member that couples with at least one of the following: at least one detachable fastening member attached to said rear sunshield member, and at least one detachable fastening member attached to said crown, thereby securing said at least two angled folded flaps in their retracted position;
wherein each of said at least one angled folded flaps on said left and right sunshield members secured by detachable fastening members includes a first fold along a first fold line that starts from a central location of said left and right sunshield members respectively and ends at said rear edge of said left and right sunshield members respectively, and a second fold, folded in an opposite direction of said first fold, along a second fold line located above said first fold line and sharing the same starting focal point as the first fold from the central location and ending at either said top edge of said left and right sunshield members respectively or said rear edge of said left and right sunshield members respectively, so that said first fold forms a flap edge that rises up starting from the focal point at an angle defined by the angle between the first and second fold lines to form an angled folded flap that extends outwardly from said left and right sunshield members, and said second fold serving as an axis that guides said angled folded flap toward its position of retraction secured by detachable fastening members;
wherein two angled folded flaps on said rear sunshield member each secured by detachable fastening members include a first fold either inwardly or outwardly along a first fold line which starts from a central location of said rear sunshield member and ends at either an edge or folded edge of said rear sunshield member, and a second fold along a second fold line located either above or below said first fold line and in the opposite direction of said first fold, and sharing the same starting focal point as the first fold from the central location and ends at an edge or folded edge, wherein the first fold creates a flap edge defined by the angle between the first and second fold line to form an angled folded flap that extends either outwardly or inwardly from said rear sunshield member depending on the direction of the fold, and said second fold serving as an axis that guides said angled folded flap toward its position of retraction secured by detachable fastening members;
(f) a plurality of detachable fastening members attached to said crown within 5.1 cm of the vertex, and a plurality of detachable fastening members attached to said left, right and rear sunshield members, that detachably attach portions of said left, right and rear sunshield members on top of said crown during retraction;
wherein at least one detachable fastening member is disposed on said crown that couples with a corresponding detachable fastening member disposed adjacent to the front edge of each of said left and right sunshield members, so that the front edge of each of said left and right sunshield members is laid along the front centerline on top of said crown and secured near the vertex dining retraction;
wherein at least one detachable fastening member is disposed on said crown that couples with at least one corresponding detachable fastening member disposed on a top portion of said rear sunshield member; wherein the configuration of said detachable fastening members on both said crown and said rear sunshield member holds down and secures one or more folds on said rear sunshield member during retraction.

US Pat. No. 10,555,573

SEAMLESS BACK BUCKLE WITH CONCEALED FITTINGS

1. A seamless back buckle, comprising:a substrate and a plurality of rows of concealed fittings disposed on the substrate; wherein the substrate further comprises a surface layer and a bottom layer, an interlayer is disposed between the surface layer and the bottom layer, and the plurality of rows of concealed fittings are disposed in the interlayer; and a through hole is formed at a position corresponding to each fitting on the surface layer, and each through hole is communicated with an interior of the interlayer; and wherein an edge of the substrate is provided with a hemming structure.

US Pat. No. 10,555,572

ATHLETIC GARMENT WITH POCKETS

1. An athletic garment, comprising:an envelope pocket being disposed along an upper portion of the athletic garment;
the envelope pocket having an outer panel and an inner panel, the outer panel comprising of a compression material and being adapted to secure an object against the inner panel;
the envelope pocket having a height defined by a bottom portion and a top portion, and a width defined by a first seam and a second seam, the outer panel being coupled with the inner panel by the first seam and the second seam and at the top portion of the envelope pocket, forming a pocket cavity;
the outer panel having a pocket opening at the bottom portion of the envelope pocket; and
wherein the first seam is positioned along a first side of the athletic garment and the second seam is positioned along a center of a rear of the athletic garment such that the width of the envelope pocket extends between the first side of the athletic garment to the center of the rear of the athletic garment.

US Pat. No. 10,555,568

PREMATURE INFANT CLOTHING

1. A patient gown comprisinga plurality of panels and a plurality of detachable fasteners;
wherein the plurality of panels are interconnected using the plurality of detachable fasteners to form a plurality of garments;
wherein the plurality of detachable fasteners removably attach one or more panels selected from the plurality of panels to form a garment selected from the plurality of garments;
wherein the patient gown is a therapeutic garment;
wherein the patient gown is configured for use with a patient;
wherein the patient is a low birthweight infant receiving medical therapy;
wherein the therapy further comprises medical tubing;
wherein each of the plurality of panels is a textile;
wherein the plurality of detachable fasteners are adjustable such that any detachable fastener selected from the plurality of detachable fasteners can be reconfigured to accommodate the insertion of the medical tubing through the selected detachable fastener;
wherein the patient gown is configured for use with a cap;
wherein each garment selected from the plurality of garment comprises one or more panels selected from the plurality of panels and one or more detachable fasteners selected from the plurality of detachable fasteners;
wherein no permanent attachments are used to assembly any garment selected from the plurality of garments;
wherein each of the plurality of detachable fasteners is a hook/loop surface;
wherein each of the plurality of garments is an article of apparel that is worn by the patient;
wherein the assembly of any garment selected from the plurality of garments allows for the medical tubing required for the care of the patient to be inserted through the selected garment at any point along any seam that joins two panels selected from the plurality of panels;
wherein the plurality of panels comprises a first panel, a second panel, a third panel, a fourth panel, a fifth panel, a sixth panel, and a seventh panel;
wherein the first panel is a textile that is cut in the shape of a cruciform;
wherein the second panel is a textile that is cut in the shape of a rectangle;
wherein the third panel is a textile that is cut in a rectilinear shape;
wherein the fourth panel is a textile that is cut in a rectilinear shape;
wherein the fifth panel is a textile that is cut in a rectilinear shape;
wherein the sixth panel is a textile that is cut in the shape of a rectangle;
wherein the seventh panel is a textile that is cut in the shape of a rectangle;
wherein the first panel is further defined with a first edge, a second edge, a third edge, a fourth edge, a fifth edge, a sixth edge, a seventh edge, and an eighth edge;
wherein the second panel is further defined with a ninth edge, a tenth edge, an eleventh edge, and a twelfth edge;
wherein the third panel is further defined with a thirteenth edge, a fourteenth edge, a fifteenth edge, a sixteenth edge, a seventeenth edge, an eighteenth edge, a nineteenth edge, a twentieth edge, a twenty-first edge, and a twenty-second edge;
wherein the fourth panel is further defined with a twenty-third edge, a twenty-fourth edge, a twenty-fifth edge, a twenty-sixth edge, a twenty-seventh edge, and a twenty-eighth edge;
wherein the fifth panel is further defined with a twenty-ninth edge, a thirtieth edge, a thirty-first edge, a thirty-second edge, a thirty-third edge, and a thirty-fourth edge;
wherein the sixth panel is further defined with a thirty-fifth edge, a thirty-sixth edge, a thirty-seventh edge, and a thirty-eighth edge;
wherein the seventh panel is further defined with a thirty-ninth edge, a fortieth edge, a forty-first edge, and a forty-second edge.

US Pat. No. 10,555,566

IMPACT PROTECTION SYSTEMS

PINWREST DEVELOPMENT GROU...

1. A protection system, comprising:a) at least one interconnected mesh plate element network comprising a plurality of plate elements substantially evenly spaced from one another in an arrayed pattern, the plurality of plate elements being made from a hard plastic material; and
b) at least one liner disposed adjacent to the at least one interconnected mesh plate element network, the at least one liner being made from a different material than the plurality of plate elements,
wherein the at least one interconnected mesh plate element network includes a first interconnected mesh plate element network and a second interconnected mesh plate element network that overlap one another, and wherein the plurality of plate elements of the first interconnected mesh plate element network are disposed adjacent to and laterally offset from corresponding plate elements of the second interconnected mesh plate element network.

US Pat. No. 10,555,565

REFLECTIVE ARTICLES OF WEAR

NIKE, Inc., Beaverton, O...

1. An upper torso reflective garment comprising:a webbed structure having a plurality of apertures, wherein the webbed structure is formed from a plurality of intersecting reflective elastomeric strands, the webbed structure comprising:
(1) a front panel;
(2) a back panel; and
(3) a pair of shoulder straps that connect the front panel and the back panel;
wherein:
the front panel, the back panel, and the pair of shoulder straps define a neck opening, and a pair of armhole openings,
each aperture in the plurality of apertures comprises a shape having at least a first axis and at least a second axis,
the first axis of at least one aperture located on the back panel is oriented orthogonal to a hypothetical vertical axis,
the second axis of the at least one aperture located on the back panel is oriented parallel to the hypothetical vertical axis; and
the at least one aperture is deformable to a first degree in a direction that is parallel to the first axis and is deformable to a second degree in a direction that is orthogonal to the first axis.

US Pat. No. 10,555,560

HEATER MANAGEMENT

Altria Client Services LL...

1. An aerosol-generating system comprising:a main body configured to receive an aerosol-forming substrate;
a cartridge including a heater, the cartridge configured to couple with the main body, the heater configured to heat the aerosol-forming substrate;
a power supply configured to supply a current to the heater; and
electric circuitry connected to the heater and to the power supply, the electric circuitry including a memory, the electric circuitry configured to,
detect a coupling of the cartridge to the main body,
determine an initial resistance of the heater in response to the detection of the coupling of the cartridge to the main body,
determine a subsequent resistance of the heater, and
determine a presence of an adverse condition based on a resistance change of the heater compared to a threshold value stored in the memory, the resistance change of the heater based on the determined initial resistance and the subsequent resistance.

US Pat. No. 10,555,559

ELECTRONIC VAPOR PROVISION DEVICE

Nicoventures Holdings, Li...

1. An electronic vapor provision device comprising:a liquid store;
a wicking element configured to wick liquid from the liquid store to a heating element for vaporizing the liquid;
an air outlet for vaporized liquid from the heating element; and
a heating element support configured to support the heating element, wherein the heating element is on the inside of the heating element support, and wherein the heating element support is the wicking element,
wherein the heating element support comprises a first support section and a second support section, and wherein the heating element is supported between the first support section and the second support section.

US Pat. No. 10,555,556

CARTRIDGE FOR AN AEROSOL-GENERATING SYSTEM

Philip Morris Products S....

1. A cartridge for use in an aerosol-generating system, comprising:a liquid storage portion, comprising a housing configured to hold a liquid aerosol-forming substrate, the housing having an opening, wherein the liquid storage portion comprises at least two parts in fluid communication with each other,
a first part of the liquid storage portion comprising
a first capillary material, provided in a vicinity of the opening of the housing, and
a second capillary material in fluid contact with the first capillary material and spaced apart from the opening by the first capillary material, and
a second part of the liquid storage portion comprising a container configured to hold the liquid aerosol-forming substrate and to supply the liquid to the second capillary material.

US Pat. No. 10,555,555

AEROSOL-GENERATING ARTICLE AND ELECTRICALLY OPERATED SYSTEM INCORPORATING A TAGGANT

PHILIP MORRIS PRODUCTS S....

1. A method of controlling an aerosol-generating system,the system comprising:
an aerosol-generating article including an aerosol-forming substrate and at least one component incorporating a taggant having an identifiable spectroscopic signature within a material of the at least one component; and
an aerosol-generating device, comprising:
a cavity configured to at least partially receive the aerosol-generating article;
a power supply configured to supply power to at least one heating element to heat the aerosol-forming substrate to form an aerosol;
control circuitry connected to the power supply; and
a detector configured to detect the presence of the aerosol-generating article and to detect the identifiable spectroscopic signature of the taggant;
wherein the control circuitry is configured to distinguish the aerosol-generating article from other articles configured for use with the aerosol-generating system, based on the spectroscopic signature detected by the detector, and
wherein the taggant is distributed throughout the material,
the method comprising:
detecting, by the detector, a presence of the aerosol-generating article;
determining, by the control circuitry, whether the aerosol-generating article comprises the taggant;
comparing, by the control circuitry, the spectroscopic signature of a detected taggant with a look-up table of taggant spectroscopic signatures corresponding to aerosol-generating articles configured for use with the aerosol-generating system;
preventing, by the control circuitry, activation of the aerosol-generating device, including preventing the supply of power to the at least one heating element, unless the detected taggant spectroscopic signature corresponds to the aerosol-generating article configured for use with the aerosol-generating system; and
activating, by the control circuitry, the aerosol-generating device if the detected taggant spectroscopic signature corresponds to the aerosol-generating article configured for use with the aerosol-generating system.

US Pat. No. 10,555,553

FILTER WITH IMPROVED HARDNESS AND FILTRATION EFFICIENCY

Philip Morris Products S....

1. A smoking article comprising:an aerosol generating substrate; and
a mouthpiece attached to the aerosol generating substrate, the mouthpiece comprising a segment comprising:
a filtration material comprising polylactic acid; and
an additive for reducing phenols;
wherein the additive comprises a mixture of triacetin with cellulose acetate flakes.

US Pat. No. 10,555,552

AEROSOL GENERATING DEVICE WITH PIERCING ASSEMBLY

Altria Client Servies LLC...

1. An electrically heated aerosol-generating device for use with a consumable cartridge comprising a storage portion containing an aerosol-forming substrate, the storage portion having a fluid permeable internal surface surrounding an open ended passage extending through the cartridge, the device comprising:a main housing having a cavity for receiving a cartridge;
a closure body engageable with the main housing to enclose the cartridge in the cavity; and
a heater assembly for heating the cartridge, the heater assembly including,
an elongate piercing assembly configured to extend into the open ended passage of the cartridge and defining an internal airflow passage forming part of an airflow pathway through the device, the elongate piercing assembly including,
a first hollow shaft portion connected to the main housing, the first hollow shaft portion having a first piercing surface at a distal end thereof, the first piercing surface configured to break through a first frangible seal across a first end of the open ended passage when the cartridge is inserted into the cavity, and
a second hollow shaft portion connected to the closure body, the second hollow shaft portion having a second piercing surface at a distal end thereof, the second piercing surface configured to break through a second frangible seal across a second end of the open ended passage when the closure body is engaged with the main housing, the first and second hollow shaft portions extending along a same longitudinal axis when the closure body is engaged with the main housing, and the first and second hollow shaft portions being sized to meet at a junction such that the elongate piercing assembly extends along an entire length of the cavity when the closure body is engaged with the main housing; and
at least one electric heater fixed to the elongate piercing assembly, the at least one electric heater having at least one heating element for heating the aerosol forming substrate when the cartridge is enclosed in the cavity.

US Pat. No. 10,555,546

BLADE FOR SHAVING ICE

Snowie LLC, Salt Lake Ci...

1. A system for shaving ice comprising:a cabinet;
a hopper attached to said cabinet;
a drive motor disposed within said cabinet;
a stationary arcuate blade fixed relative to said cabinet, the blade comprising a plurality of slots adjacent to a plurality of corresponding teeth, wherein at least one of the plurality of corresponding teeth are offset relative to the plurality of corresponding teeth and offset relative to a centerline of the arcuate blade, wherein the centerline of the arcuate blade intersects each of the plurality of slots along an arc of the arcuate blade;
a control mechanism for activating and deactivating said drive motor;
a spout configured for dispensing conditioned ice; and
a scraper mechanically connected to said drive motor, such that when said drive motor is activated, the scraper rotates and scrapes ice against said arcuate blade thereby conditioning the ice.

US Pat. No. 10,555,538

LOIN PULLER SCRIBE SAW ASSEMBLY

Hall Fabrication, Inc., ...

1. A scribe saw assembly for a loin puller machine, comprising:a standard to drivingly support a scribe saw rotary blade;
a rotary scribe saw blade mounted on the standard for cutting a carcass middle;
a motor operatively connected to the blade for rotating the blade;
a pinion gear and a bevel gear meshingly mounted in the standard, with the motor drivingly connected to the pinion gear and the blade drivingly connected to the bevel gear; and
a shaft interconnecting the bevel gear and the blade, and a pair of bearings on the shaft to eliminate shaft deflection.

US Pat. No. 10,555,514

FLY FISHING LINE AND METHOD FOR MANUFACTURING SAME

Scientific Anglers LLP, ...

1. A fly fishing line comprising:an elongated core; and
a coating disposed around the elongated core, wherein the coating comprises a polymer resin, a co-polymer of silicone, and one or more other polymeric materials,
wherein the co-polymer of silicone is a fluorinated polydimethylsiloxane, a fluorinated polydimethylsiloxane propylhydroxy copolymer, or a combination thereof.

US Pat. No. 10,555,510

FISH PUMPING SYSTEM AND METHOD

COOKE AQUACULTURE INC., ...

1. A fish pumping system for moving upload water and fish, comprising:a) an upload pipe section, a buffer pipe section downstream of the upload pipe section, and a fish delivery pipe section downstream of the buffer pipe section,
b) an inlet valve assembly between the upload pipe section and the buffer pipe section, and an outlet valve assembly between the buffer pipe section and the fish delivery pipe section
c) an inlet branch pipe extending from the inlet valve assembly and providing a water inlet to the inlet valve assembly, and an outlet branch pipe extending from the outlet valve assembly and providing a water outlet from the outlet valve assembly;
d) a production water reservoir; and
e) a production water piping circuit connected to said inlet branch pipe, to said outlet branch pipe, and to said production water reservoir, the production water piping circuit forming a loop with said buffer pipe section, said production water circuit comprising a pump and valves for alternatingly (i) pumping production water from said production water reservoir into said buffer pipe section through said inlet branch pipe, and (ii) pumping production water out from said buffer pipe section through said outlet branch pipe into said production water reservoir, for moving said upload water and fish from said upload pipe section through said buffer pipe section into said fish delivery pipe section.

US Pat. No. 10,555,509

NESTING CRAB TRAP

1. A nesting crab trap comprising: a top ring and a bottom ring with an outer diameter that is slightly smaller than the inner diameter of the top ring connected to each other by at least six vertical support bars; a semi-circular top bar; at least two rounded nesting supports; at least two tunnels that are each attached to two of the vertical support bars; at least two escape rings attached to the top ring; steel netting; nylon netting; and at least two cathodic bars attached to the bottom ring; wherein the round nylon netting is stretched over and securely attached to one half of the top ring and to the entire semi-circular top bar such that when the semi-circular bar is placed over the other half of the top ring, a flat nylon netting top is created; steel netting is stretched across and securely attached to the entire bottom ring and between the vertical support bars from the bottom ring to the top ring except over the two tunnels and the escape rings; steel netting is securely attached to the top, bottom and two sides of the tunnels; the interior walls of the two tunnels have inwardly rotatable prongs that allow crabs to enter but not to exit; the rounded nesting supports are attached to the vertical support bars that are not attached to entry cages such that the tops of the rounded nesting supports are at the same height as the top of the tunnels and the rounded nesting supports protrude toward the center to a diameter that is smaller than the outer diameter of the bottom ring.

US Pat. No. 10,555,503

ANIMAL CONTROL DEVICE

Lucas Keller, Mapleton, ...

1. An animal control device, comprising:a stem having a gripping portion at a first end and an electric prod head connected to a second end;
a paddle body connected to a hollow stem between the gripping portion and the electric prod head; and
a flap door formed from a portion of a top wall that extends from a fold line.

US Pat. No. 10,555,466

MODULAR AUTOMATED GROWING SYSTEM

1. A growth system for growing vegetation, the system comprising:a plurality of modular growing units configured for supporting vegetation, wherein each of the plurality of modular growing units define a root zone and a vegetative zone;
a lighting system comprising a plurality of lighting units configured to maintain a constant intensity of light within at least two spectral regions, wherein each of the plurality of lighting units is associated with a respective modular growing unit of the plurality of the modular growing units, wherein each of the plurality of lighting units includes at least one lighting node, wherein the at least one lighting node is configured for selectively emitting one or both of a first wavelength of light from a first spectral region of the at least two spectral regions into the vegetative zone and a second wavelength of light from a second spectral region of the at least two spectral regions into the vegetative zone so as to maintain the constant intensity of light;
an unpressurized reservoir configured for housing a fluid containing one or more nutrients;
a nutrient feeding system configured for fluidly connecting each of the plurality of modular growing units to the unpressurized reservoir in parallel, wherein the nutrient feeding system includes a respective quick connect valve associated with each of the plurality of modular growing units; and
a pump in fluid communication between the unpressurized reservoir and the plurality of modular growing units, wherein the pump is configured for drawing the fluid from the unpressurized reservoir to the nutrient feeding system,
wherein when one or more of the plurality of modular growing units is connected to the respective quick connect valve, the nutrient feeding system directs the fluid to the modular growing unit,
wherein when one or more of the plurality of modular growing units is disconnected from the respective quick connect valve, the quick connect valve is configured for preventing the fluid from flowing from the unpressurized reservoir through the respective quick connect valve, and the other modular growing units connected to the nutrient feeding system remain fluidly connected to the unpressurized reservoir.

US Pat. No. 10,555,465

SINGLE STEP HYDROPONIC PLANTING CUP

1. A hydroponic planting cup system comprising:a hydroponic planting cup comprising:
a body having an outer-surface;
a hollow first-inner-volume with an inner-surface integral to the body including;
a bottom-opening configured to allow or remove nutrient solution from the hollow first-inner-volume,
an inner-opening with dimensions smaller than the bottom-opening, and
a hollow second-inner-volume configured to provide smaller dimensions with respect to the first inner-volume and in linear alignment above the hollow first-inner-volume forming a coupling through the inner-opening, the hollow second-inner-volume provides an outer-opening at the top of the body and is configured to allow a developing plant access through and outside of the body; and
at least one medium within the hollow first-inner-volume, the at least one medium having wicking and anti-fungal properties.

US Pat. No. 10,555,460

AUTOMATED DRONE FOR HARVESTING PRODUCE

Amrita Vishwa Vidyapeetha...

1. A system for harvesting produce, comprising:a drone having a body, and capable of hovering flight;
a first video camera on the body of the drone gathering visual data;
global positioning system (GPS) circuitry in the drone reporting GPS position of the drone;
an articulated arm extending from the body of the drone, the arm capable of extension, retraction and lateral movement relative to the body of the drone;
a second video camera mounted at an end of the articulated arm away from the body of the drone;
a laser gun cutting implement mounted to rotate under power to sweep a laser beam around a vertical axis, the laser gun having a laser controller with a transceiver, the laser gun cutting implement mounted at the end of the articulated arm;
a remote control station having a display screen, wireless communication circuitry, and input mechanisms enabling an operator to manually enter commands to control flight movement of the drone, operation of the articulated arm, and power and movement of the laser gun cutting implement;
software executing on a processor in the remote control station;
a pre-stored flight path followed by the software, that accomplishes an automated flight path for the drone, guiding the drone to a tree having fruit to be harvested, according to a stored GPS location; and
circuitry in the body of the drone enabling two-way communication with the remote control station, transmission of video data from the video camera, and response to manually-entered commands from the remote control station;
wherein the software is configured to automatically guide the drone to a tree, cause the drone to enter an observation pattern, determine if there is produce available, and determine if the produce is ready to harvest, and wherein, if there is produce ready to harvest, the drone is guided by manually-entered commands by the operator to position the laser gun cutting implement proximate a stem supporting the produce ready to harvest, to power on the laser, and to operate the laser gun cutting implement to sweep the laser beam horizontally, cutting the supporting stem, separating the produce from the tree.

US Pat. No. 10,555,458

LEAF SHREDDER TRIMMER ATTACHMENT

1. A modular leaf shredder, the modular leaf shredder comprising:a housing comprising an upper portion and a lower portion, the housing comprising a plurality of interlocking housing subsections; and
a trimmer connector that is mounted on the housing and forms a physical connection with a cooperating member of a trimmer, thereby allowing the housing to physically join the trimmer;
wherein the upper portion comprises an approximately dome shaped structure arranged above the lower portion, and the lower portion comprises an approximately tubular structure, with the upper portion being tapered from a border with the lower portion towards the trimmer connector;
wherein the housing of the modular leaf shredder is fully encloses a trimmer head arranged at the end of a shaft, the trimmer head comprising a rotating head and a plurality of cutting wire sets protruding from the rotating head within the perimeter of the housing, the plurality of cutting wire sets being oriented to protrude from the rotating head at multiple angles such that a first set of cutting wires protrudes parallel to ground when the trimmer is activated, a second set of cutting wires protrudes below the first set of cutting wires, and a third set of wires protrudes above the first set of cutting wires; and
wherein the housing comprises at least one opening at a bottom edge of the housing allowing leaves to enter the housing through the at least one opening.

US Pat. No. 10,555,457

LAWN MOWER ROBOT

LG ELECTRONICS INC., Seo...

1. A lawn mower robot, comprising:an inner body;
an outer cover configured to surround an outer side of the inner body;
a plurality of blades rotatably provided on a bottom surface of the inner body to cut grass;
casters pivotably provided near front sides of the inner body to be pivotable about a rotation shaft;
wheels rotatably provided near rear sides of the inner body and configured to roll on a surface;
a driving unit configured to drive the wheels; and
a sensor unit configured to sense whether one or more of the casters is lifted off the surface to stop rotation of the wheels by the driving unit,
wherein the sensor unit includes a drop switch configured to sense a downward movement of one or more of the casters when the one or more of the casters is lifted off the surface to be suspended in air,
wherein the sensor unit includes:
a shaft supporter received in a lower portion of the inner body and configured to be movable up and down, the shaft supporter provided to surround the rotation shaft of each caster and support the rotation shaft to rotate in place; and
a lowering protrusion formed on an outer circumferential surface of the shaft supporter,
wherein, when one or more of the casters is lowered relative to the inner body, the lowering protrusion is brought into contact with the drop switch to activate the drop switch and stop rotation of the wheels.

US Pat. No. 10,555,455

WORK VEHICLE WITH COMMODITY METERING SYSTEM AND AIRFLOW SYSTEM

1. A work vehicle comprising:a commodity container;
a volumetric metering assembly configured to meter a commodity by volume out from the commodity container along an axis;
a fan and an airflow structure that defines at least one air passage for an airstream at least in part from the fan, the airflow structure supported for movement relative to the volumetric metering assembly between a first position and a second position,
the airflow structure, in the first position, configured to receive units of the commodity travelling generally along the axis to be introduced into the airstream;
the airflow structure, in the second position, being spaced away from the volumetric metering assembly to provide unobstructed access to the volumetric metering assembly along the axis in an upstream direction.
US Pat. No. 10,556,931

BROAD SPECTRUM CONJUGATE VACCINE TO PREVENT KLEBSIELLA PNEUMONIAE AND PSEUDOMONAS AERUGINOSA INFECTIONS

UNIVERSITY OF MARYLAND, B...

1. A conjugate comprising a Klebsiella pneumoniae surface polysaccharide antigen and a Pseudomonas aeruginosa flagellin protein or antigenic fragment thereof, wherein the conjugate comprises i) Pseudomonas aeruginosa flagellin type A (FlaA) or an antigenic fragment thereof and/or Pseudomonas aeruginosa flagellin type B (FlaB) or an antigenic fragment thereof and ii) OPS from Klebsiella pneumoniae selected from the group consisting of Klebsiella pneumoniae serovars 01, 02a, 03, 05.
US Pat. No. 10,557,187

MAGNESIUM-LITHIUM ALLOY, ROLLED STOCK MADE OF MAGNESIUM-LITHIUM ALLOY, AND PROCESSED PRODUCT INCLUDING MAGNESIUM-LITHIUM ALLOY AS MATERIAL

SUBARU CORPORATION, Toky...

1. A magnesium-lithium alloy that contains not less than 10.50 mass % and not more than 16.00 mass % lithium, not less than 7.20 mass % and not more than 12.00 mass % aluminum, and not less than 2.00 mass % and not more than 8.00 mass % calcium.
US Pat. No. 10,555,908

DOSAGE FORM ARTICLES FOR DELAYED RELEASE

Capsugel Belgium NV, Bor...

1. A comestible dosage form article for administration to a target subject, the dosage form comprising:an outer capsule comprising a first cap telescopically engageable with a first body; and
an inner capsule, within the outer capsule, comprising a second cap telescopically engageable with a second body,
the inner capsule being in an inverted position with respect to the outer capsule such that, in an assembled state, the second cap is proximal to the first body and distal to the first cap;
wherein the outer and inner capsules are sized such that substantially no compartment is present between the inner and outer capsule.
US Pat. No. 10,556,934

CRYSTAL STRUCTURE OF THE LARGE RIBOSOMAL SUBUNIT FROM S. AUREUS

Yeda Research and Develop...

1. A composition-of-matter comprising a crystallized Staphylococcus aureus 50S large ribosomal subunit, wherein the crystallized 50S large ribosomal subunit effectively diffracts X-rays for calculating an electron density map and determination of atomic coordinates to a resolution of at least 4 ? and forms in a hexagonal space group with unit cell dimensions of a=279.6±10 ?, b=279.6±10 ?, c=872.7±10 ?, ?, ?=90°, ?=120°.
US Pat. No. 10,555,912

USE OF POLYMERIC EXCIPIENTS FOR LYOPHILIZATION OR FREEZING OF PARTICLES

Abraxis BioScience, LLC, ...

1. A method of preparing a lyophilized or frozen preparation of a composition comprising particles comprising a drug, wherein the particles are liposomes or micelles, and wherein the particles are coated with polyethylene glycol (PEG), the method comprising adding polyvinyl alcohol (PVA) to an aqueous composition comprising the particles, and lyophilizing or freezing the aqueous composition.
US Pat. No. 10,559,757

HOST MATERIAL FOR DELAYED FLUORESCENT MATERIALS, ORGANIC LIGHT-EMITTING DEVICE AND COMPOUND

KYULUX, INC., Fukuoka (J...

1. An organic light-emitting device comprising a layer that contains a delayed fluorescent material and a host material represented by the following general formula (1):(Tr)n-Z  General Formula (1)
wherein:
Tr represents a substituted or unsubstituted triphenylenyl group, and plural Tr's existing in the general formula (1) may be the same as or different from each other; Z represents a carbonyl group or a substituted or unsubstituted, n-valent aromatic hydrocarbon group; n represents an integer of 2 to 6, but when Z is a carbonyl group, then n is 2; and the substituted n-valent aromatic hydrocarbon group is a n-valent aromatic hydrocarbon group substituted by a hydroxy group, a halogen atom, a cyano group, an alkyl group having 1 to 20 carbon atoms, an alkoxy group having 1 to 20 carbon atoms, an alkylthio group having 1 to 20 carbon atoms, an alkyl-substituted amino group having 1 to 20 carbon atoms, an acyl group having 2 to 20 carbon atoms, an aryl group having 6 to 40 carbon atoms, an alkenyl group having 2 to 10 carbon atoms, an alkynyl group having 2 to 10 carbon atoms, an alkoxycarbonyl group having 2 to 10 carbon atoms, an alkylsulfonyl group having 1 to 10 carbon atoms, a haloalkyl group having 1 to 10 carbon atoms, an amide group, an alkylamide group having 2 to 10 carbon atoms, a trialkylsilyl group having 3 to 20 carbon atoms, a trialkylsilylalkyl group having 4 to 20 carbon atoms, a trialkylsilylalkenyl group having 5 to 20 carbon atoms, a trialkylsilylalkynyl group having 5 to 20 carbon atoms, a nitro group, or a substituent represented by the following general formula (2):
Tr4-CO—  General Formula (2)wherein Tr4 represents a substituted or unsubstituted triphenylenyl group,provided that when Z is a substituted or unsubstituted, n-valent aromatic hydrocarbon group, then at least one of the following conditions is satisfied:<1> at least one Tr is a substituted triphenylenyl group, and<2> Z is the substituted aromatic hydrocarbon group, and provided that at least one of the following conditions is satisfied Z is an n-valent aromatic hydrocarbon group substituted with a substituted or unsubstituted alkyl group or a substituted or unsubstituted aryl group, Z is a carbonyl group, at least one Tr has a substituent represented by the following general formula (2):Tr4-CO—  General Formula (2)wherein Tr4 represents a substituted or unsubstituted triphenylenyl group, and at least one Tr is a triphenylenyl group substituted with a substituted or unsubstituted alkyl group or a substituted or unsubstituted aryl group.
US Pat. No. 10,556,939

GLUCAGON/GLP-1 AGONISTS FOR THE TREATMENT OF OBESITY

MEDIMMUNE LIMITED, Cambr...

1. A method of treating a disease or condition caused or characterized by excess body weight, comprising administering to a subject in need of treatment an effective amount of the peptide HSQGTFTSDKSEYLDSERARDFVAWLEAGG (SEQ ID NO: 19).
US Pat. No. 10,555,918

2-AMINO-N?-BENZYLIDENEACETOHYDRAZIDES AND DERIVATIVES FOR THE MANAGEMENT OF CFTR PROTEIN MEDIATED DISEASES

Emory University, Atlant...

1. A method of treating cystic fibrosis comprising administering an effective amount of ((E)-N?-(3,5-dibromo-2,4-dihydroxybenzylidene)-2-(m-tolylamino)acetohydrazide or salt thereof to a human subject diagnosed with cystic fibrosis.
US Pat. No. 10,555,921

AMINO ACID COMPOSITIONS

ThermoLife International,...

1. An oral composition for human ingestion comprising:at least one isolated nitrate salt selected from the group consisting of a salt of an amino acid and an inorganic nitrate salt; and
at least one constituent amino acid selected from the group consisting arginine, agmatine, beta alanine, citrulline, creatine, glutamine, L-histidine, isoleucine, leucine, norvaline, ornithine, valine, aspartic acid, cysteine, glycine, lysine, methionine, proline, tyrosine, and phenylalanine,
wherein the isolated nitrate salt is a separate constituent from the at least one constituent amino acid and the oral composition is in a dosage form selected from the group consisting of a capsule, a cachet, a pill, a tablet, a pellet, a bead, a troche, a lozenge, and a gel.
US Pat. No. 10,556,948

IP-10 ANTIBODIES AND THEIR USES

BRISTOL-MYERS SQUIBB COMP...

1. An isolated monoclonal antibody, or an antigen-binding portion thereof, that binds human IP-10, comprising heavy and light chain variable regions, wherein the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 16.
US Pat. No. 10,555,924

METHODS OF REDUCING THE RISK OF A CARDIOVASCULAR EVENT IN A SUBJECT AT RISK FOR CARDIOVASCULAR DISEASE

Amarin Pharmaceuticals Ir...

1. A method of reducing risk of unstable angina in a subject with established cardiovascular disease, the method comprising administering to said subject about 4 g of ethyl icosapentate per day for a period effective to reduce risk of unstable angina in the subject.
US Pat. No. 10,556,950

HUMANIZED ANTIBODY FOR TREATING OR PREVENTING COGNITIVE DISORDERS, PROCESS FOR PRODUCING THE SAME, AND AGENT FOR TREATING OR PREVENTING COGNITIVE DISORDERS USING THE SAME

TEIJIN PHARMA LIMITED, (...

1. An anti-pSer413 tau antibody comprising:(A) (i) a variable heavy (VH) domain having an amino acid sequence of SEQ ID NO:20, and
(ii) a variable light (VL) domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(B) (i) a VH domain having an amino acid sequence of SEQ ID NO:22, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(C) (i) a VH domain having an amino acid sequence of SEQ ID NO:24, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(D) (i) a VH domain having an amino acid sequence of SEQ ID NO:26, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(E) (i) a VH domain having an amino acid sequence of SEQ ID NO:28, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114;
(F) (i) a VH domain having an amino acid sequence of SEQ ID NO:116, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114; or
(G) (i) a VH domain having an amino acid sequence of SEQ ID NO:117, and
(ii) a VL domain having an amino acid sequence of SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, SEQ ID NO:112, SEQ ID NO:113, or SEQ ID NO:114.
US Pat. No. 10,556,956

PHARMACEUTICAL COMPOSITIONS COMPRISING HUMANIZED ANTI-CCR4 IGG4 ANTIBODY

DANA-FARBER CANCER INSTIT...

1. A pharmaceutical composition comprising a humanized anti-CCR4 antibody in an amount effective to increase the ratio of effector T-cells to regulatory T-cells in or associated with a tumor present in a human subject to whom the pharmaceutical composition is administered one or more times,wherein the regulatory T-cells comprise CD4+ CD25highCD127dim/? Tregs and the effector T-cells comprise CD4+ CD25? Teffs,
wherein the humanized anti-CCR4 antibody has a heavy chain with three CDRs comprising the amino acid sequences GYTFASAW (SEQ ID NO: 9), INPGNVNT (SEQ ID NO: 11), and STYYRPLDY (SEQ ID NO: 13) respectively and a light chain with three CDRs comprising the amino acid sequences QSILYSSNQKNY (SEQ ID NO: 10), WASTRE (SEQ ID NO: 12), and HQYMSSYT (SEQ ID NO: 14) respectively, and
wherein the humanized anti-CCR4 antibody has an IgG4 heavy chain constant region.
US Pat. No. 10,557,212

ELECTROPOLISHING METHOD AND PRODUCT

Chemeon Surface Technolog...

1. A method for electropolishing an aluminum substrate comprising:submerging at least part of the aluminum substrate in an electrolyte solution comprising:
phosphoric acid;
at least one hydroxyalkyl (meth)acrylate monomer and/or hydroxyalkyl (meth)acrylate polymer;
supplying electrical current to the aluminum substrate from a power supply;
wherein the aluminum substrate is electrically coupled to a positive terminal of the power supply.
US Pat. No. 10,555,931

PHARMACEUTICAL COMBINATION FOR THE TREATMENT OF CANCER

PIRAMAL ENTERPRISES LIMIT...

1. A method of treating cancer comprising administering to a subject in need thereof voruciclib in a therapeutically effective amount to treat cancer, and a thioredoxin reductase inhibitor in a therapeutically effective amount to treat cancer, wherein:the cancer is selected from head and neck cancer, lung cancer, gastrointestinal cancer, blood or lymphatic system cancer, and breast cancer; and
the thioredoxin reductase inhibitor is selected from auranofin, ebselen, and arsenic trioxide.
US Pat. No. 10,556,957

ANTI-CD27 ANTIBODIES

1. An antibody or antigen binding fragment thereof that binds to human CD27, wherein the antibody or antigen binding fragment comprises:a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1, wherein X1=M;
a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2, wherein X1=N, X2=T, X3=N and X4=T;
a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, wherein X1=M;
a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4, wherein X1=M;
a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, wherein X1=D and X2=T; and
a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, wherein X1=W, X2=N and X3=S.
US Pat. No. 10,556,958

CD37-BINDING MOLECULES AND IMMUNOCONJUGATES THEREOF

Debiopharm International,...

1. An antibody or antigen binding fragment thereof that specifically binds to CD37, wherein said antibody or fragment comprises a variable heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO:171, a variable heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO:172 or SEQ ID NO:181, and a variable heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO:173, a variable light chain CDR1 comprising the amino acid sequence of SEQ ID NO:174, a variable light chain CDR2 comprising the amino acid sequence of SEQ ID NO:175, and a variable light chain CDR3 comprising the amino acid sequence of SEQ ID NO:176.
US Pat. No. 10,556,960

METHODS AND COMPOSITIONS FOR DIAGNOSIS AND TREATMENT OF DISORDERS IN PATIENTS WITH ELEVATED LEVELS OF TLR4 LIGANDS AND OTHER BIOMARKERS

NovImmune SA, Geneva (CH...

1. A method of alleviating a symptom in a subject having a disorder associated with excessive aberrant TLR4 signaling or elevated TLR4 ligand expression or activity, the method comprising:a) identifying a subject having an elevated level of expression of citrullinated fibrinogen and citrullinated histone 2b compared to a control level of expression; and
b) administering an anti-TLR4 antibody or an immunologically active fragment thereof that binds and neutralizes TLR4, in an amount sufficient to alleviate the symptom of the disorder.
US Pat. No. 10,555,939

FORMULATIONS OF 4-AMINO-2-(2,6-DIOXOPIPERIDINE-3-YL)ISOINDOLINE-1,3-DIONE

Celgene Corporation, Sum...

1. An oral dosage form in the form of a capsule which comprises: 1) pomolidomide at an amount of 0.1 to 3 weight percent of the total weight of the composition; 2) a binder or filler at an amount of 70 to 99 weight percent of total weight of the composition, wherein the binder or filler is a mixture of mannitol and starch; and wherein the ratio of mannitol:starch in the dosage form is from about 1:1 to about 1:1.5.
US Pat. No. 10,555,942

EMETINE COMPOUNDS FOR TREATMENT AND PREVENTION OF FLAVIVIRUS INFECTION

Florida State University ...

1. A method for treating or delaying the onset of Zika virus infection in a human or non-human animal subject, said method comprising administering an effective amount of cephaeline, or a pharmaceutically acceptable salt thereof, to a subject in need thereof.
US Pat. No. 10,556,970

METHOD FOR PREPARING HIGH TRANSPARENT LOW ACYL GELLAN GUM

DSM IP ASSETS B.V., Te H...

1. A method for preparing purified deacylated gellan gum from gellan gum fermentation broth, wherein the method comprises the following steps:1) Deacylation of gellan gum present in fermentation broth, to obtain deacylated gellan gum solution, followed by two-stage filtration consisting of steps 2) and 3);
2) First filtration of the deacylated gellan gum solution obtained in step 1), wherein a first added filter aid and filter medium are diatomite and/or perlite with permeability of 1 ?m2-8 ?m2;
3) Second filtration of the gellan gum solution obtained in step 2), wherein a second added filter aid or filter medium comprises diatomite and/or perlite with permeability of 0.1 ?m2-1.0 ?m2; and
4) Alcohol precipitation of the gellan gum solution obtained in step 3), drying, and milling to obtain the gellan gum product.
US Pat. No. 10,555,952

PHARMACEUTICAL COMPOSITIONS AND METHODS FOR ANESTHESIOLOGICAL APPLICATIONS

Melt Pharmaceuticals, Inc...

1. A method for treating or mitigating sedative-induced nystagmus in a patient in need of conscious sedation, procedural sedation, analgesia, pre-sedation or a non-general anesthesia prior to undergoing a medical procedure comprising administering to the patient an effective amount of a pharmaceutical composition, the pharmaceutical composition comprising:(a) a therapeutically effective quantity of a first pharmaceutically active compound selected from the group consisting of midazolam, diazepam, lorazepam, flunitrazepam, alprazolam, chlordiazepoxide, clonazepam and clorazepate, and pharmaceutically acceptable salts, hydrates, solvates or N-oxides thereof;
(b) a therapeutically effective quantity of a second pharmaceutically active compound selected from the group consisting of ketamine, dextrorphan, etomidate, methadone, memantine, amantadine, dextromethorphan, and pharmaceutically acceptable salts, hydrates, solvates or N-oxides thereof;
(c) optionally, a pharmaceutically suitable binder therefor; and
(d) optionally, a pharmaceutically acceptable excipient,
thereby preventing or mitigating the occurrence of sedative-induced nystagmus resulting from administering the second pharmaceutically active compound alone to the patient for conscious sedation, procedural sedation, analgesia, pre-sedation or a non-general anesthesia.
US Pat. No. 10,557,234

PAPERMAKING ADDITIVE COMPOSITIONS AND METHODS AND USES THEREOF

Neozyme International, In...

1. A papermaking additive composition comprising a treated, fermented yeast supernatant including bio-nutrients, minerals and amino acids, and about 1% to about 15% by weight of one or more nonionic surfactants, wherein the composition lacks any active enzymes due to the treatment, and wherein the composition has a pH of about 2.5 to about 5.0.
US Pat. No. 10,555,953

PHARMACEUTICAL COMPOSITION FOR TREATMENT OF INCREASED INTRAOCULAR PRESSURE

NOVALIQ GMBH, Heidelberg...

1. A pharmaceutical composition comprising:(a) a therapeutically effective amount of a poorly water-soluble prostaglandin analogue selected from the group consisting of latanoprost, bimatoprost, tafluprost, travoprost and unoprostone, and
(b) a liquid vehicle comprising a semifluorinated alkane selected from F4H5, F4H6, F6H6 and F6H8;wherein the composition is substantially free of water and free of a preservative, andwherein the composition is formulated as a solution, emulsion or suspension.
US Pat. No. 10,556,980

POLY ALKYL (METH)ACRYLATES GRAFTED NANOPARTICLES AND THEIR METHODS OF MANUFACTURE AND USE

University of South Carol...

1. A method of synthesizing a composite, the method comprising:covalently bonding a plurality of an anchoring compound to a nanoparticle;
covalently bonding a plurality of reversible addition-fragmentation chain-transfer (RAFT) agents to the anchoring compounds bonded to the nanoparticle, each of the RAFT agents being bonded to each one of the anchoring compounds;
polymerizing a stearyl methacrylate monomers to each one of the RAFT agents bonded to the anchoring compounds in a solvent solution comprising a mixture of solvents to form a graft-modified nanoparticle that includes a plurality of poly(stearyl methacrylate) (PSMA) polymer chains bonded to the nanoparticle, each of the PSMA polymer chains being bonded to each one of the RAFT agents via direct bonding between a terminal stearyl methacrylate of the PSMA polymer chain and the RAFT agent, the PSMA polymer chains consisting of PSMA polymer chains having a number average molecular weight of from 84,000 to 140,000 that are grafted to the nanoparticle at a chain density of from 0.11 chains per nm2 to 0.7 chains per nm2;
following the polymerization step, combining a plurality of the thus produced graft-modified nanoparticles with a polypropylene or a polyethylene to form a mixture; and
solution casting or melt-forming the mixture to form the composite of a polypropylene or polyethylene matrix with the plurality of the graft-modified nanoparticles dispersed therein without gross agglomeration of the nanoparticles within the polypropylene or polyethylene matrix.
US Pat. No. 10,555,713

METHODS FOR TREATING IDIOPATHIC PULMONARY FIBROSIS

FIBROGEN, INC, San Franc...

1. A method for increasing forced vital capacity percent predicted (FVC % predicted) in a subject with idiopathic pulmonary fibrosis (IPF), the method comprising administering at least 30 mg/kg of an anti-connective tissue growth factor (CTGF) antibody that has the same amino acid sequence as the antibody produced by the cell line identified by ATCC Accession No. PTA-6006, thereby increasing the subject's FVC % predicted.
US Pat. No. 10,556,228

ACIDIC AROMATIZATION CATALYST WITH IMPROVED ACTIVITY AND STABILITY

Chevron Phillips Chemical...

1. A supported catalyst comprising:a bound zeolite base, wherein the bound zeolite base comprises a binder and a large pore zeolite having an average pore diameter in a range of from about 7 ? to about 12 ?;
from about 0.3 wt. % to about 3 wt. % of a transition metal, wherein the transition metal comprises a Group 8-11 transition metal;
from about 1.8 wt. % to about 4 wt. % of chlorine; and
from about 0.4 wt. % to about 1.5 wt. % of fluorine, based on the total weight of the supported catalyst;
wherein the supported catalyst is characterized by a peak reduction temperature on a Temperature Programmed Reduction curve in a range from about 580° F. to about 800° F.
US Pat. No. 10,555,980

TREATMENT OF CLOSTRIDIUM DIFFICILE INFECTION

Vedanta Biosciences, Inc....

1. A method to suppress an abnormal or excessive immune response comprising administering a pharmaceutical composition comprising a purified bacterial mixture consisting of 7 or more bacterial strains comprising 16S rDNA sequences of at least 97% sequence identity to nucleic acid sequences selected from the group consisting of SEQ ID NO: 10, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, and SEQ ID NO: 21, to the subject in an amount sufficient to suppress the abnormal or excessive immune response.
US Pat. No. 10,555,471

SOYBEAN CULTIVAR S170082

M.S. Technologies, L.L.C....

1. A plant of soybean cultivar S170082, representative seed of said soybean cultivar having been deposited under ATCC Accession No. PTA-125454.
US Pat. No. 10,555,476

PLANTS AND SEEDS OF HYBRID CORN VARIETY CH265634

Monsanto Technology LLC, ...

1. A seed of hybrid corn variety CH265634, produced by crossing a first plant of variety CV292720 with a second plant of variety CV744222, wherein representative seeds of said varieties CV292720 and CV744222 are deposited under ATCC Accession Nos. PTA-9834 and PTA-124496, respectively.
US Pat. No. 10,555,478

SOYBEAN CULTIVAR 75242840

M.S. Technologies, L.L.C....

1. A plant of soybean cultivar 75242840, representative seed of said soybean cultivar having been deposited under ATCC Accession No. PTA-125325.
US Pat. No. 10,555,479

SOYBEAN CULTIVAR 71342318

M.S. Technologies, L.L.C....

1. A plant of soybean cultivar 71342318, representative seed of said soybean cultivar having been deposited under ATCC Accession No. PTA-125347.
US Pat. No. 10,555,481

SOYBEAN VARIETY 01068364

Monsanto Technology LLC, ...

1. A plant of soybean variety 01068364, wherein representative seed of said soybean variety have been deposited under ATCC Accession No. PTA-125717.
US Pat. No. 10,555,484

SOYBEAN VARIETY 01068903

Monsanto Technology LLC, ...

1. A plant of soybean variety 01068903, wherein representative seed of said soybean variety have been deposited under ATCC Accession No. PTA-125719.
US Pat. No. 10,555,485

SOYBEAN VARIETY 01073532

Monsanto Technology LLC, ...

1. A plant of soybean variety 01073532, wherein representative seed of said soybean variety have been deposited under ATCC Accession No. PTA-125724.
US Pat. No. 10,555,488

SOYBEAN VARIETY 01067714

Monsanto Technology LLC, ...

1. A plant of soybean variety 01067714, wherein representative seed of said soybean variety have been deposited under ATCC Accession No. PTA-125773.
US Pat. No. 10,555,489

SOYBEAN VARIETY 01068972

Monsanto Technology LLC, ...

1. A plant of soybean variety 01068972, wherein representative seed of said soybean variety have been deposited under ATCC Accession No. PTA-125877.
US Pat. No. 10,555,491

SOYBEAN CULTIVAR 83072718

Monsanto Technology LLC, ...

1. A plant of soybean cultivar 83072718, representative seed of said soybean cultivar having been deposited under NCMA Accession No. 201909029.
US Pat. No. 10,555,493

ALFALFA VARIETY R410A109

Forage Genetics Internati...

1. A seed of alfalfa variety R410A109, wherein representative seed of said alfalfa variety have been deposited under ATCC Accession No. PTA-125605.
US Pat. No. 10,557,031

COMPOSITION INCLUDING AMORPHOUS FLUOROPOLYMER AND FLUOROPLASTIC PARTICLES AND METHODS OF MAKING THE SAME

3M Innovative Properties ...

1. A composition comprising:fluoroplastic particles having a mean particle size of less than 500 nanometers; and
an amorphous fluoropolymer comprising at least one of:
a segment represented by formula
—CF(Rf)—(CX2)n—(CX2CXR)m—O—R?f—Ok—(CXR?CX2)p—(CX2)q—CF(R?f)—
or a terminal segment represented by formula
Rf—CF(I)—(CX2)n—(CX2CXR)m—O—R?f—Ok—(CXR?CX2)p—(CX2)q—CF(R?f)—,
wherein
each X is independently F, H, or Cl;
Rf and R?f are each independently F or a monovalent perfluoroalkyl having 1 to 3 carbon atoms;
R and R? are each independently F or a partially fluorinated or perfluorinated alkyl having 1 to 3 carbons atoms;
R?f is a divalent fluoroalkylene having 1 to 8 carbon atoms or a divalent fluorinated alkylene ether having 1 to 20 carbon atoms and at least one ether linkage;
k is 0 or 1; and n, m, p, and q are each independently an integer from 0 to 5, with the proviso that when k is 0, n+m is at least 1 and p+q is at least 1, and wherein the amorphous fluoropolymer is a fluoroelastomer gum.
US Pat. No. 10,555,496

ALFALFA VARIETY R410M327

Forage Genetics Internati...

1. A seed of alfalfa variety R410M327, wherein representative seed of said alfalfa variety have been deposited under ATCC Accession No. PTA-125608.
US Pat. No. 10,556,010

NEOADJUVANT THERAPY FOR BLADDER CANCER

PHOTOCURE ASA, Oslo (NO)...

1. A method of neoadjuvant therapy for muscular invasive bladder cancer (MIBC) or non-muscular invasive bladder cancer (NMIBC) with a high risk of progression in a bladder cancer patient who is scheduled for a cystectomy, said method of neoadjuvant therapy comprises:instilling into the bladder of said patient who is scheduled for a cystectomy a composition comprising hexyl 5-ALA ester (HAL) or a pharmaceutically acceptable salt thereof; and
exposing the inside of said bladder to light from a cystoscope;wherein the time between said neoadjuvant therapy and the cystectomy is zero to 6 weeks.
US Pat. No. 10,555,507

NON-HUMAN ANIMALS HAVING HUMANIZED FC-GAMMA RECEPTORS

Regeneron Pharmaceuticals...

1. A mouse whose genome comprises an Fc?RI gene at an endogenous Fc?RI locus, wherein the Fc?RI gene encodes a functional Fc?RI protein comprising an extracellular portion of a human Fc?RI ? chain and an intracellular portion of a mouse Fc?RI ? chain, wherein the mouse expresses the functional Fc?RI protein encoded by the Fc?RI gene.
US Pat. No. 10,555,508

IN VIVO METHOD FOR GENERATING DIVERSITY IN A PROTEIN SCAFFOLD

CRYSTAL BIOSCIENCE INC., ...

1. A transgenic chicken comprising a genome comprising an immunoglobulin heavy chain locus comprising:(a) a transcribed gene encoding a fusion protein comprising, from N-terminus to C-terminus: a binding domain from a heavy chain-only antibody and, operably linked to said binding domain, at least part of a heavy chain constant region that is native to said transgenic chicken; and
(b) a plurality of pseudogenes that are operably linked to said transcribed gene and that donate, by gene conversion, nucleotide sequence to the part of said transcribed gene that encodes said binding domain, wherein the pseudogenes are upstream or downstream of the transcribed gene and contain a nucleotide sequence that is at least 80% identical to at least part of the transcribed gene;
wherein the genome of the chicken further comprises an immunoglobulin light chain locus that encodes a light chain constant region but not a light chain variable domain, and
wherein the transgenic chicken produces a diversified population of antibodies whose binding specificity is solely determined by a diversified binding domain of (a).
US Pat. No. 10,556,024

18F LABELING OF PROTEINS USING SORTASES

Whitehead Institute for B...

1. A method for labeling a protein having a sortase recognition motif comprising:contacting the protein with a sortase substrate peptide in the presence of a sortase to transamidate the protein and the sortase substrate peptide, wherein the sortase substrate peptide comprises a click chemistry handle; and
contacting the protein with a radiolabeled agent, wherein the radiolabeled agent comprises a click chemistry handle which reacts with the click chemistry handle of the protein, thereby producing a radiolabeled protein,
wherein the radiolabeled agent comprises fluorodeoxyglucose (18F-FDG), and wherein the click chemistry handle is linked to the fluorodeoxyglucose via an oxime linkage;
wherein the protein comprises a C-terminal sortase recognition motif LPXTG or NPXTX, wherein each instance of X independently represents any amino acid residue, and the sortase substrate peptide comprises a N-terminal sortase recognition motif oligoglycine or oligoalanine;
wherein the sortase substrate peptide is linked to the radiolabeled agent by an oxime linkage, a hydrazone linkage, a thiosemicarbazone linkage, a heterocyclylene linkage, an amide linkage, an ester linkage, an ether linkage, or a disulfide linkage.
US Pat. No. 10,557,818

CEPHALOPOD PROTEINS AS PROTON CONDUCTORS

The Regents of the Univer...

1. A protonic transistor, comprisinga source electrode;
a drain electrode;
a protonic channel structure comprising a cephalopod proton-conducting protein comprising SEQ ID NO: 1 and/or a reflectin; and
a gate electrode in contact with or in proximity to the protonic channel structure.
US Pat. No. 10,555,522

LONG TERM METHODS OF IMPROVING DISEASE TOLERANCE IN PLANTS

AgroFresh Inc., Collegev...

1. A method of improving long-term disease tolerance of a crop plant, said method comprising:contacting the crop plant with a composition comprising 1-methylcyclopropene (1-MCP),
wherein the crop plant is a pre-transplant seedling having about 3 leaves or about 4 leaves,
wherein the pre-transplant seedling is a young plant sporophyte that has developed out of a plant embryo from a seed,
transplanting the pre-transplant seedling, and
improving the long-term disease tolerance of the crop plant treated with the composition comprising 1-MCP as compared to a crop plant that is not treated with the composition comprising 1-MCP,
wherein the improvement in the long-term disease tolerance of the treated crop plant is selected from the group consisting of an improvement in a fungal disease tolerance, a bacterial disease tolerance, a viral disease tolerance, or a combination thereof, and
wherein the long-term disease tolerance is present in the treated crop plant between 6-12 weeks after contacting the pre-transplant seedling with the composition comprising 1-MCP.
US Pat. No. 10,555,523

SELF INDICATING ANTIMICROBIAL CHEMISTRY

Ecolab USA Inc., Saint P...

7. A method of indicating the presence of a peroxycarboxylic acid concentration for surface disinfection comprising:generating a peroxycarboxylic acid in situ by perhydrolysis;
contacting a latent dye of a visual indicator composition with a peroxycarboxylic acid to oxidize the latent dye; and
indicating a presence of a desired concentration of the peroxycarboxylic acid for surface disinfection through the visual indicator composition comprising at least two dyes, wherein the combination of dyes have different half-lives to provide sustained visual indication of peroxycarboxylic acid concentration for at least 12 hours.
US Pat. No. 10,555,524

PESTICIDAL COMPOSITIONS AND RELATED METHODS

CJB Applied Technologies,...

1. A pesticidal composition efficacious against fungicidal resistant strains of fungi, the pesticidal composition comprising:at least one strobilurin fungicidal active ingredient; and
benzyl acetate, propylene carbonate, N-methylpyrrolidone, or any combination thereof,
wherein the at least one organic solvent increases the efficacy of the at least one fungicidal active ingredient against the fungicidal resistant strains of fungi by at least about 25% compared to the at least one fungicidal active ingredient alone.
US Pat. No. 10,556,294

METHOD OF TREATING SUPERALLOY ARTICLES

GENERAL ELECTRIC COMPANY,...

1. A method of treating a superalloy article, comprising:selecting an article having a superalloy composition, whereby said article has at least one treatable feature on its outermost surface;
removing a base alloy from a region abutting a portion of the at least one treatable feature to form a first treatment region and a second treatment region, wherein the base alloy has not been removed from the region abutting the second treatment region;
treating at least a portion of the second treatment region with a treatment composition including a silicon aluminum alloy or an aluminum fluoride derivative to form a clean second treatment region;
inserting a treatment material into the first treatment region;
depositing the base alloy into the first treatment region;
heating the article to a temperature above the melting point of the treatment material thereby allowing the molten treatment material to flow into the clean second treatment region to form a treated article.
US Pat. No. 10,556,038

DERMATOLOGICAL ADHESIVE AGENT, PATCH MATERIAL, AND METHOD FOR PRODUCING DERMATOLOGICAL ADHESIVE AGENT

ALCARE CO., LTD, Tokyo (...

1. A dermal adhesive in the form of a porous membrane formed through irradiation of a radiation-curable resin with radiation rays, comprising:fibrous resins containing the radiation-curable resin;
particulate resins containing the radiation-curable resin;
a hydrophilic polymer dispersed in the radiation-curable resin;
a reactive diluent that reacts with the radiation-curable resin; and
a functional group-free acrylic polymer,
wherein the dermal adhesive has a porosity of 5 to 90% and voids between the fibrous resins and particulate resins,
wherein the radiation-curable resin is an ultraviolet ray-curable resin,
wherein in the dermal adhesive an amount of the radiation-curable resin is 35 to 95 mass %, an amount of the hydrophilic polymer is 1 to 30 mass %, an amount of the reactive diluent is 1 to 20 mass %, and an amount of the functional group-free acrylic polymer is 1 to 20 mass %, and
wherein the fiber diameter of each of the fibrous resins is from 1 to 1000 ?m, and the length of each of the fibrous resins is from 0.1 to 10 mm, and
wherein the particle size of each of the particulate resins is from 1 to 1000 ?m.
US Pat. No. 10,555,528

HERBICIDAL COMPOSITION AND METHOD FOR CONTROLLING WEEDS

SUMITOMO CHEMICAL COMPANY...

1. A herbicidal composition comprising a PPO inhibitor and glufosinate or its salt, wherein the weight ratio of the PPO inhibitor to glufosinate or its salt is from 1/20,000,000 to 1/2,000,wherein the PPO inhibitor is saflufenacil or trifludimoxazin.
US Pat. No. 10,556,040

SURFACE-MODIFIED METAL AND METHOD FOR MODIFYING METAL SURFACE

SUMITOMO RUBBER INDUSTRIE...

1. A surface-modified metal which has a surface that is at least partially provided with a treatment layer having a thickness of 60 to 760 nm, the treatment layer being formed by treating a surface of a metal with a silane coupling agent, followed by adsorbing a hydrogen abstraction type photopolymerization initiator onto the surface and then polymerizing a monomer.
US Pat. No. 10,557,068

ABRASIVE GRAIN WITH MAIN SURFACES AND SUBSIDIARY SURFACES

Robert Bosch GmbH, Stutt...

1. An abrasive grain comprising:at least two main surfaces; and
at least one subsidiary surface, which is connected by way of a first edge to a first main surface of the at least two main surfaces and is connected by way of a second edge to a second main surface of the at least two main surfaces,
wherein the second main surface does not have any edge in common with the first main surface,
wherein the at least one subsidiary surface includes a first obtuse angle with the first main surface in a region of the first edge and a second obtuse angle with the second main surface in a region of the second edge,
wherein the at least two main surfaces of the abrasive grain are substantially planar and lie on faces of one of an imaginary pyramid, an imaginary frustopyramid, and a tetrahedron, and the at least one subsidiary surface truncates the one of the imaginary pyramid, the imaginary frustopyramid, and the tetrahedron, and
wherein each of the at least two main surfaces has a triangular shape.
US Pat. No. 10,555,541

METHOD FOR PRODUCING A DAIRY PRODUCT

1. A polypeptide having transgalactosylating activity, which is a truncated polypeptide consisting of the amino acid sequence of amino acids 28-979 of SEQ ID NO: 1 or is a fragment thereof having transgalactosylating activity, wherein the polypeptide is isolated.
US Pat. No. 10,556,831

METHOD OF MANUFACTURING CERAMIC MATRIX COMPOSITE OBJECTS

MBDA UK Limited, Stevena...

1. A method of manufacturing a ceramic matrix composite object comprising the steps of:(i) providing a first arrangement of one or more fibre plies, and machining the first arrangement to a predetermined configuration to form a first preform;
(ii) providing a second arrangement of one or more fibre plies, and machining the second arrangement to a predetermined configuration to form a second preform;
(iii) wrapping the second preform around at least one edge of the first preform;
(iv) fixing the first and second preforms together to form a combined first and second preform;
(v) providing one or more further arrangements of one or more fibre plies, machining the one or more further arrangements to a predetermined configuration to form one or more further preforms; and successively adhering each of the one or more further preforms to the combined first and second preform to form a complete preform in which at least one of the one or more further preforms are wrapped around one of the first, second, or one or more further preforms; and
(vi) rigidizing the complete preform by a step comprising infiltrating the combined first and second preforms with a liquid material, the liquid material selected to react with a component of the first and second preforms so as to form a ceramic.
US Pat. No. 10,555,550

TOPICAL FLAVOURING COMPOSITIONS COMPRISING OLEIC ACID AND SODIUM OLEATE

Givaudan, S.A., Vernier ...

1. A method of applying to the surface of a comestible product a solid flavouring, comprising dispersion of the solid flavouring in a non-aqueous continuous medium in the presence of oleic acid and sodium oleate and its topical application to the product, the weight ratio of oleic acid to sodium oleate being from 80:20-54:46.
US Pat. No. 10,557,856

BIOMARKERS OF RENAL INJURY

University Of Pittsburgh-...

1. A method for predicting dialysis independence after an acute renal injury, comprising:a) initiating renal replacement therapy in a patient having an acute renal injury, wherein said patient does not have an end stage renal disease;
b) collecting at least two urine samples from said patient within fourteen days of said initiating renal replacement therapy;
c) introducing said at least two urine samples into an assay device that detects a hyaluronic acid value normalized to urinary creatinine content in said urine sample, wherein said hyaluronic acid level decreases between an earlier urine sample hyaluronic acid value and a later urine sample hyaluronic acid level; and
d) calculating therefrom an area under the curve receiver operated characteristic (AUC ROC) determination patient value between said earlier and later urine sample hyaluonic acid levels;
e) correlating said AUC ROC patient value to an AUC ROC predetermined threshold value to determine a probability of recovery versus non-recovery for said patient;
f) predicting a recovery of said patient when said probability of recovery vesus non-recovery correlates said AUC ROC patient value at or above said AUC ROC predetermined threshold value; and
g) removing said patient from said renal replacement therapy under conditions of dialysis independence.
US Pat. No. 10,558,129

MASK ASSEMBLY

ASML Netherlands B.V., V...

1. A mask assembly suitable for use in a lithographic process, the mask assembly comprising:a patterning device; and(a) a pellicle frame configured to support a pellicle and mounted on the patterning device with a mount;(b) wherein the mount is configured to suspend the pellicle frame relative to the patterning device such that there is a gap between the pellicle frame and the patterning device; andwherein the mount provides a releasably engageable attachment between the patterning device and the pellicle frame.
US Pat. No. 10,557,117

GAMMADELTA T CELL EXPANSION PROCEDURE

1. A method for expanding a population of effector ?? T-cells, said method comprising culturing isolated Peripheral Blood Mononuclear Cells (PBMCs) in a medium comprising (i) transforming growth factor beta (TGF-?), (ii) interleukin-2 (IL-2), and (iii) an activator for V?9V?2 T-cells,wherein the medium is serum free.
US Pat. No. 10,557,118

COMPOSITIONS AND METHODS FOR PREVENTION OR TREATMENT OF NEOPLASTIC DISEASE IN A MAMMALIAN SUBJECT

The Government of the Uni...

1. A method of treating renal cell carcinoma in a mammalian subject, comprising administering to the subject an effective amount of a CD8+ T cell population or dendritic cells specific for a human endogenous retrovirus type E (HERV-E) antigen present on the renal cell carcinoma, wherein the HERV-E antigen comprises a polypeptide encoded by a nucleic acid sequence that is at least 95% identical to SEQ ID NO: 45 or SEQ ID NO: 47.
US Pat. No. 10,556,863

CRYSTALLINE FORM OF (R)-4-HYDROXY-2-OXO-1-PYRROLIDINEACETAMIDE, PREPARATION METHOD THEREFOR AND USE THEREOF

CHONGQING RUZER PHARMACEU...

1. A crystalline form I of (R)-4-hydroxy-2-oxo-1-pyrrolidineacetamide having diffraction peaks at diffraction angles 2? of 16.66±0.2°, 17.54±0.2°, 21±0.2°, 22.16±0.2°, and 30.96±0.2°.
US Pat. No. 10,560,987

ELECTRODE COMPOSITION

1. A self-calcining electrode composition for electric arc furnaces, comprising one or more carbon components and a binder,wherein the binder contains exclusively hard bitumen with a needle penetration of <50 per 0.1 mm at 25° C. according to DIN EN 1426, a softening point, ring and ball, of at least 65° C. according to DIN EN 1427, a density of 0.5 to 2 g/cm3 at 25° C. according to DIN EN 52004, or any combination thereof, and
wherein the electrode composition has a polyaromatic hydrocarbon (PAC) content of <500 ppm.
US Pat. No. 10,557,145

FLAGELLIN-SENSING 3 (‘FLS3’) PROTEIN AND METHODS OF USE

BOYCE THOMPSON INSTITUTE ...

1. A nucleic acid construct comprising:a nucleic acid molecule that encodes a FLAGELLIN-SENSING 3 (“FLS3”) protein, wherein said nucleic acid molecule encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, SEQ ID NO:4, or SEQ ID NO: 5;
a 5? heterologous DNA promoter sequence; and
a 3? terminator sequence, wherein the nucleic acid molecule, the DNA promoter sequence, and the terminator sequence are operatively coupled to permit transcription of the nucleic acid molecule.