US Pat. No. 10,689,775

SOLUTION DEPOSITION METHOD FOR FORMING METAL OXIDE OR METAL HYDROXIDE LAYER

Seoul Semiconductor Co., ...

1. An optoelectronic device, comprising:a substrate comprising epitaxial layers of a group III-Nitride semiconductor;
a seed layer formed on the substrate, the seed layer comprising an oxide of a first metal, a hydroxide of the first metal, or a combination thereof, and the seed layer being substantially free of organic compounds; and
a bulk layer formed on the seed layer,
wherein the bulk layer comprises an oxide of second metal, a hydroxide of the second metal, or a combination thereof, with the second metal being different from the first metal.

US Pat. No. 10,689,774

CONTROL OF CURRENT DENSITY IN AN ELECTROPLATING APPARATUS

Lam Research Corporation,...

1. A method of electroplating metal onto a substrate, the method comprising:immersing the substrate in electrolyte in an electroplating chamber, wherein the substrate is immersed at an angle such that a leading edge of the substrate contacts the electrolyte before a trailing edge of the substrate, the leading edge of the substrate first contacting the electrolyte at a substrate entry position;
monitoring a potential difference between the substrate and a reference electrode, wherein the reference electrode is positioned radially outside of the periphery of the substrate and angularly offset from the substrate entry position; and
electroplating metal onto the substrate.

US Pat. No. 10,689,773

PROPERTY MODULATED MATERIALS AND METHODS OF MAKING THE SAME

MODUMETAL, INC., Seattle...

1. A method, comprising:contacting a portion of a substrate with a bath including at least two electrodepositable species;
forming a property modulated composite on the portion of the substrate by:
applying a current to the substrate at a first setting having a first determined value of beta for a first duration, beta being defined as a ratio of a value of peak cathodic current density to an absolute value of peak anodic current density, the current having a current density that is a sine waveform, the first setting producing a first material comprising the at least two electrodepositable species, the first material having a first composition and a first nanostructure defined by one or more of a first average grain size, a first grain boundary geometry, a first crystal orientation, and a first defect density; and
applying the current to the substrate at a second setting having a second determined value of beta for a second duration, the second setting producing a second material comprising the at least two electrodepositable species, the second material having a second composition and a second nanostructure defined by one or more of a second average grain size, a second grain boundary geometry, a second crystal orientation, and a second defect density,
where one or more of the first average grain size differs from the second average grain size, the first grain boundary geometry differs from the second grain boundary geometry, the first crystal orientation differs from the second crystal orientation, or the first defect density differs from the second defect density.

US Pat. No. 10,689,772

COMPONENTS, ASSEMBLIES AND METHODS FOR DISTRIBUTING ELECTRICAL CURRENT IN AN ELECTROLYTIC CELL

Pultrusion Technique Inc....

1. An assembly for implementation in an electrolytic cell to facilitate enhanced distribution of the electrical current in the electrodes of the electrolytic cell, including:an insulator including a body configured to cooperate with a primary contact element and first and second rows of seats distributed along the body and extending upwardly from said body for supporting first and second opposing rows of electrodes, each row of electrodes being an alternation of anodes and cathodes;
a secondary contact element configured to cooperate with the first row of seats of the insulator; and
a tertiary contact element configured to cooperate with the second row of seats of the insulator;
wherein the first and second rows of seats of the insulator are configured with respect to the primary contact element so as to:
allow electrical contact between each anode of the first row and the primary contact element while insulating each anode of the second row from the primary contact element, and
allow electrical contact between each cathode of the second row and the primary contact element while insulating each cathode of the first row from the primary contact element-; and
wherein each seat of the first row of seats of the insulator is configured to cooperate with the secondary contact element for providing electrical contact to each anode of the second row resting thereon, therefore facilitating enhanced distribution of the electrical current in the anodes of the second row;
wherein each seat of the second row of seats of the insulator is configured to cooperate with the tertiary contact element for providing electrical contact to each cathode of the first row resting thereon, therefore facilitating enhanced distribution of the electrical current in the cathodes of the first row; and
wherein at least one of the secondary contact element and the tertiary contact element, is partially embedded within the insulator or rests on a surface of the insulator.

US Pat. No. 10,689,771

CONFIGURATIONS AND POSITIONING OF CONTACT BAR SEGMENTS ON A CAPPING BOARD FOR ENHANCED CURRENT DENSITY HOMOGENEITY AND/OR SHORT CIRCUIT REDUCTION

Pultrusion Technique, Inc...

1. A method for enhancing current density homogeneity in contact bar segments along a capping board including:providing the capping board;
providing a series of contact bar segments independently positionable on the capping board for providing alternating contact points for a pre-determined number of anodes and a pre-determined number of cathodes, wherein the series of contact bar segments includes:
a first sub-set of contact bar segments each being sized and configured to contact N number of anodes and N number of cathodes; and either
a second sub-set of one or more contact bar segments each being sized and configured to contact N number of anodes and N+1 number of cathodes; or
a second sub-set of one or more contact bar segments each being sized and configured to contact N+1 number of anodes and N number of cathodes,
wherein N is an integer which is equal to at least three;
positioning a center contact bar segment of the second sub-set of one or more contact bar segments at a center of the capping board; and
positioning the contact bar segments on the capping board with a symmetrical configuration with respect to the center contact bar segment.

US Pat. No. 10,689,770

MODIFIED ELECTROLYSIS CELL AND A METHOD FOR MODIFYING SAME

NORSK HYDRO ASA, Oslo (N...

1. A method for reducing the metal pad unevenness and optimizing the MHD stability in an electrolysis cell of the Hall-Héroult type for aluminium production, the cell having suspended prebaked carbon anodes and a cathode panel comprising several carbon based cathode blocks having one or more collector bars thus forming a cathode block assembly, where said cathode block assembly may be constituted by several individual cathode block sections that together with its cathode collector bars form cathode block section assemblies, the cell further having a metal pad that lies onto the cathode panel and an electrolytic bath between said metal pad and the anodes, where unevenness of the metal pad is detected by measurements or calculations,wherein
a model of the electrolysis cell is established in a computer based modelling program where each cathode block assembly or cathode block section assembly is represented, the modelling program being able to identify which cathode block assembly or cathode block section assembly that preferably should be modified, where at least one of the modifications is implemented in the cell by changing selectively the electrical current distribution in individual cathode block assemblies or in cathode block section assemblies so that the local electrical current paths and correspondingly the local forces in the metal above the cathode panel are modified to reduce the unevenness of the metal pad and optimize the overall MHD stability of the cell.

US Pat. No. 10,689,768

AMALGAM ELECTRODE, PRODUCING METHOD THEREOF, AND METHOD OF ELECTROCHEMICAL REDUCTION OF CARBON DIOXIDE USING THE SAME

SOGANG UNIVERSITY RESEARC...

1. An electrochemical cell for electrochemical reduction of carbon dioxide comprising:a reduction electrode unit comprising an amalgam electrode configured to reduce carbon dioxide that flows to the amalgam electrode so as to form at least one of formic acid and formate salt,
the amalgam electrode comprising:
a conductive portion,
a support portion having a first end that is directly connected to the conductive portion, and a second end oppositely disposed from the first end,
the conductive portion being thicker than the second end of the support portion, and
an amalgam portion supported by and in direct contact with the support portion, the amalgam portion comprising:
from about 35 wt % to about 55 wt % mercury;
from about 14 wt % to about 34 wt % silver;
from about 7 wt % to about 17 wt % tin; and
from about 4 wt % to about 24 wt % copper,
an oxidation electrode unit comprising a counter electrode operably connected to the amalgam electrode;
a solution at least partially contacting the amalgam portion of the amalgam electrode, the solution comprising dissolved carbon dioxide and an electrolyte selected from the group consisting of KHCO3, NaHCO3, K2SO4, NaCl, KCl and combinations thereof;
a source of carbon dioxide configured to flow carbon dioxide into the solution; and
a galvanostat configured to apply a static current ranging from 2 mA/cm2 to 10 mA/cm2 between the amalgam electrode and the counter electrode when in operation to reduce the carbon dioxide.

US Pat. No. 10,689,767

ELECTRODES/ELECTROLYTE ASSEMBLY, REACTOR AND METHOD FOR DIRECT AMINATION OF HYDROCARBONS

BONDALTI CHEMICALS, S.A.,...

1. A method for obtaining an electrodes/electrolyte assembly for direct amination of aromatic hydrocarbons, the electrodes/electrolyte assembly comprisinga simultaneously electron and proton conductive anode comprising a composite porous matrix, the composite porous matrix comprising a proton conductive ceramic fraction, wherein the ceramic fraction is barium cerate doped with nanoparticulated yttrium, and a metal catalyst for said direct amination of aromatic hydrocarbons at temperatures lower than 450° C., wherein the metal catalyst comprises nickel, nickel oxide or mixtures thereof, and wherein the porosity of the anode ranges between 10-40%;
an electrocatalyst porous cathode having protonic and electronic conductivity comprising an electrocatalyst;
a proton or ion conductive and electrically insulated electrolyte located between the anode and the cathode, made of a composite ceramic impermeable to reagents and to the products of said direct amination of aromatic hydrocarbon,
wherein the anode and the cathode are electrically connected, and
wherein the anode comprises a catalytic area higher than a catalytic area of the electrolyte and the cathode combined,wherein the method comprises the following stepsobtaining the anode by mixing the metal catalyst with the proton conductive ceramic, and an organic additive, wherein a proportion of the nickel oxide on the proton conductive ceramic ranges from 30% (w/w) to 70% (w/w), and a concentration of the organic additive ranges from 5% (w/w) to 30% (w/w) in the presence or absence of a solvent to obtain a mixture;
conforming the resulting mixture in a mould and pressing to obtain the anode;
depositing the proton or ion conductive and electrically insulated electrolyte on the anode, and sintering at a temperature between 1300° C. and 1600° C. for 5 h to 24 h, with a heating rate of between 1° C.·min?1 and 5° C.·min?1 in an oxidising atmosphere to obtain the simultaneously electron and proton conductive anode;
depositing the electrocatalyst porous cathode on the anode by co-pressing, co-sintering, spraying wet powder or directly applying commercial pastes; and
sintering the cathode at a temperature ranging from 900° C. to 1100° C., with a rate of heating that varies from 1° C.·min?1 to 5° C.·min?1, in an oxidising atmosphere.

US Pat. No. 10,689,766

LITHIUM SELECTIVE PERMEABLE MEMBRANE, LITHIUM RECOVERY DEVICE, LITHIUM RECOVERY METHOD, AND HYDROGEN PRODUCTION METHOD

NATIONAL INSTITUTES FOR Q...

1. A lithium selective permeable membrane that is configured to selectively transmit lithium (Li) ions from a first main surface side toward a second main surface side, the lithium selective permeable membrane comprising:a selective permeable membrane main body constituted of a ion conductor of lithium as a main body; and
a lithium adsorption layer that is formed on a surface of the selective permeable membrane main body on the first main surface side and selectively adsorbs the lithium ions.

US Pat. No. 10,689,765

METHOD FOR CLEANING WIRE AND DEVICE THEREFOR

Nakagawa Special Steel In...

1. A batch-type steel wire rod cleaning method comprising, in the following order, the steps of:(A) subjecting a steel wire rod, which is coiled and put on a hook for carrying and transferring, to acid pickling by immersing it in an acid pickling solution, wherein the acid pickling solution is hydrochloric acid or sulfuric acid;
(B) cleaning the wire rod with pressurized acidic water, wherein the concentration of the acidic water is adjusted to a constant acid concentration value with an acid pickling solution that has been retrieved as being adhered to the wire rod and collected after it had been used in the step (A) and water, wherein the pressurized acidic water is circulated and reused; and
(C) washing the wire rod with water, wherein
in the step (A): at least a first pickling tank and a last pickling tank are used; the wire rod is subjected to acid pickling in the first pickling tank, then the wire rod is transferred to the last pickling tank, and the wire rod is further subjected to acid pickling in the last pickling tank; the acid pickling solution adhering to the wire rod from the first pickling tank is transferred to the last pickling tank; and acid pickling solution overflowing from the last pickling tank is supplied to the first pickling tank to supplement a reduced amount of acid pickling solution in the first pickling tank; a new acid pickling solution is supplied only to the last pickling tank; and collection of the pickling solution to be used for adjusting the concentration of the acidic water in step (B) is carried out only from acid pickling solution adhered to the wire rod from step (A); and
in the step (B), the pressurized acidic water contains 1.0% by mass to 7% by mass of hydrochloric acid or 1.5% by mass to 10% by mass of sulfuric acid; the pressurized acidic water has a pressure of 3 to 10 kg/cm2; and smut is removed from the wire rod and yellowing of the surface of the wire rod is prevented.

US Pat. No. 10,689,763

METHOD AND SYSTEM FOR ION BEAM DELAYERING OF A SAMPLE AND CONTROL THEREOF

TECHINSIGHTS INC., Ottaw...

1. A method of reverse engineering a sample using an ion beam mill, the method comprising:identifying a plurality of materials in an exposed surface of the sample;
defining a removal sequence defined by distinct sets of one or more predetermined operational characteristics, wherein each of said sets corresponds with respective ion beam removal rates for each of said materials, each of said removal rates being greater than zero;
operating the ion beam mill in accordance with the defined sequence to simultaneously remove, during each distinct set of one or more predetermined operational characteristics, using an ion beam from the ion beam mill, each of the plurality of materials at said respective ion beam removal rates such that upon completion of said defined sequence, a substantially planar layer of substantially constant thickness has been removed from the exposed surface of the sample;
acquiring surface data from a newly exposed surface of the sample; and
repeating the method for at least one more layer, the acquired surface data for reverse engineering at least a portion of the sample;
wherein said one or more predetermined operational characteristics comprise at least one of: angle of sample-to-ion beam direction, ion beam size, ion type, sample stage temperature, chamber base pressure, chamber cross-over pressure, chamber process pressure, sample stage linear location, sample stage angle, sample stage rotation speed, ion source accelerator voltage, ion source accelerator current, ion source beam voltage, ion source beam current, ion source extractor grid configuration, ion source extractor grid material, ion source RF power, extraction voltage, plasma bridge neutralizer (PBN) cathode voltage, PBN emission current, PBN gas flow, ion source type, ion source gas flow rate, chamber background gas type, chamber background gas flow rate, or sidewall angle.

US Pat. No. 10,689,762

SUBSTRATE PROCESSING APPARATUS, SUBSTRATE PROCESSING METHOD AND RECORDING MEDIUM

TOKYO ELECTRON LIMITED, ...

1. A substrate processing apparatus, comprising:a processing chamber having a processing space in which a substrate is processed;
a vaporizing tank, configured to store a processing liquid therein, having a vaporization space in which the stored processing liquid is allowed to be vaporized;
a decompression driving unit configured to vaporize the processing liquid stored in the vaporization space into a processing gas by decompressing the vaporization space through the processing space, and configured to supply the vaporized processing gas into the processing space;
an inert gas supply unit configured to supply an inert gas into the vaporization space;
a first line through which the vaporization space and the processing space communicate with each other;
a second line through which the processing space and the decompression driving unit communicate with each other;
a third line through which the vaporization space and the decompression driving unit communicate with each other without through the processing space;
a first gas supply line through which the inert gas supply unit and the vaporization space communicate with each other;
a first opening/closing valve provided at the first line;
a second opening/closing valve provided at the second line;
a third opening/closing valve provided at the third line;
a first gas opening/closing valve provided at the first gas supply line; and
a control unit configured to control the decompression driving unit, the first opening/closing valve, the second opening/closing valve, the third opening/closing valve and the first gas opening/closing valve,
wherein the control unit vaporizes the processing liquid stored in the vaporization space into the processing gas by decompressing the vaporization space without through the processing space while closing the first opening/closing valve and the first gas opening/closing valve and opening the third opening/closing valve such that the vaporization space is filled with the processing gas and a pressure of the processing gas within the vaporization space increases, and
the control unit then vaporizes the processing liquid stored in the vaporization space into the processing gas by decompressing the vaporization space through the processing space while opening the first opening/closing valve, the second opening/closing valve and the first gas opening/closing valve and closing the third opening/closing valve, and simultaneously supplies the inert gas into the vaporization space.

US Pat. No. 10,689,761

PLATING METHOD

MIMAKI ENGINEERING CO., L...

2. A plating method, comprising:a surface roughening step of subjecting a plating target object to a surface roughening treatment, wherein the surface roughening treatment is at least one of etching and sandblasting;
a catalyst applying step of applying a catalyst for deposition of plating material to the plating target object;
a mask forming step of ejecting a UV-curable ink in the form of ink droplets from an inkjet head so as to have the ejected ink droplets land on the plating target object and to form a plating mask on the plating target object;
a plating step of performing plating to the plating target object subsequent to the mask forming step; and
a mask removing step of removing the plating mask from the plating target object subsequent to the plating step,
wherein an aqueous plating solution is used in the plating step,
the UV-curable ink is a UV-curable and solvent-soluble ink, the UV-curable and solvent-soluble ink comprising:
a UV-curable compound polymerizable by ultraviolet irradiation into a UV-curable resin; and
a solvent-soluble material soluble in a solvent, and
the UV-curable ink is aqueous solution-insoluble and organic solvent-soluble after curing.

US Pat. No. 10,689,760

DEPOSITION PLATFORM FOR FLEXIBLE SUBSTRATES AND METHOD OF OPERATION THEREOF

Applied Materials, Inc., ...

1. An apparatus for processing a flexible substrate, comprising:a vacuum chamber having a first chamber portion, a second chamber portion and a third chamber portion, the first chamber portion and second chamber portion being separated by a wall inclined at an angle relative to a vertical orientation, wherein the angle is at least 20 degrees;
an unwinding shaft for supporting the flexible substrate to be processed and a winding shaft for supporting the flexible substrate after processing, wherein the unwinding shaft and the winding shaft are disposed in the first chamber portion;
a first gap sluice separating the first chamber portion from the second chamber portion at a first position, the first gap sluice configured to open and close to provide a first vacuum seal between the first chamber portion and the second chamber portion at the first position;
a second gap sluice separating the first chamber portion from the second chamber portion at a second position, the second gap sluice configured to open and close to provide a second vacuum seal between the first chamber portion and the second chamber portion at the second position, wherein the first position is spaced apart from the second position in a vertical and horizontal direction;
a coating drum having a first portion disposed in the second chamber portion and a second portion disposed in the third chamber portion, the coating drum having a rotational axis; and
a plurality of processing stations disposed at least partially in the third chamber portion, wherein a majority of the plurality of the processing stations are disposed below the rotational axis of the coating drum.

US Pat. No. 10,689,759

FILM FORMING APPARATUS

TOKYO ELECTRON LIMITED, ...

1. A film forming apparatus comprising:a rotation shaft;
a rotation stage provided on the rotation shaft, fixed to the rotation shaft, and configured to hold a plurality of workpieces on a plurality of placing areas disposed in a circumferential direction with respect to a central axis of the rotation shaft;
a susceptor configured to provide a first opening and a second opening to face each other along a second direction that is orthogonal to a first direction parallel with the central axis, and provide an inner space between the first opening and the second opening so as to accommodate the rotation stage therein;
a gas supply mechanism configured to form a gas flow from the first opening to the second opening through the inner space;
a container configured to accommodate the susceptor; and
a heating mechanism provided around the container and configured to heat the susceptor,
wherein the susceptor includes a first wall portion and a second wall portion facing each other,
the rotation stage is provided between the first wall portion and the second wall portion,
the first wall portion faces the plurality of placing areas,
a first through hole through which the rotation shaft passes is formed in the second wall portion,
the second wall portion includes an intermediate area defined by a first circle having a first radius with respect to the central axis and a second circle having a second radius that is larger than the first radius with respect to the central axis, and the first radius is larger than a minimum distance between the central axis and each of the plurality of placing areas and the second radius is smaller than a maximum distance between the central axis and each of the plurality of the placing areas,
wherein the film forming apparatus further comprises an insulation layer provided between the container and the susceptor so as to enclose the susceptor,
one or more of second through holes are formed in the intermediate area, and
the one or more of second through holes are covered with the insulation layer.

US Pat. No. 10,689,758

SUBSTRATE PROCESSING APPARATUS, AND METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE

KOKUSAI ELECTRIC CORPORAT...

1. A substrate processing apparatus comprising:a boat configured to hold a plurality of substrates while the substrates are arranged in a horizontal posture with centers thereof aligned at a predetermined interval in a vertical direction;
a heat insulating portion disposed below the boat;
a reaction tube formed in a cylindrical shape with an upper end closed and a lower end open and including a process chamber containing a processing region in which the boat is disposed and a adiabatic region in which the heat insulating portion is disposed;
a flange formed on a lower end of the reaction tube so as to protrude toward an outer peripheral side;
a supply buffer chamber protruding outwardly from a side wall of the reaction tube and formed in a vertical direction;
an exhaust buffer chamber protruding outwardly from a side wall of the reaction tube so as to face the supply buffer chamber and formed in a vertical direction;
a first exhaust port configured to discharge an atmosphere of the processing region, the first exhaust port being formed in a partition portion serving as a partition between the reaction tube and the exhaust buffer chamber and constituting a part of a side wall of the reaction tube;
an exhaust port communicating with the exhaust buffer chamber;
a purge gas supply portion configured to supply a purge gas to the adiabatic region; and
a second exhaust port configured to discharge an atmosphere of the adiabatic region to the exhaust buffer chamber, the second exhaust port being formed at a position overlapping with the adiabatic region in a height direction in the partition portion.

US Pat. No. 10,689,757

GAS INJECTION APPARATUS WITH HEATING CHANNELS

APPLIED MATERIALS, INC., ...

1. A gas injection apparatus for a processing chamber comprising:a gas injector having an inlet at a first end, a closed second end, and an extending conduit located between the first end and the second end; and
a transparent manifold plate gas heater having an inlet that matches and fluidly couples to the extending conduit, one or more outlets, and one or more channels formed in the manifold plate gas heater and fluidly connecting the inlet of the manifold to the one or more outlets.

US Pat. No. 10,689,756

GAS CONTAINER

LINDE AKTIENGESELLSCHAFT,...

1. A gas container comprising:a container made of a base material having an inside coating applied directly on the base material of the container,
wherein said coating comprises a plurality of monomolecular layers of coating material, wherein said plurality of monomolecular layers are alternately Al2O3 and TiO2 monomolecular layers, each monomolecular layer having the thickness of one molecule of the respective coating material and in each monomolecular layer the molecules are each situated alongside one another substantially directly in the respective layer,
wherein each of the Al2O3 and TiO2 monomolecular layers is produced by an Atomic Layer Deposition process, and
wherein coating has a thickness of not more than 500 nm.

US Pat. No. 10,689,755

BIPHASIC SILICA- AND CARBON NANOTUBE-BASED MATERIAL

1. A process for synthesizing a biphasic material, wherein the biphasic material comprises at least one mesoporous substrate surrounded with carbon nanotubes, said process comprising the steps of:providing a catalyst on the at least one mesoporous substrate, the catalyst being configured to favor the growth of the carbon nanotubes; and
performing the growth of the carbon nanotubes, wherein the two steps are performed in a one-pot synthesis,
wherein the catalyst is reduced by one of an alcohol derivative or a gaseous hydrogen, the alcohol derivative for the reduction of the catalyst being applied once the at least one catalyst is deposited on the at least one mesoporous substrate when the step of providing a catalyst on the at least one mesoporous substrate is performed by atomic layer deposition.

US Pat. No. 10,689,754

PROGRAMMABLE CHARGE STORAGE ARRAYS AND ASSOCIATED MANUFACTURING DEVICES AND SYSTEMS

Peter C. Salmon, Mountai...

1. A charge storage cell comprising:an insulating substrate having a back side and a top side opposite the back side;
a back side conductive element coupled to the back side of the insulating substrate;
a top side metal pad coupled to the top side of the insulating substrate; and
an insulative layer covering the top side metal pad;
wherein the top side metal pad is operable to support an electric charge injected through the insulative layer by a charged particle beam.

US Pat. No. 10,689,753

SYSTEM HAVING A COOLING ELEMENT FOR DENSIFYING A SUBSTRATE

Goodrich Corporation, Ch...

1. A system for densifying a substrate comprising:a base;
a top portion operable to removably attach to the base;
at least two process compartments each comprising:
a substrate support structure comprising at least one of a first plate, a disc, or a platform;
a first gas inlet operable to deliver a gas to the substrate support structure, the first gas inlet disposed on a bottom surface of the substrate support structure;
a second gas inlet operable to deliver the gas to the substrate support structure, the second gas inlet disposed on the bottom surface of the substrate support structure,
a gas outlet operable to remove the gas from the substrate support structure, the gas outlet disposed on the bottom surface of the substrate support structure, the gas outlet disposed in between the first gas inlet and the second gas inlet;
a cooling element positioned beneath and in thermal communication with the substrate support structure, the cooling element having an embedded cooling conduit to allow a fluid coolant to flow through the cooling element, the cooling element being thermally coupled to the bottom surface of the substrate support structure, wherein the cooling element comprises a second plate having a surface in thermal communication with the substrate support structure, said surface extending horizontally in a first direction, a position of the cooling element being adjustable with respect to the substrate support structure so as to increase or decrease an interstitial space between the position of the cooling element and the substrate support structure;
the first gas inlet, the second gas inlet, and the gas outlet extending vertically in a second direction from below the surface of the second plate to a location above the surface of the second plate of the cooling element, and
heating element in thermal communication with the substrate support structure, the heating element including at least one of an induction heater, a susceptor, a resistance heater, an electrode, or a microwave heater,
wherein the top portion defines a volume within which resides each of the at least two process compartments.

US Pat. No. 10,689,752

FILM STABILIZATION THROUGH NOVEL MATERIALS MODIFICATION OF BEAMLINE COMPONENTS

Axcelis Technologies, Inc...

1. A component for an ion implantation system, the component comprising a carbon-based substrate having a microscopically textured surface overlying a macroscopically textured surface, wherein the macroscopically textured surface comprises a mechanically roughened surface having a machined pattern of narrow grooves.

US Pat. No. 10,689,751

EVAPORATION SOURCE COVER, EVAPORATION SOURCE AND EVAPORATION APPARATUS

BOE TECHNOLOGY GROUP CO.,...

1. An evaporation source cover, comprising a cover body and an elastic dredging member which is arranged on the cover body,wherein the elastic dredging member comprises a bottom part and a top part, the elastic dredging member is fixed to a surface of the cover body at the bottom part, and the elastic dredging member is configured to extend and contract in a direction perpendicular to the surface of the cover body.

US Pat. No. 10,689,750

EVAPORATOR BODY WITH TITANIUM HYDRIDE COATING, METHOD FOR THE PRODUCTION AND USAGE THEREOF

KENNAMETAL INC., Latrobe...

1. A method for producing an evaporator body for a PVD coating system with a basic body and an evaporator surface on the basic body, which comprises the following steps:providing a suspension of titanium hydride and an organic carrier agent in an organic solvent; and
applying the suspension onto the evaporator surface while forming a titanium hydride layer, in which titanium hydride is present as the only inorganic solid;
wherein the titanium hydride layer is formed in a thickness of no more than 10?; and heating the evaporator body to melt aluminum in contact with the titanium hydride layer to form a Ti—Al wetting layer.

US Pat. No. 10,689,749

LINEAR EVAPORATION SOURCE AND VACUUM DEPOSITION APPARATUS INCLUDING THE SAME

Samsung Display Co., Ltd....

1. A linear evaporation source comprising:a single crucible storing an evaporation material, wherein the crucible includes a plurality of side surfaces, and top and bottom surfaces opposing each other, wherein the single crucible is connected to a plurality of nozzles;
a heater unit surrounding the crucible and configured to heat the crucible;
a down reflector surrounding the bottom surface of the crucible;
a plurality of lateral reflectors surrounding a lateral surface of the heater unit; and
a plurality of temperature sensing units disposed between the crucible and the heater unit,
wherein each of the lateral reflectors comprises:
a first reflector combined with the heater unit and spaced apart from the heater unit, wherein a first opening is formed in the first reflector; and
a second reflector movably combined with the first reflector, wherein a second opening is formed in the second reflector,
wherein each of the lateral reflectors further comprises a transfer unit configured to linearly move the second reflector with respect to the first reflector from a first position where the first and second openings do not overlap each other to a second position where the first and second openings at least partially overlap each other,
wherein the heater unit comprises:
a heater configured to heat the crucible; and
a heater frame configured to support the heater, wherein the heater frame has first and second surfaces opposing each other, wherein the first surface of the heater frame faces the first reflector, wherein the second surface of the heater frame faces the crucible, wherein the heater is positioned between the second surface of the heater frame and the crucible and is disposed directly on the second surface of the heater frame,
wherein each of the plurality of temperature sensing units is disposed on the second surface of the heater frame in a one-to-one correspondence with each of the lateral reflectors to measure area-depending temperatures of the crucible,
wherein the transfer unit of each of the lateral reflectors is further configured to independently move a corresponding one of the plurality of lateral reflectors based on the corresponding area-depending temperature of the crucible such that open ratios of the lateral reflectors are independently adjusted, and
the first opening of the first reflector has one or more openings located at a top half of the first reflector along a height direction of the heater unit, and the first opening of the first reflector has one or more openings located at a bottom half of the first reflector along the height direction of the heater unit.

US Pat. No. 10,689,748

COATING

Sumitomo Electric Industr...

1. A coating located on a surface of a substrate, comprising:one or more layers,
at least one of said layers being a domain structure layer constituted of two or more domains different in composition and including at least either of Ti and Al,
a first domain and a second domain which are two of the two or more domains being composed of at least one element selected from the group consisting of Al, B, Si, and elements of group 4, 5, 6 in the periodic table and at least one element selected from the group consisting of B, O, C, and N,
a plurality of said first domains being present in said domain structure layer,
when a size of each said first domain in an in-plane direction of said domain structure layer is defined as a diameter of a virtual circumcircle in contact with said each first domain and a nearest neighbor distance of said each first domain in the in-plane direction of said domain structure layer is defined as a length of a shortest straight line connecting a center of said circumcircle with a center of another circumcircle adjacent to said circumcircle, an average value of the size of said each first domain being not smaller than 1 nm and not greater than 10 nm and an average value of the nearest neighbor distance of said each first domain being not smaller than 1 nm and not greater than 12 nm,
95% or more of said first domains having a size in a range of not more than ±25% of the average value of said size, and
95% or more of said first domains having a nearest neighbor distance in a range of not more than ±25% of the average value of said nearest neighbor distance.

US Pat. No. 10,689,747

EVAPORATION DEVICE

SHANGHAI TIANMA MICRO-ELE...

1. An evaporation device, comprising:a deposition chamber;
a first coil;
a second coil;
a third coil; and
a fourth coil;
wherein a plane where a mask is located is between the first coil and the second coil, and the plane where the mask is located is between the third coil and the fourth coil, wherein a distance between the plane where the mask is located and the first coil is equal to a distance between the plane where the mask is located and the second coil,
wherein the third coil is surrounded by the first coil and is spaced apart from the first coil, and the fourth coil is surrounded by the second coil and is spaced apart from the second coil,
wherein axes of the first coil and the second coil coincide, axes of the third coil and the fourth coil coincide, the axes of the first coil and the second coil, and the axes of the third coil and the fourth coil coincide and are perpendicular to the mask, wherein the first and the second coils are mask supporting coils and the third and fourth coils are mask conveying coils.

US Pat. No. 10,689,746

THIN FILM DEPOSITION APPARATUS

Samsung Display Co., Ltd....

1. A thin film deposition apparatus to form a thin film on a substrate, the thin film deposition apparatus comprising:a deposition source to discharge a deposition material;
a first nozzle disposed at a side of the deposition source and including a plurality of first slits arranged in a first direction;
a second nozzle disposed opposite to the first nozzle and including a plurality of second slits arranged in the first direction; and
a barrier wall assembly including a plurality of barrier walls arranged in the first direction between the first nozzle and the second nozzle so as to partition a space between the first nozzle and the second nozzle into a plurality of sub-deposition spaces, barrier walls of the plurality of barrier walls being located between respective pairs of adjacent first slits of the plurality of first slits, wherein a width of each of the first slits in the first direction is less than a distance between adjacent barrier walls of the plurality of barrier walls in the first direction.

US Pat. No. 10,689,743

PISTON RING

IHI CORPORATION, (JP) IH...

1. A method of coating a piston ring comprising:manufacturing a thermal spray powder by adding tungsten carbide, chromium carbide, and nickel to a dispersion medium so as to create a slurry, creating granules from the slurry, sintering the granules, cracking the granules, and classifying the granules, the thermal spray powder containing nickel within a range of not less than 7.0 wt % and not more than 18.5 wt % and tungsten carbide particles of which mean particle diameter is in a range of not less than 0.15 ?m and not more than 0.45 ?m, and
thermal spraying the thermal spray powder to the piston ring to form the thermal spray coating on the piston ring,
wherein the method of coating the piston ring includes no step of forming a member on a surface of the thermal spray coating opposite to a surface of the thermal spray coating in contact with the piston ring.

US Pat. No. 10,689,742

DEVICE AND METHOD FOR IMPROVED EXTRACTION OF METAL VAPOR

Thyssenkrupp Steel Europe...

1. A device that minimizes or eliminates surface flaws caused by metal dust on a metal strip to be coated in a continuous hot-dip coating process, wherein at least some segments of the metal strip to be coated are configured to be conveyed through the device in an axial direction, the device comprising a blowing/sucking unit that comprises:a blow-in region that includes a plurality of blow-in openings for applying protective gas to the metal strip, wherein some of the plurality of blow-in openings are positionable on a first side of the metal strip and some of the plurality of blow-in openings are positionable on a second side of the metal strip;
a suction region that includes a plurality of suction openings for extracting the protective gas, which is laden with at least one of metal vapor or metal dust, wherein some of the plurality of suction openings are positionable on the first side of the metal strip and some of the plurality of suction openings are positionable on the second side of the metal strip;
a first blowing/suction box that is positionable on the first side of the metal strip, the first blowing/suction box comprising a first pair of blowing boxes at the blow-in region and a first pair of suction boxes at the suction region, the first pair of blowing boxes and the first pair of suction boxes separated by a first partition wall; and
wherein the suction region is positioned downstream of the blow-in region with respect to the axial direction and wherein the blow-in region and the suction region are free of overlapping in the axial direction.

US Pat. No. 10,689,741

NI-BASED SUPERALLOY PART RECYCLING METHOD

NATIONAL INSTITUTE FOR MA...

1. A method for recycling a Ni-based single crystal superalloy part provided with a thermal barrier coating containing at least a ceramic on a surface of a Ni-based single crystal superalloy substrate, the method comprising the steps of:melting and desulfurizing the Ni-based single crystal superalloy part at a temperature in a range from 1400° C. to 2000° C. to prepare a desulfurized Ni-based single crystal superalloy; and
forming a recycled Ni-based single crystal superalloy part or a melting stock using the Ni-based single crystal superalloy,
wherein
in the step of desulfurizing the Ni-based single crystal superalloy part, the Ni-based single crystal superalloy part is desulfurized so that a sulfur content of the Ni-based single crystal superalloy part is 3 PPM or less, and
in a case of directly forming the recycled Ni-based single crystal superalloy part, the method comprises the steps of:
heating a casting mold for a recycled Ni-based single crystal superalloy part to have a temperature in a range from 1400° C. to 1600° C.;
pouring the melted Ni-based single crystal superalloy into the casting mold for a recycled Ni-based single crystal superalloy part to grow the Ni-based single crystal superalloy; and
removing the recycled Ni-based single crystal superalloy part from the casting mold for a recycled Ni-based single crystal superalloy part, and
in a case of forming a recycled Ni-based single crystal superalloy part from a melting stock, the method comprises the steps of:
pouring the melted Ni-based single crystal superalloy into a casting mold for a melting stock to form a melting stock;
removing the melting stock from the casting mold for a melting stock; and
producing a Ni-based single crystal superalloy part from the melting stock.

US Pat. No. 10,689,740

GALVANICALLY-ACTIVE IN SITU FORMED PARTICLES FOR CONTROLLED RATE DISSOLVING TOOLS

Terves, LLCq, Euclid, OH...

94. A dissolvable magnesium cast composite comprising a mixture of magnesium or a magnesium alloy and an additive material, said additive material includes a) nickel wherein said nickel constitutes 0.01-5 wt. % of said dissolvable magnesium cast composite or b) nickel wherein said nickel constitutes 0.1-23.5 wt. % of said dissolvable magnesium cast composite, said dissolvable magnesium cast composite includes in situ precipitate, said in situ precipitate includes said additive material, said dissolvable magnesium cast composite has a dissolution rate of at least 75 mg/cm2/hr. in 3 wt. % KCl water mixture at 90° C.

US Pat. No. 10,689,739

ALUMINIUM-COPPER-LITHIUM ALLOY PRODUCTS WITH IMPROVED FATIGUE PROPERTIES

Constellium Issoire, Iss...

20. An aged state plate having a thickness of at least about 80 mm, wherein said plate comprises AA2050 aluminium alloy,wherein in the aged state the fatigue logarithmic mean measured at mid-thickness in the LT direction on smooth test samples exhibits a maximum stress amplitude of 242 MPa, a frequency of 50 Hz, and a stress ratio of R=0.1 of at least 250,000 cycles.

US Pat. No. 10,689,738

PROCESS FOR FORMING ALUMINIUM ALLOY SHEET COMPONENTS

Imperial Innovations Ltd....

1. A method of forming a component having a complex shape from an Al-alloy sheet comprising sequentially:(i) heating an Al-alloy sheet blank to its Solution Heat Treatment (SHT) temperature at a heating station and maintaining the SHT temperature until Solution Heat Treatment is complete,
(ii) transferring the sheet blank to a set of cold dies and initiating forming within 10s of removal from the heating station so that heat loss from the sheet blank is minimised,
(iii) closing the cold dies in less than 0.15s, which includes fully forming the sheet blank into the complex-shaped component at low heat loss whereby to deform selected regions faster than neighboring regions thereby increasing the strength of the selected regions relative to the neighboring regions, and
(iv) thereafter subjecting the formed component to a quenching phase by holding the fully formed component in the closed dies at a gap of from 0.0 mm to 1.05 mm, during cooling of the formed component.

US Pat. No. 10,689,736

ULTRA-HIGH-STRENGTH SPRING STEEL FOR VALVE SPRING

Hyundai Motor Company, S...

1. An ultra-high-strength spring steel for a valve spring in a vehicle engine, consisting essentially of: 0.5-0.7% by weight of carbon (C), 1.3-2.3% by weight of silicon (Si), 0.6-1.2% by weight of manganese (Mn), 0.6-1.2% by weight of chrome (Cr), 0.1-0.5% by weight of molybdenum (Mo), 0.05-0.8% by weight of nickel (Ni), 0.05-0.5% by weight of vanadium (V), 0.05-0.5% by weight of niobium (Nb), 0.05-0.3% by weight of titanium (Ti), 0.001-0.01% by weight of boron (B), 0.01-0.52% by weight of tungsten (W), 0.3% or less (0% exclusive) by weight of copper (Cu), 0.3% or less (0% exclusive) by weight of aluminum (Al), 0.03% or less (0% exclusive) by weight of nitrogen (N), 0.003% or less (0% exclusive) by weight of oxygen (O), a remainder of iron (Fe), and other inevitable impurities, based on 100% by weight of the ultra-high-strength spring steel,wherein the ultra-high-strength spring steel has a fatigue strength of 1200 MPa or higher, and
wherein the ultra-high-strength spring steel has a hardness of 760 HV or higher.

US Pat. No. 10,689,735

HIGH STRENGTH STEEL SHEET HAVING EXCELLENT CRYOGENIC TEMPERATURE TOUGHNESS AND LOW YIELD RATIO PROPERTIES, AND METHOD FOR MANUFACTURING SAME

POSCO, Pohang-si (KR)

1. A high strength steel sheet comprising: 0.02 to 0.12 wt % of carbon (C), 0.5 to 2.0 wt % of manganese (Mn), 0.05 to 0.5 wt % of silicon (Si), 0.05 to 1.0 wt % of nickel (Ni), 0.005 to 0.1 wt % of titanium (Ti), 0.005 to 0.5 wt % of aluminum (Al), 0.015 wt % or less of phosphorus (P), 0.015 wt % or less of sulfur (S), and the balance of Fe and other inevitable impurities,wherein a microstructure formed throughout an entire thickness thereof consists of: 70% to 90% of ultrafine ferrite having 10 ?m or less of a crystal grain size and 10% to 30% of MA (martensite/austenite) structure by area fraction, and a yield ratio (YS/TS) thereof is 0.8 or less.

US Pat. No. 10,689,734

EXTRUDED 6XXX ALLOY PRODUCT THAT IS SUITABLE FOR TURNING AND HAS LOW ROUGHNESS AFTER ANODISATION

CONSTELLIUM EXTRUSION DEC...

1. An extruded product for turning, made of an aluminum alloy consisting of a composition in wt % of Si 0.4-0.8; Mg 0.8-1.2; Cu 0.20-0.4; Fe 0.05-0.4; Mn?0.10; Ti?0.15; Cr?0.10; Bi 0.4-0.8; Pb 0.2-0.34; other elements <0.05 each and <0.15 total, balance aluminum,wherein Cr+Mn?0.10,
wherein a rate of recrystallization at one quarter thickness of the granular structure thereof is greater than 70%, and
wherein after mirror polishing and anodizing at a temperature of 30° C. with a solution comprising 180 g/l sulfuric acid and 14 g/l oxalic acid and 15 g/l glycerol to make an oxide layer 30 ?m thick, the product has a roughness Rz on a generatrix parallel to the extrusion axis that is equal to or less than 1.7 ?m.

US Pat. No. 10,689,733

METHODS TO INCREASE SOLID SOLUTION ZIRCONIUM IN ALUMINUM ALLOYS

GM GLOBAL TECHNOLOGY OPER...

1. A method of making an aluminum alloy comprising zirconium, the method comprising:heating a first composition comprising aluminum to a first temperature of greater than or equal to a liquidus temperature of the first composition;
adding a second composition comprising a copper-zirconium compound to the first composition, the copper-zirconium compound is selected from the group consisting of: Cu9Zr2, Cu51Zr14, Cu8Zr3, Cu10Zr7, CuZr2, or a combination thereof;
forming a third composition by decomposing at least a portion of the copper-zirconium compound into copper and zirconium, at least a portion of the copper dissolving in aluminum;
cooling the third composition to a second temperature less than or equal to a solidus temperature of the third composition to form a first solid material;
dissolving at least a portion of the zirconium after the cooling; and
heat treating the first solid material to form the aluminum alloy comprising zirconium.

US Pat. No. 10,689,732

METHODS FOR CONTROLLING IRON VIA MAGNETITE FORMATION IN HYDROMETALLURGICAL PROCESSES

1. A method of controlling iron in a hydrometallurgical leach process (1) comprising the steps of:leaching (14, 114) a feed slurry (2, 102);
forming a pregnant leach solution (12a, 12b; 112a, 112b);
removing a first leach residue (18, 118) from the pregnant leach solution (12a, 12b); and
sending a portion (12b, 112b) of the pregnant leach solution (12a, 12b) and/or raffinate (22, 122) produced therefrom, to an iron removal process (34, 134); wherein the iron removal process (34, 134) comprises:
sequentially processing the pregnant leach solution (12a, 12b) and/or raffinate (22, 122) produced therefrom in a first reactor (R1) a second reactor (R2), and a third reactor (R3);
maintaining a pH level of the first reactor (R1) in the range of 4-5, by virtue of an addition of a first base;
maintaining a pH level of the second (R2) and/or third (R3) reactors above 8.5, by virtue of an addition of a second base; and
forming solids (46) comprising magnetite (68);
performing a solid liquid separation step (36) after the iron removal process (34, 134); and
performing a magnetic separation step (64) to remove magnetite (68) from said solids comprising magnetite (68).

US Pat. No. 10,689,731

DEVICE FOR DEGASSING LIGHT ALLOY MELTS BY MEANS OF ULTRASOUNDS AND SYSTEM

1. A system for degassing light alloy melts by means of ultrasounds, comprising:a degassing device (100) integrating:
a sonotrode (102) which can produce an oscillatory movement using a transducer (101) in order to generate waves at an ultrasound oscillation frequency in said light alloy melt, when said sonotrode (102) and said melt are in contact, so as to perform the degassing; and
an electronic-mechanical component (104) embedded in an interchangeable tip (102b) of the sonotrode (102) provided at an end part of the sonotrode (102) and responsible for making contact with the light alloy melt, said electronic-mechanical component (104) comprising a programmable chip integrated circuit encoded with identification and service life parameters of the sonotrode (102) including user, material, manufacturing dates, serial number and information about a maximum allowable vibrations, said chip integrated circuit being programmed and configured to detect a state of a service life or an anomalous operation of the sonotrode (102) including vibration anomalies, said electronic-mechanical component (104) being configured to send the detected state or detected anomalous operation, conveyed in at least one notification signal; and
an electronic control equipment (103), located remotely with respect to the sonotrode (102), configured to receive said at least one notification signal and to establish a connection using an electronic unit (105) with said transducer (101) for activation or deactivation of the transducer (101), depending on said at least one notification signal.

US Pat. No. 10,689,730

METHODS OF PRODUCING A TITANIUM PRODUCT

University of Utah Resear...

1. A method for producing a titanium product, comprising:obtaining TiO2 rich material as a purified TiO2 having at least 70% by weight TiO2;
reducing the purified TiO2 by combining with a metallic reducing agent and a molten salt at a temperature and a pressure to produce a hydrogenated titanium powder product comprising TiH2 and optionally elemental titanium;
heat treating the hydrogenated titanium powder product under a hydrogen atmosphere to coarsen the powder so as to reduce pore size and specific surface area to form a heat treated hydrogenated titanium powder product, wherein the hydrogen atmosphere is maintained during at least one of heating and cooling; and
deoxygenating the heat treated hydrogenated titanium powder product to reduce residual oxygen to less than 0.2 wt % to form a deoxygenated hydrogenated titanium powder product.

US Pat. No. 10,689,729

REDUCTION DEVICE USING LIQUID METAL

Korea Institute of Indust...

1. A device for reducing a material using a liquid metal, comprising:a storage unit containing the liquid metal;
a reducing agent block positioned in the storage unit; and
a reduction unit positioned on a side of the storage unit in fluid communication with the storage unit, which receives a material to be reduced;
wherein the reducing agent, after sublimation, flows to the reduction unit via fluid communication;
wherein the liquid metal is different from the reducing agent; and
wherein the reduction device further comprises a dispersion plate positioned between the storage unit and the reduction unit.

US Pat. No. 10,689,728

RENEWABLE ISOPARAFFINS AS DILUENT IN HYDROMETALLURGICAL LIQUID-LIQUID EXTRACTION PROCESS

OUTOTEC (FINLAND) OY, Es...

1. A biobased composition for liquid-liquid extraction of metals, the biobased composition comprising:5 vol-%-40 vol-% metal extraction reagent; and
60 vol-%-95 vol % diluent, wherein the diluent includes:
10 wt %-100 wt % of a first organic diluent containing hydrocarbons having 80 wt %-98 wt % C15-C20 hydrocarbons with at least 60 wt % isoparaffins from a total amount of the hydrocarbons; and
optionally, 0 wt %-90 wt % of a second organic diluent component having more than 10 wt % naphthenes;
wherein a 14C isotope content of the first organic diluent is more than 90%.

US Pat. No. 10,689,727

METHODS FOR LIQUID EXTRACTION OF RARE EARTH METALS USING IONIC LIQUIDS

UT-Battelle, LLC, Oak Ri...

1. A method for extracting a rare earth element from a rare earth-containing substance, the method comprising mixing the rare earth-containing substance with a protic ionic liquid having the following formula:
wherein R1 is selected from the group consisting of hydrogen and hydrocarbon groups containing at least 1 and up to 12 carbon atoms; R2 and R3 are independently selected from the group consisting of hydrocarbon groups containing at least 1 and up to 12 carbon atoms; and X? is an anionic species;
wherein said mixing results in a solution comprising a rare earth composition of the formula (RE)(amide)yXz at least partially dissolved in said protic ionic liquid, wherein RE is at least one rare earth element having an atomic number selected from the group consisting of 39, 57-71, and 90-103 and having a positive oxidation state; y is 2-6; z is a number that charge balances the total positive charge of the at least one rare earth element (RE); X is equivalent to X? in the ionic liquid of Formula (1); and said amide is the conjugate base of the cationic portion of the protic ionic liquid of Formula (1) and has the following formula:

US Pat. No. 10,689,726

METHOD FOR PRODUCING HOT-FORMED STEEL SPRINGS

THYSSENKRUPP FEDERN UND S...

1. A process for producing a spring or torsion bar from a steel wire by hot forming, the process comprising:providing a steel wire;
thermomechanically forming the steel wire above a minimum recrystallization temperature of the steel wire, the steel wire having an at least partly austenitic structure, wherein the thermomechanical forming occurs at a temperature in a range between an austenite end temperature and 50° C. above the austenite end temperature;
cooling the thermomechanically-formed steel wire such that at least a partly ferritic-pearlitic structure is formed in the steel wire;
cutting the steel wire to length to form rods;
heating the rods at least to a forming temperature, the forming temperature being above the minimum recrystallization temperature of the steel wire;
hot forming the heated rods;
tempering the hot-formed rods, wherein the tempering comprises:
quenching the rods to a first cooling temperature such that an at least partly martensitic structure forms in the steel wire and such that the spring or the torsion bar that is produced has a martensite content of greater than 40% by volume, the first cooling temperature being a temperature below the minimum recrystallization temperature of the steel wire,
reheating the quenched rods to a first annealing temperature that is less than an austenite start temperature, and
cooling the reheated rods to a second cooling temperature, the second cooling temperature being less than the first annealing temperature.

US Pat. No. 10,689,725

METHOD FOR PRODUCING A COMPONENT HAVING IMPROVED ELONGATION AT BREAK PROPERTIES

ThyssenKrupp Steel Europe...

1. Method for manufacturing a component for a body part or a chassis of a motor vehicle with improved elongation at break properties, in which a component is first produced by one of a hot forming and press curing process, and in which the component is tempered after the one of hot forming and press curing processes characterised in thata tempering temperature T and a tempering time t substantially satisfy the numerical relationship T?900·t?0.087, wherein the tempering temperature T is expressed in ° C. and the tempering time tin seconds and wherein the tempering temperature is at least 500° C. and lower than AC1 temperature.

US Pat. No. 10,689,724

STEEL SHEET WITH STRAIN INDUCED TRANSFORMATION TYPE COMPOSITE STRUCTURE AND METHOD OF MANUFACTURING SAME

NIPPON STEEL CORPORATION,...

1. A steel sheet comprising, as a chemical composition, by mass %,C: more than 0.075% and 0.150% or less,
Si: 0.50% or less,
Mn: 0.20% to 3.00%,
P: 0.010% or less,
S: 0.005% or less,
Al: 0.040% to 1.500%,
N: 0.0100% or less,
Ti: 0.015% to 0.200%,
Nb: 0% to 0.060%,
Cu: 0% to 1.20%,
Ni: 0% to 0.60%,
Mo: 0% to 1.00%,
V: 0% to 0.200%,
Cr: 0% to 2.00%,
W: 0% to 0.50%,
Mg: 0% to 0.0100%,
Ca: 0% to 0.0100%,
REM: 0% to 0.100%,
B: 0% to 0.0020%, and
a remainder comprising Fe and impurities,
wherein the chemical composition satisfies the following equation (i);
a microstructure at the ¼ thickness of the steel sheet includes, by area ratio, 50% to 85% of a polygonal ferrite, 3% to 10% of a residual austenite, 5% to 47% of a bainite, and 1% or less of a fresh martensite and a tempered martensite in total, and satisfies the following equation (ii),
wherein the microstructure includes 1×1016 pieces/cm3 or more of precipitates containing a TiC,
an average grain diameter of the residual austenite is 1.0 ?m to 5.0 ?m at an equivalent circle diameter,
an average of closest distances of the residual austenite is 3.0 ?m to 10.0 ?m, and
an average diameter of the precipitates is 3 nm or less,
Ti?48×(N/14+S/32)?0  (i)
0.01 where symbols for elements in the equations are amounts of the elements included in the steel sheet by mass %,
the fsd in the equation (ii) is an area ratio (%) of the residual austenite in the microstructure, and
Ex.C is calculated by the following equation (iii),
Ex.C=C?12×(Ti/48+Nb/93?N/14?S/32)  (iii).

US Pat. No. 10,689,722

ALUMINUM FOIL ANNEALING FURNACE

NINGBO SACHSEN INDUSTRY T...

1. An aluminum foil annealing furnace, comprising a furnace body, a furnace door mounted at a front of the furnace body, and a plurality of resistance heaters fixedly mounted over the furnace body, each of the plurality of resistance heaters being connected with an air circulation pipeline system; each air circulation pipeline system including a circulating blower fixedly mounted over the furnace body, an air outlet pipeline communicating with an air outlet of the resistance heater connected thereto through an air outlet elbow, and an air return pipeline communicating with an air inlet of the circulating blower through an air return elbow, an air inlet of each resistance heater communicating with an air outlet of the circulating blower, all air outlet pipelines and all air return pipelines being evenly arranged in the furnace body; all air return elbows being provided with a pipeline for communicating with air outside of the aluminum foil annealing furnace, the pipeline being provided with a negative pressure relief valve for controlling of opening or closing of the pipeline.

US Pat. No. 10,689,720

DRYING UNIT FOR ACCOMMODATING A PLURALITY OF ELONGATED HOLLOW PELT BOARDS

1. A pelt processing system comprising:a plurality of expandable pelt boards, each of the pelt boards having a pelt board top, a pelt board bottom and a connecting element at the pelt board bottom, each of the pelt boards being operable between an expanded state and a non-expanded state by moving the connecting element relative to the pelt board bottom;
a holding unit configured for accommodating the plurality of pelt boards, the holding unit defining a top plate having a number of apertures, each of the apertures being configured for accommodating one of the connecting elements;
a blowing unit operatively connected to the holding unit and comprising a bottom plate parallel to and spaced apart from the top plate, a gas inlet configured for receiving a stream of gas, and a sidewall interconnecting the top plate and the bottom plate in a fluid-tight manner for establishing an inner space between the top plate, the bottom plate, the gas inlet, and the sidewall; and
a release mechanism operable for causing the pelt boards on the holding unit to assume the non-expanded state.

US Pat. No. 10,689,716

MATERIALS AND METHODS FOR DETECTING CORONAVIRUS

UNIVERSITY OF MIAMI, Mia...

12. A method for detecting Coronavirus polynucleotides in a biological sample comprising:(a) an amplifying step comprising adding the biological sample to a vessel containing a primer pair that is capable of amplifying Coronavirus polynucleotides, if present, in the biological sample, wherein at least one primer of the primer pair comprises the sequence of SEQ ID NO: 1,
(b) digesting amplified Coronavirus polynucleotides in the vessel into a single-stranded amplified product before the combing step;
(c) combining the single-stranded amplified product with a running buffer comprising a capture probe that is capable of detecting the single-stranded amplified product to form a mixture, and incubating the mixture for a period of time in the vessel; and,
(d) a detecting step comprising wicking the mixture into a test strip and visually detecting the capture probe on the test strip.

US Pat. No. 10,689,704

METHOD FOR PREDICTING CERVICAL SHORTENING AND PRETERM BIRTH

Imperial College of Scien...

1. A method for reducing the risk of cervical shortening or preterm labor (PTL) comprising:determining an elevated expression level of an miRNA molecule having SEQ ID NO:7 extracted from a biological sample obtained from a pregnant female subject as compared to a control value; and
administering to the subject one or more of a-cervical ultrasound screening, therapeutic intervention, and surgical intervention.

US Pat. No. 10,689,698

ELECTROCHEMICAL DETECTION OF POLYMERASE REACTIONS BY SPECIFIC METAL-PHOSPHATE COMPLEX FORMATION

AMARYLLIS INNOVATION GMBH...

1. An electrochemical nucleic acid sequencing method comprising the steps of:a. providing a sample comprising a template nucleic acid to be sequenced;
b. annealing a primer molecule to said template nucleic acid;
c. carrying out nucleic acid elongation steps with a polymerase on said template nucleic acid in the presence of manganese ions, wherein each step comprises the addition of a single type of nucleotide, wherein pyrophosphate is released in a stoichiometric ratio to the number of nucleotides incorporated, and wherein the manganese ions are capable of preferentially binding to pyrophosphate in solution;
d. measuring, in said sample, the potential, current or charge at an electrode prior to the elongation steps and after the elongation steps, wherein the electrode used is selective for the manganese ion; and
e. comparing the change in potential, current or charge from the measurement prior to the elongation steps to the measurement after the elongation steps.

US Pat. No. 10,689,691

UNBIASED IDENTIFICATION OF DOUBLE-STRAND BREAKS AND GENOMIC REARRANGEMENT BY GENOME-WIDE INSERT CAPTURE SEQUENCING

THE BROAD INSTITUTE, INC....

1. A method for identifying the location of at least one double strand break (DSB) in DNA of a cell or tissue, the method comprising:a) ligating a linker to each end of the DSB to create a linker-DSB conjugate at each end,
wherein the linker comprises:
i) a promoter sequence for linear amplification, and
ii) a unique molecular identifier sequence;
b) producing a polynucleotide complementary to the linker-DSB conjugate by linear amplification; and
c) determining the sequence of the complementary polynucleotide, whereby the location of the DSB is identified;wherein each linker comprises a different unique molecular identifier sequence, and wherein the complementary polynucleotide comprises a sequence of the DNA adjacent to the DSB.

US Pat. No. 10,689,688

DETECTING CHEMICAL AND BIOLOGICAL AGENTS USING TEXTILE-BASED SENSORS

SRC, Inc., North Syracus...

1. A method for detecting the presence of a biological or chemical target using a textile-based sensor, the method comprising the steps of:contacting a sample with a sensor, the sensor comprising: (i) a textile comprising a plurality of textile fibers, wherein the textile is a textile patch; (ii) a plurality of aptamer molecules extending outwardly from at least some of the plurality of textile fibers of the textile, each aptamer molecule comprising a target binding domain selected to bind to the target when the target is present, and each aptamer molecule further comprising a metal nanoparticle reversibly immobilized to a first end of each of said plurality of aptamer molecules, wherein said metal nanoparticle is released from the aptamer molecule when the target binds to the target binding domain; and (iii) a stabilizing agent selected to stabilize the plurality of aptamer molecules, wherein the stabilizing agent is selected from the group consisting of trehalose, a natural polymer, a synthetic polymer, and combinations thereof, and further wherein the stabilizing agent comprises a plurality of stabilizing nanoparticles immobilized to the plurality of textile fibers, wherein each aptamer molecule is immobilized at a second end to at least one of the stabilizing nanoparticles; and
detecting a reporter signal generated by the sensor in response to the target binding to the target binding domain of one or more of the plurality of aptamer molecules.

US Pat. No. 10,689,675

ENZYMATIC PROCESSES FOR THE PREPARATION OF (±)-2-(DIFLUOROMETHYL)-1-(ALKOXYCARBONYL)-CYCLOPROPANECARBOXYLIC ACID AND (±)-2-(VINYL)-1-(ALKOXYCARBONYL)-CYCLOPROPANECARBOXYLIC ACID

AbbVie Inc., North Chica...

1. A method of conversion of starting material 1 to reaction product 2 according to reaction Scheme A:
wherein R1 is (C1-C6)alkyl;
R2 is —CF2H or —CH?CH2; and
the first enzyme is a mutant of BsteE esterase;
wherein BsteE esterase has the sequence:
AKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPP EELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAP MYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHL DLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAF LESLDW (SEQ ID NO:10); and
wherein the mutant of BsteE esterase comprise the sequence ID NO: 10 having a first mutation of T25H, a second mutation of L92H, and a third mutation selected from the group consisting of C115S, C115A, K121R, K121Y, K121H, K121D, K121L, K121T, K121A, K121N, E123T, M126F, M126V, M126I, M126Q, M126N, K164S, L166N, L166M, L166I, L166T, L166A, I170N, I170Q, I170V, I170T, I170A, D172N, M194A, M194L, I195G, I195A, I195V, and K215N.

US Pat. No. 10,689,669

AUTOMATED MULTI-MODULE CELL PROCESSING METHODS, INSTRUMENTS, AND SYSTEMS

Inscripta, Inc., Boulder...

20. An automated multi-module cell editing instrument comprising:a housing configured to house some or all of the modules;
a receptacle configured to receive cells;
at least one receptacle configured to receive nucleic acids, wherein the nucleic acids comprise editing machinery;
a growth module configured to grow the cells;
a filtration module configured to concentrate the cells and render the cells electrocompetent;
a transformation module comprising a flow-through electroporator to introduce the nucleic acids into the cells;
a combination recovery and editing module configured to allow the cells to recover after electroporation in the transformation module and to allow the nucleic acids to edit the cells;
an enrichment module to enrich for cells receiving the editing machinery;
a processor configured to operate the automated multi-module cell editing instrument based on user input and/or selection of a pre-programmed script; and
an automated liquid handling system to move cells from the receptacle configured to receive cells to the growth module; from the growth module to the filtration module, from the filtration module to the transformation module, from the transformation module to the combination recovery and editing module, and from the combination recovery and editing module to the enrichment module; and to move nucleic acids from the receptacle configured to receive nucleic acids to the transformation module, all without user intervention.

US Pat. No. 10,689,663

METHODS FOR CONFERRING OR ENHANCING HERBICIDE RESISTANCE ON PLANTS AND/OR ALGA WITH PROTOPORPHYRINOGEN OXIDASE VARIANTS

FARM HANNONG CO., LTD., ...

1. A method of conferring herbicide resistance on a plant or an alga, the method comprising: transforming an alga, plant cell, protoplast, callus, hypocotyl, seed, cotyledon, shoot, or plant with a nucleotide sequence encoding a polypeptide consisting of the amino acid sequence of SEQ ID NO: 5, wherein the herbicide is selected from the group consisting of Tiafenacil, Saflufenacil, Butfenacil, Flumioxazin, Fomesafen, Actifluorfen, Oxyfluorfen, Sulfentrazone, Pentoxazone, Pyraflufen-ethyl, Oxadiozon, Fluthiacet-methyl, Pyraclonil, and a combination thereof.

US Pat. No. 10,689,655

OFF-AXIS COLLIMATION OPTICS

Seoul Semiconductor Co., ...

1. A collimator comprising a transparent body having:a central axis;
a central cavity bounded by a circumferential surface and a front lens surface, the lens surface shaped to refract light from a predetermined location on the central axis in the cavity through the body to and out through a front exit surface;
an outer reflector surface shaped to reflect light from the predetermined location refracted by the circumferential surface of the cavity through the body to and out through the front exit surface;
wherein the reflector surface comprises first and second parts connected by an optically inactive surface, and at least one of said first and second parts is not symmetrical about the central axis;
wherein the circumferential surface, the front lens surface and the outer reflector surface are arranged to direct the light in at least two beams outside the front exit surface, one of said beams on said central axis and the other of said beams having a center diverging from said central axis; and
wherein said optically inactive surface connects a radially outer end of the first part of the reflector surface to a radially inward end of the second part of the reflector surface, and wherein both first and second parts each form an angle greater than zero degrees with respect to the central axis.

US Pat. No. 10,689,645

AUTOMATED CELL PROCESSING METHODS, MODULES, INSTRUMENTS, AND SYSTEMS

Inscripta, Inc., Boulder...

10. An automated stand-alone multi-module cell editing instrument for performing nuclease editing comprising:a first receptacle configured to receive cells;
a second receptacle configured to receive nucleic acids;
a growth module for growing the cells for transformation;
a transformation module comprising an electroporator to introduce the nucleic acids into the cells;
a nuclease-directed editing module configured to select for transformed cells and to allow the nucleic acids to edit nucleic acids in the cells to produce edited cells;
a processing environment comprising a processor configured to operate the automated multi-module cell editing instrument based on user input and/or selection of a script, wherein the processor comprises a robotics controller, module controller and temperature controller; and
an automated liquid handling system to move liquids from the first and second receptacles to the transformation module, from the transformation module to the nuclease-directed editing module, all without user intervention.

US Pat. No. 10,689,644

SYSTEMS AND METHODS FOR GENETIC ANALYSIS OF INTRACTABLE MICROBES

Duke University, Durham,...

1. A method of identifying a genetic regulator of motility affecting host colonization, the method comprising:contacting Exiguobacterium with a mutagen in vitro to produce a plurality of mutagenic variants;
performing a low-melt agar, swarming based assessment of the mutagenic Exiguobacterium variants and isolating those that are non-motile;
sequencing at least a portion of the plurality of non-motile mutagenic Exiguobacterium variants' genomes; and
determining differences in the genomic sequences of the plurality of non-motile mutagenic Exiguobacterium variants as compared to a reference genome,
wherein the differences in the genomic sequences between the plurality of mutagenic variants and the reference genome are used to identify a genetic regulator of motility affecting host colonization.

US Pat. No. 10,689,642

MOLECULAR SENSOR SELECTION

THE BOARD OF TRUSTEES OF ...

12. A method to isolate an RNA aptamer comprising the steps of:(a) in vitro transcribing a DNA library to produce RNA;
(b) cleaving the RNA to yield cleaved and uncleaved RNA;
(c) reverse transcribing the cleaved and uncleaved RNA to cDNA without isolating the cleaved or uncleaved RNA;
(d) selectively amplifying the cDNA such that cDNA molecules corresponding to RNA molecules that have been cleaved are amplified by a different amount relative to cDNA molecules corresponding to uncleaved RNA;
(e) preparing the amplified cDNA of (d) for in vitro transcription;
(f) repeating steps (a)-(e) one or more times; and,
(g) determining the sequence of one or more of the molecules in the product of step (f).

US Pat. No. 10,689,641

RECOMBINANT FUSION PROTEINS AND LIBRARIES FROM IMMUNE CELL REPERTOIRES

GigaGen, Inc., South San...

1. A kit for producing a library of recombinant immunoglobulin expression constructs, the kit comprising:a. a plurality of at least 10,000 unique, recombinant fusion polynucleotides, each comprising a first polynucleotide and a second polynucleotide and a linker polynucleotide,
the first polynucleotide encoding a heavy chain variable domain from a cognate pair from a single isolated mammalian B cell and an IgG heavy chain constant domain fragment; and
the second polynucleotide encoding a light chain variable domain from the cognate pair from the single isolated mammalian B cell and an IgK light chain constant domain; and
the linker polynucleotide linking the first and second polynucleotides and comprising a restriction site; and
b. a third recombinant polynucleotide, not operationally linked to the recombinant fusion polynucleotides, comprising a first AOX1 promoter sequence and a sequence encoding a portion of the IgG heavy chain constant domain, wherein the third recombinant polynucleotide comprises a first end sequence and a second end sequence, each overlapping with a first or second end sequence of each recombinant fusion polynucleotide; and
c. a fourth recombinant polynucleotide, not operationally linked to the recombinant fusion polynucleotides or the third recombinant polynucleotide, comprising a second AOX1 promoter sequence.

US Pat. No. 10,689,639

TETHERING CYSTEINE RESIDUES USING CYCLIC DISULFIDES

Brandeis University, Wal...

1. A method of treating a patient suffering from Amyotrophic Lateral Sclerosis (ALS), Parkinson's disease, or Alzheimer's disease, wherein said method comprises administering to the patient a stabilized superoxide dismutase (SOD1) dimer or a stabilized DJ-1 dimer, wherein said stabilized superoxide dismutase dimer has a tertiary structure and comprises a first SOD1 monomer and a second SOD1 monomer; wherein the first SOD1 monomer comprises a first cysteine residue; the second SOD1 monomer comprises a second cysteine residue, and wherein said first SOD1 monomer and said second SOD1 monomer is at least 85% sequence identity to the amino acid sequence of SEQ ID NO:2; or said stabilized DJ-1 dimer has a tertiary structure and comprises a first DJ-1 monomer and a second DJ-1 monomer; wherein the first DJ-1 monomer comprises a first cysteine residue; the second DJ-1 monomer comprises a second cysteine residue, and wherein said first DJ-1 monomer and said second DJ-1 monomer Is at least 85% sequence identity to the amino acid sequence of SEQ ID NO:1; and wherein the first cysteine residue is connected to the second cysteine residue by a connection; and the connection is a connection of Formula III or Formula IV:
wherein
Y is S, S=0, or S(=0)2; n is 0, 1, 2, 3, or 4;
R is independently selected from the group consisting of —H, —OH, —NH2, —NHR?, —N(R?)2, alkyl, —OMs, —OTs, —OTf, and —CO2H; or any two geminal R groups, taken together, form an imine; or any two vicinal R groups, taken together, form a ring; wherein any alkyl or imine may be substituted with a carbamide, a carboxylate, or a hydroxyl; and
R? is alkyl or aryl; and
R? is —H, alkyl, or aryl, or both R?, taken together, form a ring; wherein any alkyl, aryl, or ring may be substituted with —OH, alkyl, or halo.

US Pat. No. 10,689,624

COMPOUND FOR IDENTIFYING PLURIPOTENT CELLS

Kyoto University, Kyoto ...

1. An in vitro method for removing pluripotent cells, comprising a step of contacting a compound represented by formula (I);wherein R1 represents, a naphthyl group; m represents 1; and n represents 2 or 3, or formula (II):wherein R1 represents, a naphthyl group; R2 represents a glycine residue; m represents 1; and represents 3, with a cell population containing pluripotent cells and cells differentiated from pluripotent cells.

US Pat. No. 10,689,621

KITS AND MATERIALS FOR IMPLANTABLE COLLAGEN DEVICES

MiMedx Group, Inc., Mari...

1. A medical kit, comprising:a single-use flexible package holding a collagen construct comprising a plurality of synthetic elongate collagen fibers, wherein the plurality of synthetic elongate collagen fibers comprise ligament or tendon phenotype cells, and wherein the tendon or ligament phenotype cells extend over at least 50% of a length of the collagen fibers.

US Pat. No. 10,689,612

METHOD TO PURIFY COCCIDIAL OOCYSTS FROM ANIMAL FAECES, A SYSTEM SUITABLE FOR APPLYING THIS METHOD AND OOCYSTS OBTAINED THEREWITH

Intervet Inc., Madison, ...

8. A system (20) suitable for purifying a quantity of coccidial oocysts having dimensions between Dmin and Dmax from faeces or a fine fraction thereof, the system comprising:a first sieve deck (21?) that is drum shaped and comprises mesh openings suitable to let the oocysts pass the first sieve deck in a first filtrate (11), and obstruct particles larger than the oocysts, which particles form a first residue,
a means for automatically loading the first filtrate to the inside of a second sieve deck (22?), which is rotating, wherein the second sieve deck is drum shaped, and
wherein the second sieve deck comprises mesh openings to obstruct passing of the oocysts through the second sieve deck and let particles smaller than the oocysts pass to obtain a second filtrate and a second residue,
wherein the second residue comprises the oocysts and is suitable to be used in a vaccine, and
wherein the first sieve deck comprises mesh openings larger than Dmin and up to 1.1 times Dmax and the second sieve deck comprises mesh openings of between 0.9 to 1.1 times Dmin.

US Pat. No. 10,689,611

CRYOPRESERVATION BAGS AND METHOD OF USE THEREOF FOR CLOSED SYSTEM, HIGH CAPACITY CELL-BANKING

Boehringer Ingelheim Anim...

1. A high-capacity cryopreservation bag, which is adapted for use in a high capacity biological material, closed cryopreservation banking system, and which is resistant to liquid nitrogen temperatures comprising:a. a first fluorinated ethylene propylene (FEP) enclosure;
b. at least two sterile-weldable fluid conduits adapted for use in a high capacity biological material, closed banking system;
c. a first rigid FEP inlet conduit, in fluid connection with the first FEP enclosure, and connectable to the first of the two sterile-weldable fluid conduits, wherein said first conduit is a first flexible PVC tube;
d. a second rigid FEP outlet conduit, in fluid connection with the first FEP enclosure, and connectable to the second of the two sterile-weldable fluid conduits, wherein said second conduit is a second flexible PVC tube; and
e. a FEP pouch, which is initially open at one end, and which is contiguous with the first FEP enclosure, but thermosealed therefrom, and encircling both the rigid inlet conduit and the rigid outlet conduit;
wherein the pouch extends sufficiently far enough such that when the first enclosure has been filled with the biological material during use, the first and second flexible PVC tubes are withdrawn into the pouch, which is then thermosealed to form a second enclosure, which now contains both PVC tubes.

US Pat. No. 10,689,610

GAS-FED FERMENTATION REACTORS, SYSTEMS AND PROCESSES UTILIZING GAS/LIQUID SEPARATION VESSELS

Calysta, Inc., Menlo Par...

1. A system for stimulating production of biomass comprising:a loop reactor, the loop reactor including:
a fluid moving device having an inlet and an outlet, the inlet of the fluid moving device in fluid communication with an outlet of a substantially vertical downflow zone;
a loop section including an outlet and an inlet, the inlet of the loop section in fluid communication with the outlet of the fluid moving device;
a substantially vertical upflow zone including an outlet and an inlet, the inlet of the substantially vertical upflow zone in fluid communication with the outlet of the loop section; and
a gas/liquid separation vessel having a longitudinal axis and including:
an outlet and an inlet, the inlet of the gas/liquid separation vessel located in a lower portion of the gas/liquid separation vessel and in fluid communication with the outlet of the substantially vertical upflow zone, the outlet of the gas/liquid separation vessel in fluid communication with an inlet of the substantially vertical downflow zone;
an intermediate section between the outlet and the inlet of the gas/liquid separation vessel, the intermediate section having a constant diameter equal to D;
an outlet side section on one side of the intermediate section, the outlet side section including the outlet of the gas/liquid separation vessel; and
an inlet side section on a side of the intermediate section opposite the outlet side section, the inlet side section including the inlet of the gas/liquid separation vessel, the inlet side section having a shape of an oblique conical frustum and having an increasing diameter in a direction of fluid flow through the inlet side section.

US Pat. No. 10,689,609

ACOUSTIC BIOREACTOR PROCESSES

FloDesign Sonics, Inc., ...

1. A process for growing cells in a bioreactor, comprising:suspending the cell culture in a growth volume of a bioreactor, the bioreactor including at least one ultrasonic transducer and a reflector located opposite the at least one ultrasonic transducer, each ultrasonic transducer being driven to produce an acoustic standing wave that holds the cell culture in the growth volume, wherein the cells undergo division while held in the acoustic standing wave.

US Pat. No. 10,689,608

DROPLET FLUID CONNECTIONS

EMULATE, INC., Boston, M...

1. A first fluidic device comprising a substrate having a first mating surface, said first mating surface comprising one or more fluidic ports, wherein said first mating surface is adapted to stably retain a first protruding liquid droplets comprising a first liquid at the one or more fluidic ports, wherein said port of said first fluidic device comprising said first protruding liquid droplet is aligned with a port of a second fluidic device comprising a second protruding droplet so as to permit fluidic communication.

US Pat. No. 10,689,606

APPARATUS AND METHOD FOR THREE-DIMENSIONAL (3D) PRINTING/BIO-PRINTING

1. An apparatus for three-dimensional bio-printing, comprising:a chamber, wherein the chamber is semi or fully closed and is enabled to maintain one or more predefined environmental parameters for cell culture and growth, wherein the chamber further comprises an air supply unit, a housing, one or more printing heads, a printing platform, sterilizing means comprising an UV lamp along with an ozone generator, a gas detector, one or more gas exchange units and a gas removal unit wherein the gas removal unit further comprises a gas removal filter and a gas removal fan;
wherein the air supply unit is configured to pull the air from the ambient environment and pass filtered air into the housing, and wherein the gas removal unit is configured to remove a small portion of filtered air from the chamber, thereby creating a positive pressure in the housing;
wherein the one or more gas exchange units are configured to add and adjust an amount of external gases into the chamber during the printing of the three dimensional print;
wherein the housing is configured to receive the filtered air and adapted to house the one or more printing heads, the printing platform and the one or more sterilizing means;
wherein the printing platform is coated with an antibacterial material, wherein the printing platform is printed with a three dimensional print by dispensing biomaterials through the one or more printing heads;
wherein the gas detector is configured to detect the amount of air component inside the chamber and the external gases, wherein the external gases detected comprises carbon dioxide, oxygen, nitrogen, carbon monoxide, nitrogen dioxide and argon;
wherein the one or more gas exchange units are configured to add and adjust the amount of external gases into the chamber based upon the amount of air component inside the chamber and the external gases detected by the gas detector;
wherein the UV lamp along with the ozone generator are configured to be turned on before printing the three dimensional prints in order to sterilize the housing; and
wherein the gas removal filter is configured to remove a small portion of filtered air from the chamber.

US Pat. No. 10,689,605

LAUNDRY DETERGENT CAPSULE

Conopco, Inc., Englewood...

1. A laundry detergent capsule containing a laundry detergent composition, the capsule including a capsule base with one or more side walls extending from the base to form a detergent composition cavity accommodating the laundry detergent composition, wherein the capsule includes a capsule lid for sealing the detergent composition cavity, the capsule base, side wall(s) and/or lid include a water-soluble material and the capsule lid includes a flange extending from a lid portion and abutting the side wall or side walls, wherein the flange is a ridge or rim extending downwardly from the lid portion, the peak of the flange rim or ridge extends concentrically with the upper rim of side wall or side walls and the flange rim or ridge extends for 80% or more of the circumference or perimeter of the upper rim of the side wall or side walls, and the flange rim or ridge has 2, 3, 4, 5 or 6 breaks or gaps arranged symmetrically around the circumference or perimeter of the upper rim of the side wall or side walls.

US Pat. No. 10,689,599

DEA-FREE POT AND PAN CLEANER FOR HARD WATER USE

Ecolab USA Inc., Saint P...

1. A method of cleaning a surface comprising:diluting a concentrated cleaning composition with water at a ratio between about 1:2 and about 1:250 of concentrated cleaning composition to water to form a use solution with a viscosity between about 25 cps and about 125 cps;
wherein said concentrated cleaning composition comprises
from about 5 wt. % to about 50 wt. % of a surfactant system comprising a linear alcohol ethoxylate, a semi-polar nonionic surfactant, betaine, and a sultaine;
from about 0.01 wt. % to about 15 wt. % of a coupling agent;
from about 0.01 wt. % to about 8 wt. % of a divalent ion; and
from about 1 wt. % to about 50 wt. % of a humectant;
wherein the linear alcohol ethoxylate is present in the composition from about 1 wt. % to about 15 wt. %;
wherein the semi-polar nonionic surfactant is present in the composition from about 0.5 wt. % to about 25 wt. %;
wherein the sultaine is in a concentration of about 4.5 wt. % to about 11 wt. % of the cleaning composition and comprises a coco cut or lauryl cut sultaine;
wherein the composition has less than 0.5 wt. % diethanolamine;
wherein the ratio of the sultaine to the linear alcohol ethoxylate is between about 1:11 and about 7:4, and
wherein the ratio of the sultaine to the semi-polar nonionic surfactant is between about 3:1 and about 1:3;
contacting a surface with said use solution; and
rinsing the surface.

US Pat. No. 10,689,595

SYNTHESIS AND USE OF OMEGA-HYDROXYLATED POLYUNSATURATED FATTY ACIDS

THE REGENTS OF THE UNIVER...

1. A method for preparing a compound of Formula II:
the method comprising:
forming a coupling reaction mixture comprising a transition-metal coupling agent, a base, a compound of Formula III:

 and
a compound of Formula IV:

under conditions suitable to form the compound of Formula II;
wherein:
the transition-metal coupling agent comprises a metal selected from the group consisting of copper, iron, nickel, palladium, zinc, and combinations thereof;
R is C1-C4 alkyl;
X is selected from the group consisting of Cl, Br, I, —OTs, and —OTf;
subscript m is 2 or 3;
subscript n is 0 or 1; and
bond a is a single bond or a triple bond.

US Pat. No. 10,689,593

LOW VISCOSITY LUBRICATING OIL COMPOSITIONS FOR TURBOMACHINES

ExxonMobil Research and E...

1. A lubricating turbine oil having a composition comprising a lubricating oil base stock, present in an amount of from about 90 weight percent to about 99 weight percent, based on the total weight of the lubricating turbine oil; and one or more lubricating oil additives, present in an amount of from about 0.1 weight percent to about 10 weight percent, based on the total weight of the lubricating turbine oil; wherein the lubricating turbine oil has a kinematic viscosity of about 16 cSt to about 22 cSt at 40° C. according to ASTM D445, a density of about 0.8 g/ml to about 0.9 g/ml according to ASTM D1298, and an absolute evaporation loss at 150° C. of less than about 4% according to ASTM D972,wherein the lubricating oil base stock is selected such that the lubricating turbine oil possesses a Lubricating Efficiency Factor of at least 10, according to the following formula:
Lubricating Efficiency Factor=[19.200(Specific Heat)]?[6.679(Evaporation Loss)]?[1.028(Dynamic Viscosity)]?12.178.

US Pat. No. 10,689,592

LUBRICANT FOR A TWO-STROKE MARINE ENGINE

TOTAL MARKETING SERVICES,...

1. Lubricant composition comprising:at least one lubricant base oil,
at least a di-fatty-alkyl(ene) polyalkylamine composition comprising one or more polyalkylamines of formulae (I) or (II):
wherein,each R is, independent of the other R, an alkyl moiety or an alkylene moiety with 8 to 22 carbon atoms, which is linear or branched,
n and z are independent of each other either 0, 1, 2, or 3, and
when z is superior than 0 then o and p are independent of each other either 0, 1, 2, or 3,or derivatives thereof,whereby said polyalkylamine composition comprises at least 3% by weight of branched compounds of formula (I) or (II), with regards to the total weight of polyalkylamine compounds (I) and (II) in the composition, branched compound signifying that:
in formula (I) at least one of n and z are superior or equal to 1,
in formula (II) n is superior or equal to 1.

US Pat. No. 10,689,590

REFINING ASSEMBLIES AND REFINING METHODS FOR RICH NATURAL GAS

Element 1 Corp., Bend, O...

1. A refining assembly for rich natural gas containing a first methane gas and other hydrocarbons that are heavier than methane gas, comprising:a vaporizer configured to receive and vaporize at least a portion of at least one liquid-containing feedstream that includes water and rich natural gas to form an at least substantially vaporized stream;
a methane-producing reactor containing a catalyst and configured to receive the at least substantially vaporized feed stream and to produce an output stream by (a) converting at least a substantial portion of the other hydrocarbons with the water to a second methane gas, a lesser portion of the water, hydrogen gas, and carbon oxide gas, and (b) allowing at least a substantial portion of the first methane gas from the rich natural gas stream to pass through the methane-producing reactor unconverted; and
a first heating assembly configured to receive at least one fuel stream and at least one air stream and to produce a heated exhaust stream for heating the vaporizer to at least a minimum vaporization temperature and the methane-producing reactor to at least a minimum methane-producing temperature.

US Pat. No. 10,689,587

SYSTEMS AND PROCESSES FOR CONVERSION OF CRUDE OIL

Saudi Arabian Oil Company...

1. A process for producing petrochemicals from crude oil, the process comprising:passing the crude oil and hydrogen into a hydroprocessing reactor, the hydroprocessing reactor comprising one or more hydroprocessing catalysts that produce a hydrotreated oil;
separating the hydrotreated oil into a lesser boiling point fraction and a greater boiling point fraction;
passing the lesser boiling point fraction to a pyrolysis section of a steam cracker to produce a pyrolysis effluent comprising olefins, aromatics, or both;
passing the greater boiling point fraction to a gasifier, where the gasifier produces hydrogen; and
passing at least a portion of the hydrogen produced by the gasifier to the hydroprocessing reactor.

US Pat. No. 10,689,586

METHODS AND SYSTEMS FOR PRODUCING OLEFINS AND AROMATICS FROM COKER NAPHTHA

SABIC GLOBAL TECHNOLOGIES...

1. A method for producing olefins and aromatics from a coker naphtha feedstock, the method comprising the steps of:(a) removing silica from the coker naphtha feedstock to produce a first effluent;
(b) hydrogenating the first effluent to produce a second effluent;
(c) reacting the second effluent to produce a third effluent comprising aromatics, a fourth effluent comprising olefins, and a fifth effluent;
(d) separating the fourth effluent to produce a propylene product stream, an ethylene product stream, and a sixth effluent;
(e) recycling the sixth effluent by combining it with the second effluent;
(f) extracting benzene, toluene, and xylene from the third effluent to produce a benzene product stream, a mixed-xylene product stream, a C9+ aromatics product stream, and a seventh effluent;
(g) converting the toluene in the seventh effluent to produce an eighth effluent and a ninth effluent; and
(h) recycling the eighth effluent by combining it with the third effluent.

US Pat. No. 10,689,585

SYSTEMS AND METHODS FOR PROCESSING HEAVY OILS

Saudi Arabian Oil Company...

1. A method for processing heavy oil, the method comprising:upgrading at least a portion of the heavy oil to form an upgraded oil, the upgrading comprising contacting the heavy oil with a hydrodemetalization catalyst, a transition catalyst, a hydrodenitrogenation catalyst, a first hydrocracking catalyst, and a second hydrocracking catalyst downstream of the first hydrocracking catalyst to remove at least a portion of metals, nitrogen, or aromatics content from the heavy oil and form the upgraded oil;
wherein the final boiling point of the heavy oil is greater than 540° C.;
wherein the final boiling point of the upgraded oil is less than or equal to 540° C.;
wherein the second hydrocracking catalyst cracks at least a portion of vacuum gas oil in the heavy oil; and
wherein the first hydrocracking catalyst comprises a greater average pore size than the second hydrocracking catalyst.

US Pat. No. 10,689,584

OXIDATIVE DESULFURIZATION OF LIQUID FUELS USING METAL SULFIDE QUANTUM DOTS/GRAPHEN OXID HYBRID NANOCATALYST

1. A method for oxidative desulfurization of liquid hydrocarbon fuels, comprising:contacting a liquid fuel with a quantum dot hybrid catalyst in a reactor vessel, the quantum dot hybrid catalyst comprising metal sulfide quantum dots intercalated over graphene oxide layers;
heating the reactor vessel to a temperature between 25° C. and 200° C.; and
reducing sulfur content of the liquid fuel with a sulfur reduction amount of more than 95% wt., comprising:
producing sulfone and sulfoxide compounds by oxidizing the liquid fuel with ozone gas in the presence of the quantum dot hybrid catalyst at the temperature between 25° C. and 200° C.; and
separating the sulfone and sulfoxide compounds from the liquid fuel by extracting the sulfone and sulfoxide with an extraction solvent.

US Pat. No. 10,689,576

LIQUID CRYSTAL COMPOSITION AND LIQUID CRYSTAL DISPLAY DEVICE

JNC CORPORATION, Tokyo (...

1. A liquid crystal composition that has negative dielectric anisotropy, and contains at least one compound selected from the group of polar compounds represented by formula (1) as a first additive:
wherein, in formula (1), R1 is hydrogen, fluorine, chlorine or alkyl having 1 to 25 carbons, and in the alkyl, at least one piece of —CH2— may be replaced by —NR0—, —O—, —S—, —CO—, —CO—O—, —O—CO—, —O—CO—O— or cycloalkylene having 3 to 8 carbons, and at least one tertiary carbon (>CH—) may be replaced by nitrogen (>N—), and in the groups, at least one hydrogen may be replaced by fluorine or chlorine, in which R0 is hydrogen or alkyl having 1 to 12 carbons; R2 is a polar a group having at least one of an oxygen atom having an OH structure, a sulfur atom having an SH structure and a nitrogen atom having a primary, secondary or tertiary amine structure; ring A, ring B and ring C are independently 1,4-cyclohexylene, 1,4-cyclohexenylene, 1,4-phenylene, naphthalene-1,2-diyl, naphthalene-1,3-diyl, naphthalene-1,4-diyl, naphthalene-1,5-diyl, naphthalene-1,6-diyl, naphthalene-1,7-diyl, naphthalene-1,8-diyl, naphthalene-2,3-diyl, naphthalene-2,6-diyl, naphthalene-2,7-diyl, tetrahydropyran-2,5-diyl, 1,3-dioxane-2,5-diyl, pyrimidine-2,5-diyl or pyridine-2,5-diyl, and in the rings, at least one hydrogen may be replaced by fluorine, chlorine, alkyl having 1 to 12 carbons, alkoxy having 1 to 12 carbons, or alkyl having 1 to 12 carbons in which at least one hydrogen is replaced by fluorine or chlorine; Z1 and Z2 are independently a single bond or alkylene having 1 to 10 carbons, and in the alkylene, at least one piece of —CH2— may be replaced by —O—, —CO—, —COO— or —OCO—, and at least one piece of —CH2—CH2— may be replaced by —CH?CH—, —C(CH3)?CH—, —CH?C(CH3)— or —C(CH3)?C(CH3)—, and in the groups, at least one hydrogen may be replaced by fluorine or chlorine; P1, P2 and P3 are a polymerizable group; Sp1, Sp2 and Sp3 are independently a single bond or alkylene having 1 to 10 carbons, and in the alkylene, at least one piece of —CH2— may be replaced by —O—, —COO—, —OCO— or —OCOO—, and at least one piece of —CH2—CH2— may be replaced by —CH?CH— or —C?C—, and in the groups, at least one hydrogen may be replaced by fluorine or chlorine; a and b are independently 0, 1, 2, 3 or 4, and a sum of a and b is 0, 1, 2, 3 or 4; and c and e are independently 0, 1, 2, 3 or 4, and d is 1, 2, 3 or 4.

US Pat. No. 10,689,575

OPTICAL FILM, POLARIZING PLATE, AND IMAGE DISPLAY DEVICE

FUJIFILM Corporation, To...

1. An optical film comprising, at least:an optically anisotropic layer,
wherein the optically anisotropic layer is a layer obtained by polymerizing a polymerizable liquid crystal composition containing a liquid crystal compound represented by Formula (1) and a polymerization initiator,
the polymerization initiator is an oxime type polymerization initiator represented by Formula (2), and
an extrapolated glass transition starting temperature of the optically anisotropic layer is 90° C. or higher,

in Formula (1),
Ar1 represents an n-valent aromatic group,
L1 represents a single bond, —COO—, or —OCO—,
A represents an aromatic ring having 6 or more carbon atoms or a cycloalkylene ring having 6 or more carbon atoms,
Sp represents a single bond, a linear or branched alkylene group having 1 to 12 carbon atoms, or a divalent linking group in which one or more —CH2— groups that constitute a linear or branched alkylene group having 1 to 12 carbon atoms are substituted with —O—, —S—, —NH—, —N(Q)-, or —CO—,
Q represents a polymerizable group,
m represents an integer of 0 to 2, and
n represents an integer of 1 or 2,
where all of L, A, Sp, and Q, a plurality of which are provided depending on the number of m or n, may be the same or different from each other,

in Formula (2),
X represents a hydrogen atom or a halogen atom,
Ar2 represents a divalent aromatic group,
L2 represents a divalent organic group having 1 to 12 carbon atoms,
R1 represents an alkyl group having 1 to 12 carbon atoms, and
Y represents a monovalent organic group.

US Pat. No. 10,689,572

ETCHANT COMPOSITION WITH HIGH SELECTIVITY TO SILICON NITRIDE

LTCAM CO., LTD., Pyeongt...

1. An etchant composition with a selectivity to a silicon nitride film provided over a silicon oxide film, comprising:a compound expressed by Chemical Formula 1 or Chemical Formula 2 described below

where R1 and R2 are independently selected from hydrogen, a hydroxy group, an alkyl group or a carboxy group;
phosphoric acid;
a silicon compound;
an amino acid compound; and
water.

US Pat. No. 10,689,571

LIGHT-EMITTING CERAMIC AND WAVELENGTH CONVERSION DEVICE

MURATA MANUFACTURING CO.,...

1. A light-emitting ceramic comprising:a pyrochlore type compound that contains 0.01 mol % or more of Bi with respect to 100 mol % of ABOW; and
at least one co-added element selected from the group consisting of Mg, Ca, Zn, Sr, Ba, Sc, Ga, In, Yb, and Lu,
wherein A contains at least one first element selected from the group consisting of La, Y, and Gd in a total amount of 80 mol % or more,
B contains at least Sn, and
W is a positive number for maintaining electrical neutrality.

US Pat. No. 10,689,570

SILICATE PHOSPHORS

Merck Patent GmbH, Darms...

1. A compound of formula (1),(Ba2?a?b?c?dMaAbREcDd)(Mg1?e?f?g?jM?eA?fRE?gC?j)(Si2?h?iB?hC?i)(O7+m?k?lXkNl)  Formula (1)
where the following applies to the symbols and indices used:
M is Ca, Sr, Zn or a mixture of these elements;
A is Na, K, Rb or a mixture of these elements;
RE is La, Y, Gd or a mixture of these elements;
D is Eu2+, Mn2+, Yb2+, Sm2+ or a mixture of these elements;
M? is Zr, Hf or a mixture of these elements;
A? is Li, Na or a mixture of these elements;
RE? is Sc, Lu or a mixture of these elements;
C? is B, Al, Ga, In or a mixture of these elements;
B? is Ge, Sn or a mixture of these elements;
C? is B, Al, Ga, In or a mixture of these elements;
X is F, Cl or a mixture of these elements;
N is nitrogen;
0?a?1.0;
0?b?0.6;
0?c?0.6;
0 0?e?0.3;
0?f?0.3;
0?g?0.3;
0?j?0.6;
0?h?1.0;
0?i?0.6;
0?k?2.1;
0?l?2.1;
?2.0?m?2.0;
wherein at least one and a maximum of three of the indices b, c, e, f, g, h, i, j, k, and l is ?0; and
wherein the compound contains a coating of aluminum oxide which has been deposited by an ALD process.

US Pat. No. 10,689,569

OVERCOATING INORGANIC QUANTUM DOT AND METHOD FOR PREPARING THE SAME

Taiwan Hopax Chemicals Mf...

1. An overcoating inorganic quantum dot, comprising:a plurality of perovskite quantum dots being contained in a single oxide overcoat, wherein the oxide overcoat is In2O3.

US Pat. No. 10,689,568

ORGANIC ELECTROLUMINESCENT DEVICE

Samsung Display Co., Ltd....

1. An organic electroluminescent (EL) device, comprising:an anode;
an emission layer; and
an organic layer between the anode and the emission layer;
wherein the organic layer includes an organic material represented by Formula 1:

wherein in Formula 1,
Y is O or S,
R1 to R6 are each independently hydrogen, deuterium, a halogen atom, a substituted or unsubstituted alkyl group having 1 to 15 carbon atoms, a substituted or unsubstituted silyl group, a substituted or unsubstituted aryl group having 6 to 30 carbon atoms for forming a ring, a substituted or unsubstituted heteroaryl group having 1 to 30 carbon atoms for forming a ring, or a substituted or unsubstituted aryl group or heteroaryl group formed via condensation of optional adjacent substituents;
Ar1 and Ar2 are each independently a substituted or unsubstituted aryl group having 6 to 30 carbon atoms for forming a ring, and each of Ar1 and Ar2 is not a heteroaryl-containing group;
L1 to L3 are each independently a direct linkage, a substituted or unsubstituted alkylene group having 1 to 15 carbon atoms, a substituted or unsubstituted aralkylene group having 7 to 30 carbon atoms, a substituted or unsubstituted arylene group having 6 to 30 carbon atoms for forming a ring, a substituted or unsubstituted heteroarylene group having 1 to 30 carbon atoms for forming a ring, or a substituted or unsubstituted divalent silyl group;
m is an integer from 0 to 3; and
n is an integer from 0 to 4.

US Pat. No. 10,689,567

TREATMENT FLUIDS COMPRISING ANHYDROUS AMMONIA FOR USE IN SUBTERRANEAN FORMATION OPERATIONS

HALLIBURTON ENERGY SERVIC...

1. A method comprising:preparing a treatment fluid comprising a gelling agent, a base fluid and a bulk amount of anhydrous ammonia, wherein the anhydrous ammonia is present in an amount greater than about 70% by weight of a liquid portion of the treatment fluid, and
wherein the anhydrous ammonia is in a phase selected from the group consisting of a liquid phase, a gaseous phase, supercritical phase, and any combination thereof; and
introducing the treatment fluid into a subterranean formation,
wherein the preparing step occurs before introducing the treatment fluid through a wellhead.

US Pat. No. 10,689,566

COATED PARTICLES AND METHODS OF MAKING AND USING THE SAME

Anavo Technologies, LLC, ...

1. A particle comprising a core and a coating on at least a portion of a surface of the core, the coating comprising a cross-linked, charge-modified biopolymer,wherein the cross-linked, charge-modified biopolymer is cationic starch, and
wherein the coating is affixed on the core through cross-linking.

US Pat. No. 10,689,565

BOOSTERS FOR BREAKERS CONTAINING IRON COMPOUNDS

Kemira OYJ, Helsinki (FI...

1. A method for fracturing a subterranean formation penetrated by a well bore, the method comprising the step of injecting a well treatment fluid into the well bore at a pressure and flow rate sufficient to fracture the subterranean formation, wherein the well treatment fluid comprises:water;
at least one acrylamide-containing polymer in an amount of about 0.001% to about 5% of the well treatment fluid volume;
a ferrous salt in an amount of about 0.001% to about 0.05% of the well treatment fluid volume;
and one or more booster compounds in an amount of about 0.001% to about 0.05% of the well treatment fluid volume; and
wherein the one or more booster compounds are selected from the group consisting of urea; ethylenediaminetetraacetic acid (EDTA); salts of EDTA; citric acid; aminotricarboxylic acid and its salts; polyphosphonated and poly phosphate compounds; boric acid and its salts; alkali metal salts of carbonates; diethylenetriaminepentaacetic acid (DTPA); humic acids; and lignosulfates; and wherein the combination of the ferrous salt and the one or more booster compounds constitute a breaker composition sufficient to facilitate the breakdown of the at least one acrylamide-containing polymer in the absence of an oxidizer-based breaker.

US Pat. No. 10,689,563

BRANCHED GEMINAL ZWITTERIONIC LIQUIDS, METHOD FOR OBTAINING SAME AND USE THEREOF AS WETTABILITY MODIFIERS HAVING VISCOSITY REDUCING PROPERTIES

1. Branched geminal zwitterionic liquids based either on bis-N,N-dialkyl-N-polyether-betaine or bis-N,N-dialkenyl-N-polyether-betaine or Bis-N,N-dicycloalkyl-N-polyether-betaine or bis-N,N-diaryl-N-polyether-betaine, characterized by having the following molecular structure:
where:
R1 and R2 are the same and are a linear or branched alkyl having 1-30 carbon atoms, a linear or branched alkenyl having 2-30 carbon atoms, or a cycloalkyl or aryl group having from 5 to 12 carbon atoms;
The label n is an integer from 1 to 500, depending on the molecular weight of used polyether.

US Pat. No. 10,689,562

ARC PERM-SQUEEZE RDF—A PERMEABLE PLUG FORMING RAPIDLY DEHYDRATING FLUID

Saudi Arabian Oil Company...

1. An altered drilling fluid, comprising:a drilling fluid; and
a lost circulation material (LCM) composition, wherein the LCM composition comprises:
a carrier fluid;
a particulate material comprising a clay;
a viscosifier, wherein the viscosifier comprises a cellulosic microfiber; and
a fibrous material comprising date tree waste fibers, wherein the date tree waste fibers comprise an amount in the range of 6 weight % of the total weight (w/w %) to 9 w/w % of the LCM composition.

US Pat. No. 10,689,561

ARC PERM-SQUEEZE RDF—A PERMEABLE PLUG FORMING RAPIDLY DEHYDRATING FLUID

Saudi Arabian Oil Company...

1. A lost circulation material (LCM) composition, comprising:a carrier fluid;
a particulate material comprising a clay;
a viscosifier, wherein the viscosifier comprises a cellulosic microfiber; and
a fibrous material comprising date tree waste fibers, wherein the date tree waste fibers comprise an amount in the range of 6 weight % of the total weight (w/w %) to 9 w/w % of the LCM composition.

US Pat. No. 10,689,557

ASPHALT WATER-BASED DRILLING FLUID ADDITIVE

Owens Corning Intellectua...

1. A drilling fluid additive comprising:an emulsion including
50% to 70% by weight asphalt,
0.5% to 10% by weight of at least one emulsifier,
0.05% to 0.5% by weight cellulose ether, and
25% to 50% by weight water;
wherein the asphalt has a softening point of 160° F. to 212° F., a penetration depth of 0 mm to 45 mm, and a viscosity of 200 cP to 800 cP at 350° F.; and
wherein the drilling fluid additive includes asphalt particles with an average particle size of 0.1 micron to 10 microns.

US Pat. No. 10,689,556

THERMALLY CONDUCTIVE SHEET

Sekisui Polymatch Co., Lt...

1. A thermally conductive sheet comprisingan oriented-graphite thermally conductive layer and
an insulating thermally conductive layer stacked on the oriented-graphite thermally conductive layer,
the oriented-graphite thermally conductive layer including a polymer matrix including a plate-like graphite powder, flat surfaces of particles of the plate-like graphite powder being oriented in a thickness direction of the sheet,
an amount of plate-like graphite powder included in the oriented-graphite thermally conductive layer is 75 to 105 parts by mass relative to 100 parts by mass of the polymer matrix, and an amount of thermally conductive filler having an aspect ratio of 2 or less is 250 to 700 parts by mass relative to 100 parts by mass of the polymer matrix,
the insulating thermally conductive layer including a polymer matrix including an insulating thermally conductive filler,
the amount of the insulating thermally conductive filler is 300 to 2000 parts by mass relative to 100 parts by mass of the polymer matrix,
the insulating thermally conductive filler including particles at least one of aluminum oxide, magnesium oxide, zinc oxide, aluminum nitride, silicon carbide, and aluminum hydroxide, and
the insulating thermally conductive filler is dispersed in the polymer matrix,
the insulating thermally conductive layer having a thermal conductivity and an insulating property,
wherein the oriented-graphite thermally conductive layer has a Type-OO hardness of 10 to 80 as determined in accordance with ASTM D2240,
wherein the insulating thermally conductive layer is harder than the oriented-graphite thermally conductive layer and has a Type-E hardness of 70 or less as determined in accordance with ASTM D2240 and a thickness of 0.15 to 1.5 mm, and
wherein the thermal conductivity (W) (unit: W/m·K) and the thickness (T) (unit: mm) of the insulating thermally conductive layer satisfy a relationship represented by Formula (1),
0

US Pat. No. 10,689,550

ELECTRICALLY CONDUCTIVE COMPOSITION

FURUKAWA ELECTRIC CO., LT...

1. An electrically conductive composition, which comprises a sulfide compound expressed by the following general formula (1)R—S—R?  General Formula (1)
wherein R is an organic group that contains at least carbon; R? is an organic group that is the same as or different from R; R and R? may be bonded, and wherein the sulfide compound is a compound that contains at least one acryloyl group;
metal particles that contain at least one of Cu, Sn or Ni as essential components; and
a thermosetting resin, wherein the thermosetting resin comprises a maleic imide compound that contains two or more units of imide groups in one molecule.

US Pat. No. 10,689,549

MICROFIBERS WITH MUSHROOM-SHAPED TIPS FOR OPTIMAL ADHESION

NanoGriptech, Inc., Pitt...

1. A dry adhesive fiber structure with optimized geometric parameters for increasing adhesive performance, comprising:a dry adhesive fiber comprising a moldable plastic, the dry adhesive fiber including:
a mushroom-shaped tip having a flat surface with a radius at, inwardly inclined sides that form a wedge angle ? with the surface, a tip edge formed by the flat surface and the inclined sides, wherein the tip edge is rounded, and an end opposite the surface; and
a stem with a cross-sectional area having (i) a distal end connected to the end of the tip at a tip point of connection, (ii) a proximal end opposite the distal end, and (iii) a longitudinal length with a radius a from the distal end to the proximal end;
wherein the ratio of at/a is 1.05-1.4, the wedge angle ? is 20-55, and the normalized pull-off stress at the fiber surface is 0.7-0.9.

US Pat. No. 10,689,547

ADHESIVE COMPOSITIONS

POWDERTECH (BICESTER) LIM...

1. A contact curable adhesive composition, wherein the composition is a physically separated two-component composition that cures upon contact of the two components, the composition comprising:(A) an adhesive component comprising:
(i) an aliphatic glycidyl ether;
(ii) an aromatic glycidyl ether and optionally a cycloaliphatic epoxy; and
(iii) a silane reducing agent; and
(B) a catalyst component comprising:
(iv) a Group 9 or Group 10 noble metal catalyst,
wherein the adhesive component (A) and/or the catalyst component (B) further comprises an initiator.

US Pat. No. 10,689,546

METHOD FOR MANUFACTURING OPTICAL MEMBER

DEXERIALS CORPORATION, T...

1. A method for manufacturing an optical member in which a first member having a light transmitting property and a second member are laminated via a light transmitting resin layer comprising:an applying step of applying a photocuring resin composition in a liquid state to the surface of the first member or the second member to form a photocuring resin layer;
a precuring step of forming a photocuring precured resin layer on a surface of the first member or the second member, the photocuring precured resin layer having a thin film on a side to be bonded with the second member or the first member;
a bonding step of bonding the first member and the second member via the precured resin layer; and
a final curing step of final-curing the precured resin layer to form the light transmitting resin layer; wherein
the photocuring resin composition consists of photo-radical polymerizing poly(meth)acrylate, a photo-radical polymerizing (meth)acrylate, a softener comprising a liquid plasticizer or tackifier, a photoinitiator, and an ultraviolet absorber,
the precuring step comprises irradiating the photocuring resin layer with ultraviolet light to form the precured resin layer,
the final curing step comprises irradiating the photocuring resin layer with ultraviolet light to form the light transmitting resin layer,
a reaction ratio of a surface of the precured resin layer is 80% or more, and
a depth at which the reaction ratio falls below 60% is 60 ?m or more from the surface of the precured resin layer.

US Pat. No. 10,689,544

FIBER COATINGS WITH LOW PULLOUT FORCE

Corning Incorporated, Co...

1. A coating for optical fibers comprising:a polyol compound, said polyol compound having unsaturation less than 0.1 meq/g;
a mercapto-functional silane compound;
a Young's modulus less than 1.0 MPa; and
a pullout force less than 1.7 lbf/cm when configured with thickness 32.5 ?m to surround and directly contact a glass fiber having a diameter of 125 ?m in an as-drawn state, said pullout force increasing by less than a factor of 2.0 upon aging said coating on said glass fiber for at least 60 days.

US Pat. No. 10,689,543

AQUEOUS POLYHYDROXYURETHANE RESIN DISPERSION, METHOD FOR PRODUCING SAID AQUEOUS DISPERSION, GAS-BARRIER RESIN FILM PRODUCED USING SAID AQUEOUS DISPERSION, AQUEOUS POLYHYDROXYURETHANE RESIN DISPERSION COMPOSITION CONTAINING CLAY MINERAL, GAS-BARRIER COATIN

1. An aqueous polyhydroxyurethane resin dispersion being an aqueous dispersion comprising a polyhydroxyurethane resin having particle diameters in range from 0.001 ?m to 10 ?m dispersed in water, whereinthe polyhydroxyurethane resin comprises: a repeating unit represented by following formula (1) as a basic structure; and a carboxyl group-containing chemical structure moiety represented by following formula (6), in a structure of the polyhydroxyurethane resin:
wherein:—X— represents a direct bond, an aliphatic hydrocarbon group having 1 to 30 carbon atoms, an alicyclic hydrocarbon group having 4 to 40 carbon atoms, or an aromatic hydrocarbon group having 6 to 40 carbon atoms, wherein in structures of these groups, any one bond selected from the group consisting of an ether bond, an amino bond, a sulfonyl bond, and an ester bond, or as a substituent, any one group selected from the group consisting of a hydroxy group, a halogen atom, and a polyalkylene glycol chain having a number of repeating units in a range from 1 to 30 each comprising 2 to 6 carbon atoms is optionally contained;
—Y— represents an aliphatic hydrocarbon group having 1 to 15 carbon atoms, an alicyclic hydrocarbon group having 4 to 15 carbon atoms, or an aromatic hydrocarbon group having 6 to 15 carbon atoms, wherein in structures of these groups, an ether bond or a sulfonyl bond, or as a substituent, any one group selected from the group consisting of a hydroxy group and a halogen atom is optionally contained;
—Z1— and —Z2— each independently represent at least one structure selected from the group consisting of following formula (2), formula (3), formula (4), and formula (5), and two or more of the structures selected from the group consisting of the formulas (2), (3), (4), and (5) are optionally mixed within the repeating units of the formula (1) and between the repeating units; and
in any of cases where any one of the formulas (2), (3), (4), and (5) is independently selected for —Z1— and —Z2—, a bond on a right side bonds with an oxygen atom, and a bond on a left side bonds with X, and in a case where X represents a direct bond, the bond on the left side bonds with a bond on a left side of the other of the —Z1— and the —Z2—,
wherein R in the formula (4) and in the formula (5) independently represents a hydrogen atom or a methyl group,wherein:—W— represents an aliphatic hydrocarbon group having 1 to 30 carbon atoms, an alicyclic hydrocarbon group having 4 to 40 carbon atoms, or an aromatic hydrocarbon group having 6 to 40 carbon atoms, wherein in structures of these groups, any one bond selected from the group consisting of an ether bond, an amino bond, a sulfonyl bond, and an ester bond, or as a substituent, any one group selected from the group consisting of a hydroxy group, a halogen atom, and a polyalkylene glycol chain having a number of repeating units in a range from 1 to 30 each comprising 2 to 6 carbon atoms is optionally contained;
—Y— represents a part to be bonded with a urethane structure having a bond represented by formula (1) and is selected from the group consisting of the aliphatic hydrocarbon group, the alicyclic hydrocarbon group, and the aromatic hydrocarbon group, represented as —Y— in the formula (1); and
—V— represents a hydrocarbon group having 1 to 10 carbon atoms or an aromatic hydrocarbon group having 6 to 10 carbon atoms, wherein in structures of these groups, an oxygen atom or a nitrogen atom is optionally contained.

US Pat. No. 10,689,542

MULTIPHASE COATINGS WITH SEPARATED FUNCTIONAL PARTICLES, AND METHODS OF MAKING AND USING THE SAME

HRL Laboratories, LLC, M...

1. A multiphase polymer composition comprising a first polymer material and a second polymer material that are chemically distinct, wherein said first polymer material and said second polymer material are microphase-separated on a microphase-separation length scale from greater than 0.1 microns to about 500 microns, wherein said multiphase polymer composition comprises first solid functional particles selectively dispersed within said first polymer material, and wherein said first solid functional particles are chemically distinct from said first polymer material and said second polymer material.

US Pat. No. 10,689,540

OXIDATIVELY CURABLE COATING COMPOSITION

Catexel Limited, London ...

1. A formulation comprising an oxidatively curable alkyd-based curable resin and a chelant, which is of formulae (I) or (I-B):X((CY2)nR1)3  (I) or
(R1(CY2)n)2X(CY2)nR2-Q-R2(CY2)nX((CY2)nR1)2  (I-B)wherein:the or each X is N or CZ, wherein Z is selected from hydrogen, optionally C1-6alkyl-substituted C1-24alkyl, optionally C1-6alkyl-substituted C1-24alkyl-oxy-C1-24alkyl, optionally C1-6alkyl-substituted C1-24alkyl-oxy-C6-10aryl, optionally C1-6alkyl-substituted C1-24alkyl-O—C6-10arylC1-24alkyl, optionally C1-6alkyl-substituted hydroxyC1-24alkyl, optionally C1-6alkyl-substituted C6-10aryl and optionally C1-6alkyl-substituted C6-10arylC1-24alkyl;
n is 0 if X?CZ and 1 if X?N;
each Y is independently selected from H, CH3, C2H5 and C3H7;
each —R1 is independently selected from —CY2N(C1-24alkyl)2; —CY2NR3, in which R3 and the nitrogen atom N to which it is attached represent a heterocycloalkyl group optionally substituted with one or more C1-6alkyl groups, which is connected to the adjacent CY2 moiety through the nitrogen atom N; or represents an optionally C1-6alkyl-substituted heteroaryl group selected from pyridin-2-yl, pyrazin-2-yl, quinolin-2-yl, pyrazol-1-yl, pyrazol-3-yl, pyrrol-2-yl, imidazol-2-yl, imidazol-4-yl, benzimidazol-2-yl, pyrimidin-2-yl, 1,2,3-triazol-1-yl, 1,2,3-triazol-2-yl, 1,2,3-triazol-4-yl, 1,2,4-triazol-1-yl, 1,2,4-triazol-3-yl and thiazol-2-yl;
both —R2- moieties, if present, are independently selected from an optionally C1-6alkyl-substituted heteroarylene group selected from pyridin-2,6-diyl, pyrazin-2,6-diyl, quinolin-2,8-diyl, pyrazol-1,3-diyl, pyrrol-2,5-diyl, imidazol-1,4-diyl, imidazol-2,5-diyl, pyrimidin-2,6-diyl, 1,2,3-triazol-2,5-diyl, 1,2,4-triazol-1,3-diyl, 1,2,4-triazol-3,5-diyl and thiazol-2,4-diyl;
Q represents a bridge selected from the group consisting of a C1-6alkylene moiety, a C6-10arylene moiety or a moiety comprising one or two C1-3alkylene units and one C6-10arylene unit, which bridge is optionally substituted one or more times with independently selected C1-24alkyl groups and OH groups;
or is of formulae (II), (II-B) or (II-C):

wherein:
each —R5 independently is selected from —CH2N(C1-24alkyl)2, —CH2NR9 or an optionally C1-6alkyl-substituted heteroaryl group selected from pyridin-2-yl, pyrazin-2-yl, quinolin-2-yl, pyrazol-1-yl, pyrazol-3-yl, pyrrol-2-yl, imidazol-2-yl, imidazol-4-yl, benzimidazol-2-yl, pyrimidin-2-yl, 1,2,3-triazol-1-yl, 1,2,3-triazol-2-yl, 1,2,3-triazol-4-yl, 1,2,4-triazol-1-yl, 1,2,4-triazol-3-yl and thiazol-2-yl);
the or each —R6 independently represents —R10-R11;
the or each —R7 and the or each —R8 each independently represents hydrogen, or a group selected from C1-18alkyl, C6-10aryl, C5-10heteroaryl, C6-10arylC1-6alkyl and C5-10heteroarylC1-6alkyl, each of which groups may be optionally C1-6alkyl-substituted, with the proviso that no —R7 or —R8 may be one of the possibilities permitted for —R5;
the or each —R10- independently represents optionally C1-6alkyl-substituted C1-6alkylene;
the or each —R11 independently represents hydrogen, C1-6alkyl, optionally C1-6alkyl-substituted C6-10aryl, optionally C1-6alkyl-substituted C5-10heteroaryl, optionally C1-6alkyl-substituted C5-10heteroarylC1-6alkyl, CY2N(C1-24alkyl)2 group or CY2NR9;
each —NR9 independently represents a moiety in which R9 and the nitrogen atom N to which it is attached represent a heterocycloalkyl group optionally substituted with one or more C1-20alkyl groups, which is connected to the remainder of the chelant through the nitrogen atom N; and
Q2 represents a bridge selected from the group consisting of a C1-6alkylene moiety C6-10arylene moiety or a moiety comprising one or two C1-3alkylene units and one C6-10arylene unit, which bridge is optionally substituted one or more times with independently selected C1-24alkyl groups and OH groups,
the formulation comprising a complex comprising the chelant and a Mn transition metal ion, wherein the complex is not well-defined.

US Pat. No. 10,689,538

MULTICOMPONENT REACTIVE INKS AND PRINTING METHOD

SICPA HOLDING SA, Prilly...

1. A printing system for printing a security feature comprising at least three compositions,wherein one composition is a reactive ink comprising a silane compound comprising at least a first and a second polymerizable moiety which are different from each other and are polymerizable by different mechanisms, loaded in a first reservoir of a first printhead,
wherein another composition is a first catalyst composition comprising a substance able to react with the silane compound of the reactive ink and promote the polymerization of the first polymerizable moiety, loaded in a second reservoir of said first printhead or of a second printhead, and
wherein another composition is a second catalyst composition comprising a substance able to react, alone or in presence of the first catalyst composition, with the silane compound of the reactive ink and promote the polymerization of the second polymerizable moiety, loaded in a third reservoir of said first printhead, or of said second printhead, or of a third printhead.

US Pat. No. 10,689,537

DISPERSIONS OF HOLEY GRAPHENE MATERIALS AND APPLICATIONS THEREOF

THE REGENTS OF THE UNIVER...

1. A method of forming a graphene-based material, comprising:treating a mixture comprising an etchant and graphene oxide sheets to yield formation of holey graphene oxide sheets comprising basal plane nanopores, wherein the etchant is hydrogen peroxide that carries out an etching reaction on the graphene oxide sheets to generate the basal plane nanopores;
dispersing the holey graphene oxide sheets in a re-dispersal solvent to yield a holey graphene oxide dispersion including the holey graphene oxide sheets;
incorporating electrochemically active material nano structures, catalyst nano structures, or both, into the holey graphene oxide dispersion; and
treating the holey graphene oxide dispersion with a reducing agent to yield an interconnected network of holey graphene sheets having in-plane nanopores.

US Pat. No. 10,689,536

INK, IMAGE FORMING METHOD, IMAGE FORMING APPARATUS, AND IMAGE FORMED PRODUCT

Ricoh Company, Ltd., Tok...

1. An ink, comprising:a colorant;
an organic solvent;
a resin particle including an anionic urethane resin;
an organic amine compound having a boiling point in the range of from 120° C. to 200° C. and a molecular weight of 100 or less selected from the group consisting of piperazine, N,N-dimethylethanolamine, and 1-amino-2-methyl-propanol; and
water,
wherein a mass ratio of the resin particle to the colorant is in the range of from 0.05 to 0.8, and
wherein a mass ratio of the organic amine compound to the resin particle is in the range of from 0.01 to 1.00.

US Pat. No. 10,689,535

COLORING COMPOSITION, INK JET RECORDING INK, INK JET RECORDING METHOD, AND INK JET PRINTER CARTRIDGE

FUJIFILM Corporation, To...

1. A coloring composition comprising:a compound represented by the following Formula (1); and
at least one compound selected from the group consisting of a compound represented by the following Formula (D) and a compound represented by the following Formula (E),

in Formula (1), R1, R5, R6, and R10 each independently represent an alkyl group,
R4, R9, R11, R12, R13, R14, R15, R16, R17, R18, R19, and R20 each independently represent a hydrogen atom or a substituent,
R2, R3, R7, and R8 each independently represent a hydrogen atom, an alkyl group, or a substituent represented by the following Formula (A), and
at least one of R2, R3, R7, or R8 represents a substituent represented by the following Formula (A),

in Formula (A), X represents a substituent represented by the following Formula (X1), (X2), or (X3), and
* represents a direct bond to a benzene ring,

in Formula (X1), R401, R402, R403, R404, and R405 each independently represent a hydrogen atom or a substituent,
R401, R402, R403, R404, and R405 satisfy the following condition (i) or (ii),
* represents a direct bond to a sulfur atom,
the condition (i): at least one of R401, R402, R403, R404, or R405 represents a hydroxyl group and at least one of R401, R402, R403, R404, or R405 represents a carboxyl group, and
the condition (ii): at least two of R401, R402, R403, R404, or R405 represent a carboxyl group,

in Formula (X2), R501, R502, R503, R504, R505, R506, and R507 each independently represent a hydrogen atom or a substituent,
R501, R502, R503, R504, R505, R506, and R507 satisfy the following condition (iii) or (iv),
* represents a direct bond to a sulfur atom,
the condition (iii): at least one of R501, R502, R503, R504, R505, R506, or R507 represents a hydroxyl group and at least one of R501, R502, R503, R504, R505, R506, or R507 represents a carboxyl group, and
the condition (iv): at least two of R501, R502, R503, R504, R505, R506, or R507 represent a carboxyl group,

in Formula (X3), R601, R602, R603, R604, R605, R606, and R607 each independently represent a hydrogen atom or a substituent,
R601, R602, R603, R604, R605, R606, and R607 satisfy the following condition (v) or (vi),
* represents a direct bond to a sulfur atom,
the condition (v): at least one of R601, R602, R603, R604, R605, R606, or R607 represents a hydroxyl group and at least one of R601, R602, R603, R604, R605, R606, or R607 represents a carboxyl group, and
the condition (vi): at least two of R601, R602, R603, R604, R605, R606, or R607 represent a carboxyl group,

in Formula (D), R21 and R22 each independently represent a hydrogen atom or a substituted or unsubstituted alkyl group,
Y21 and Y22 each independently represent a chlorine atom, a hydroxyl group, a substituted or unsubstituted amino group, an alkoxy group, a substituted or unsubstituted phenoxy group, or a substituted or unsubstituted naphthyloxy group,
Xd represents a divalent linking group,
M4 represents a hydrogen atom or a counter cation, and
M4?s may be the same as or different from each other,

in Formula (E), R31 represents a hydrogen atom or a substituted or unsubstituted alkyl group,
Y31 represents a chlorine atom, a hydroxyl group, a substituted or unsubstituted amino group, or a morpholino group,
M5 represents a hydrogen atom or a counter cation,
M5?s may be the same as or different from each other, and
X31 represents a group represented by the following Formula (E-1), and

in Formula (E-1), R32, R33, R34, R35, and R36 each independently represent a hydrogen atom, an alkyl group having 1 to 8 carbon atoms, or —COOM? (M? represents a hydrogen atom or a counter cation),
at least one of R32, R33, R34, R35, or R36 represents an alkyl group having 1 to 8 carbon atoms or —COOM?, and
* represents a direct bond to a carbon atom.

US Pat. No. 10,689,533

ENERGY CURABLE LITHOGRAPHIC INKS CONTAINING LACTIC ACID RESINS

Sun Chemical Corporation,...

1. A composition comprising a compound of a lactic acid polyester resin according to Formula 1 and an acrylic acid ester,wherein:R is selected from the group consisting of a di, -tri-, tetra-, penta- and hexavalent polyol;
n is an integer from 1-50; and
m is an integer from 1-6; and
wherein the lactic acid polyester resin according to Formula I has an acid value of 5 to 50 mg KOH/g; and
wherein the lactic acid polyester resin according to Formula I comprises at least 1% of a di-, tri-, tetra, -penta, or hexafunctional polyol; and
wherein the mass ratio of the acrylic acid ester to the lactic acid polyester resin according to Formula I is 1:1 to 2:1; and
wherein the weight average molecular weight of the lactic acid polyester resin is 1,505 to 3,400 Daltons.

US Pat. No. 10,689,532

RADIATION CURABLE HYBRID INKS

Sun Chemical Corporation,...

1. A lithographic radiation curable hybrid ink or coating composition comprising:a) 10 wt % to 30 wt % one or more inert hard resins selected from the group consisting of rosin resins, rosin resin derivatives, hydrocarbon resins, modified hydrocarbon resins, and combinations thereof; and
b) 5 wt % to 45 wt % one or more multifunctional acrylate monomers;
wherein at least one of the inert hard resins has a cloud point greater than 100° C. in a concentration of 10% by weight in a test oil with a boiling point of 260° C. to 290° C.; and
wherein the ink or coating composition is curable by actinic radiation.

US Pat. No. 10,689,530

PRESSURE-SENSITIVE ADHESIVE FILM

RIKEN TECHNOS CORPORATION...

1. A pressure-sensitive adhesive film, the pressure-sensitive adhesive film comprising:(?) a poly(meth)acrylimide resin film layer and (?) a pressure-sensitive adhesive layer arranged in order from the surface layer side of an article when the pressure-sensitive adhesive film is applied to the article; and
(?) a hard coat layer directly on the surface layer side of the (?) poly(meth)acrylimide resin film layer,
wherein the pressure-sensitive adhesive film has a total light transmittance of 80% or higher,
wherein the hard coat layer has a thickness of 15 ?m or more, and
wherein the (?) poly(meth)acrylimide resin film is a transparent mulitilayer film comprising:
a first poly(meth)acrylimide resin layer (?1);
an aromatic polycarbonate resin layer (?); and
a second poly(meth)acrylimide resin layer (?2), directly laminated in this order.

US Pat. No. 10,689,527

METHODS AND COATINGS FOR PROTECTING SURFACES FROM BIO-FOULING SPECIES

REDJAK, L.L.C, Larchmont...

11. A method of protecting a surface from biofouling, comprising:painting a first biologically active inner polymer layer on a surface, the first biologically active inner polymer layer comprising at least one first biologically active agent that kills a juvenile stage of a biofouling animal organism on contact with the first biologically active polymer layer;
placing a perforated, rigid sheet of fiberglass on a surface of the first biologically active inner polymer layer to provide structural support and stiffness; and
painting a second biologically active outer polymer layer on the first biologically active inner polymer layer and the perforated, rigid sheet of fiberglass, the second biologically active outer polymer layer comprising at least one second biologically active agent, that inhibits and repels a larval stage of the biofouling animal organism, preventing the biofouling animal organism from attaching to the second biologically active outer polymer layer, and a mixture of nano-sized particles that include metal salts of pyrithione, impregnated as a suspension in the second biologically active polymer layer, that inhibit and repel the second larval stage of the biofouling animal organism and that inhibit biofilm buildup, wherein the second biologically active outer polymer layer limits exposure of a surrounding environment to the first biologically active agent,
wherein painting the second biologically active outer polymer layer causes material of the second biologically active outer polymer layer to flow through perforations in the perforated, rigid sheet of fiberglass and up against the first biologically active inner polymer layer, such that an inner surface of the perforated, rigid sheet of fiberglass is immersed in the first biologically active inner polymer layer and an outer surface of the perforated, rigid sheet of fiberglass is immersed in the second biologically active outer polymer layer.

US Pat. No. 10,689,525

CORROSION PREVENTATIVE FILM

Caterpillar Inc., Peoria...

11. A method comprising:mixing a peelable water-based film forming coating with an oil-based volatile corrosion inhibitor to obtain a mixture of the peelable water-based film forming coating and the oil-based volatile corrosion inhibitor,
wherein the peelable water-based film forming coating comprises one or more of a colloidal acrylic dispersion, a polyurethane dispersion, a natural or synthetic latex, a styrene-acrylate, a butadiene-acrylate, a vinyl chloride-acrylate, a polyvinylidene chloride-acrylate, a vinyl acetate-acrylate, a polyvinyl-styrene butadiene copolymer, a polyvinyl butyral, a polyisocyanate, a polycondensate aliphatic polyurethane, an acrylic polyurethane, or a polyester-polyurethane,
wherein the peelable water-based film forming coating includes 0.05% to 8% by weight of amine salt, and
wherein the oil-based volatile corrosion inhibitor 15% to 40% by weight and a remainder is the peelable water-based film forming coating; and applying, onto a surface of a component, the mixture of the peelable water-based film forming coating and the oil-based volatile corrosion inhibitor,
wherein the application of the mixture of the peelable water-based film forming coating and the oil-based volatile corrosion inhibitor prevents corrosion better than the peelable water-based film forming coating alone.

US Pat. No. 10,689,524

CORROSION PREVENTATIVE FILM

Caterpillar Inc., Peoria...

1. A corrosion inhibiting system for a component of an apparatus, comprising:a peelable water-based film applied directly on to a surface of the component,
wherein the peelable water-based film includes 0.05% to 8% by weight of amine salt; and
an oil-based volatile corrosion inhibitor applied directly on top of the peelable water-based film,
wherein the peelable water-based film is cured before the oil-based volatile corrosion inhibitor is applied,
wherein the oil-based volatile corrosion inhibitor migrates through the peelable water-based film and comes into contact with the surface of the component, and
wherein a continuous layer of the oil-based volatile corrosion inhibitor is in direct contact with the surface of the component.

US Pat. No. 10,689,523

ANTIREFLECTION FILM AND DISPLAY DEVICE

LG CHEM, LTD., Seoul (KR...

1. An antireflection film comprising a hard coating layer and a low refractive index layer formed on the hard coating layer, the antireflection film having a concavo-convex shaped surface,wherein a roughness kurtosis (Rku) of the concavo-convex shape of the surface of the antireflection film is greater than 3.5 and less than 6, a Swedish height (H) of the concavo-convex shape of the surface of the antireflection film is greater than 20 nm and less than 200 nm, and a light transmittance in a wavelength region of 380 nm to 780 nm is 94% or more,
wherein the hard coating layer comprises a binder resin containing a (co)polymer of a photopolymerizable compound and an organic or inorganic fine particle having a diameter of 0.5 ?m to 10 ?m dispersed in the binder resin and inorganic nanoparticles having a diameter of 1 nm to 50 nm.

US Pat. No. 10,689,522

FLUORINE COMPOUNDS

Merck Patent GmbH, Darms...

1. A compound of the formula (I)(Rf-CHF—CF2—CHR)m-L-(X)n  (I)
where
a)
Rf is a group selected from CF3—(CF2)0-3—O—(CF2)1-3—, CF3—(CF2)0-3—O—(CF2)1-3—O—, CF3—(CF2)0-3—O—(CF2)1-3—O—CF2—, CF3—(CF2)0-3—O—(CF2—O)1-8 and CF3—(CF2)0-3—O—(CF2—O)1-8—CF2—
R=H or an alkyl group,
L=a single bond or a saturated, branched or unbranched alkylene group, optionally containing heteroatoms and/or functional groups,
X=an ethylenically unsaturated group, an alkoxysilane group, a silanol group or a halosilane group,
m is ?1
and n is ?1
or
b)
Rf is CF3—(CF2)0-3—,
R=an alkyl group,
L=a single bond or a saturated, branched or unbranched alkylene group, optionally containing heteroatoms and/or functional groups,
X=an alkoxysilane group, a silanol group or a halosilane group,
m is ?1
and n is ?1,
or
c)
Rf is where CF3—(CF2)0-3—O— the compounds conform to the formulae (III) to (VIII) where R?=C1-C4-alkyl and R??=H or an alkyl group,

where R?=C1-C4-alkyl and R??=H or an alkyl group.

US Pat. No. 10,689,519

HIGH SOLIDS PRECIPITATED CALCIUM CARBONATE WITH COPOLYMERIC ADDITIVE

OMYA INTERNATIONAL AG, O...

1. A process for producing an aqueous suspension of precipitated calcium carbonate comprising the steps of:i) providing a calcium oxide containing material;
ii) providing at least one copolymer of the following formula (I):

wherein x, y and z are present in blocks, alternating or randomly; x is >0 and at least one of y or z is >0 and the sum of x+y+z is <150 and wherein a molar ratio of x to y and/or z in the at least one copolymer of step ii) [x:y and/or z] is from 10:1 to 1:2;
R1 represents hydrogen or a sulfonic functional group;
R2 represents a heteroatom, optionally substituted with an alkyl group, an alkenyl group, an heteroaryl group and/or a polyalkoxylated group;
R3 and R4 are, independently from each other, a hydroxyl group, (O?M+) with M+ being a monovalent, divalent or trivalent cation, an O-alkyl group comprising from 1 to 20 carbon atoms, an N-alkyl group comprising from 1 to 20 carbon atoms and/or a polyalkoxylated group;
iii) preparing a milk of lime by mixing water, the calcium oxide containing material of step i), and the at least one copolymer of step ii) to obtain a milk of lime, wherein the calcium oxide containing material and the water are mixed in a weight ratio from 1:1 to 1:12; and
iv) carbonating the milk of lime obtained in step iii) to form an aqueous suspension of precipitated calcium carbonate with a clustered scalenohedral crystal structure.

US Pat. No. 10,689,518

COLORED EFFECT PIGMENTS

Merck Patent GmbH, Darms...

1. A colored effect pigment, comprising a flaky metal substrate and at least three layers covering the flaky metal substrate, wherein the at least three layers comprise a layer package composed of layers a, b and c in the following sequence:(a) a hydrated metal oxide primer layer comprising a hydrated metal oxide, wherein layer (a) consists of a sublayer (a1) and a sublayer (a2), wherein sublayer (a1) is closest to the flaky metal substrate and consists of one or more hydrated metal oxides, and wherein sublayer (a2) is between sublayer (a1) and layer (b) and is composed of a mixture of a hydrated metal oxide and an organic color pigment of organic color pigment layer (b),
(b) an organic color pigment layer on layer (a) consisting of one or more organic color pigments and optionally acid groups, and
(c) a hydrated metal oxide layer on layer (b) comprising a hydrated metal oxide.

US Pat. No. 10,689,517

COLOR MATERIAL DISPERSION LIQUID, COLOR RESIN COMPOSITION, COLOR MATERIAL, COLOR FILTER, METHOD FOR PRODUCING COLOR FILTER, LIQUID CRYSTAL DISPLAY DEVICE, AND LIGHT-EMITTING DISPLAY DEVICE

DAI NIPPON PRINTING CO., ...

1. A color material dispersion liquid comprising: (A) a color material, (B) a dispersant and (C) a solvent, wherein the color material (A) contains a lake color material of a combination of an acid dye and a polyaluminum chloride; a basicity of the polyaluminum chloride is 70% or more; and a value of a ratio (I4/I6) between an integral value (I4) of a peak corresponding to a four-coordinate aluminum in a solid-state 27Al-NMR spectrum of the lake color material and an integral value (I6) of a peak corresponding to a six-coordinate aluminum therein, is from 0 to 0.50.

US Pat. No. 10,689,516

POLYMER JACKET MATERIAL BLENDS WITH IMPROVED FLAME RESISTANCE

Otis Elevator Company, F...

1. A fire-resistant material, comprising:a base material, a siloxane polymer, and a phosphonate polymer, wherein the siloxane polymer comprises between about 1% and 20% by weight of the fire-resistant material and the phosphonate polymer comprises between about 1% and about 20% by weight of the fire-resistant material.

US Pat. No. 10,689,515

SILICONE COMPOSITION BASED ON BOTH CONDENSATION/CURING REACTION AND ORGANIC-PEROXIDE CURING REACTION

SHIN-ETSU CHEMICAL CO., L...

1. A silicone composition relying on both condensation curing reaction and organic peroxide curing reaction, comprising as essential components,(A) 100 parts by weight of an organopolysiloxane capped with hydroxyl at both ends and represented by the general formula (1):
wherein R1 is each independently an unsubstituted or halogen or cyano-substituted C1-C5 alkyl or C6-C8 aryl group, and n is such a number that the organopolysiloxane of formula (1) may have a viscosity at 25° C. of the value defined below, the organopolysiloxane having a viscosity at 25° C. of 0.1 to 1,000 Pa·s,(B) 1 to 40 parts by weight of at least one compound selected from a silane compound represented by the general formula (2):
R2a—SiX(4-a)  (2)wherein R2 is an unsubstituted or halogen or cyano-substituted C1-C3 alkyl, vinyl, or phenyl group, X is a hydrolyzable group, and a is 0 or 1, a (partial) hydrolysate and a (partial) hydrolytic condensate thereof,(C) 0.01 to 20 parts by weight of a condensation catalyst selected from alkyltin ester compounds, titanic acid esters, titanium chelate compounds, organozinc compounds, organoiron compounds, organocobalt compounds, organomanganese compounds, organoaluminum compounds, hexylamine, dodecylamine phosphate, quaternary ammonium salts, alkali metal salts of lower fatty acids, dialkylhydroxylamines, and guanidyl-containing silanes and siloxanes,
(D) 0.01 to 10 parts by weight of an organic peroxide selected from peroxy ketals, hydroperoxides, dialkyl peroxides, diacyl peroxides, peroxy esters, and peroxy dicarbonates,
(E) 100 to 8,000 parts by weight of a heat-conductive filler having a thermal conductivity of at least 10 W/m·K, and
(F) an organopolysiloxane represented by the general formula (3):

wherein R3 is each independently an unsubstituted or halogen or cyano-substituted monovalent hydrocarbon group, R4 is each independently an alkyl, alkoxyalkyl, alkenyl, or acyl group, m is an integer of 2 to 100, and b is an integer of 1 to 3, in an amount of 75 to 400 parts by weight per 100 parts by weight of component (A).

US Pat. No. 10,689,514

SILICON-CONTAINING RESIN COMPOSITION

TOKYO OHKA KOGYO CO., LTD...

1. A silicon-containing resin composition comprising a silicon-containing resin, a nitroxy compound, and a solvent,wherein the silicon-containing resin is one or more selected from the group consisting of a siloxane resin and a polysilane, and
the solvent contains a cycloalkyl acetate represented by the following formula (S1):
wherein Rs1 represents an alkyl group having 1 to 3 carbon atoms; p is an integer of 1 to 6; and q is an integer of 0 to (p+1) anda content of the cycloalkyl acetate represented by the above formula (S1) in the solvent is 30 to 100% by mass.

US Pat. No. 10,689,513

COMPOSITION FOR PREPARING ARTICLE INCLUDING POLYIMIDE OR POLY(IMIDE-AMIDE) COPOLYMER, ARTICLE INCLUDING POLYIMIDE OR POLY(IMIDE-AMIDE) COPOLYMER, AND ELECTRONIC DEVICE INCLUDING THE ARTICLE

SAMSUNG ELECTRONICS CO., ...

1. A composition for preparing an article comprising a polyimide or poly(imide-amide) copolymer, the composition comprising:(1) a solution comprising at least one of
(i) a polymer comprising at least one selected from a structural unit represented by Chemical Formula 1, or a structural unit represented by Chemical Formula 2; or
(ii) a copolymer comprising at least one selected from a structural unit represented by Chemical Formula 1, or a structural unit represented by Chemical Formula 2, and a structural unit represented by Chemical Formula 3, and
(2) a metallic salt soluble in the solution of the polymer or the copolymer, wherein the metallic salt is a salt of a metal selected from a Group 1 element, a Group 11 element, a Group 13 element, and a Group 14 element, and an amount of the metallic salt is from 0.1 weight percent to less than 2.5 weight percent, based on the total weight of the metallic salt and the at least one of the polymer or copolymer in the composition:

wherein, in Chemical Formulae 1 and 2,
D is a substituted or unsubstituted tetravalent C6 to C24 aliphatic cyclic group, a substituted or unsubstituted tetravalent C6 to C24 aromatic ring group, or a substituted or unsubstituted tetravalent C4 to C24 hetero aromatic ring group, wherein the aliphatic cyclic group, the aromatic ring group, and the hetero aromatic ring group are present as a single ring, as a condensed ring system comprising two or more fused rings, or as a system comprising two or more moieties selected from the single ring and the condensed ring system linked by a single bond, —O—, —S—, —C(?O)—, —CH(OH)—, —S(?O)2—, —Si(CH3)2—, —(CH2)p— (wherein, 1?p?10), —(CF2)q— (wherein, 1?q?10), —CR?R?— (wherein, R? and R? are independently hydrogen, a C1 to C10 aliphatic hydrocarbon group, a C6 to C20 aromatic hydrocarbon group, or a C6 to C20 alicyclic hydrocarbon group), —C(CF3)(C6H5)—, —C(CF3)2—, or —C(?O)NH—, and
E is a substituted or unsubstituted biphenylene group, wherein the substituted biphenylene group is substituted with an electron-withdrawing group, and

wherein, in Chemical Formula 3,
A is a substituted or unsubstituted divalent C6 to C24 aliphatic cyclic group, a substituted or unsubstituted divalent C6 to C24 aromatic ring group, or a substituted or unsubstituted divalent C4 to C24 hetero aromatic ring group, wherein the aliphatic cyclic group, the aromatic ring group, and the hetero aromatic ring group are present as a single ring, as a condensed ring system comprising two or more fused rings, or as a system comprising two or more moieties selected from the single ring and the condensed ring system linked by a single bond, a fluorenylene group, —O—, —S—, —C(?O)—, —CH(OH)—, —S(?O)2—, —Si(CH3)2—, —(CH2)p— (wherein, 1?p?10), —(CF2)q— (wherein, 1?q?10), —CR?R?— (wherein, R? and R? are independently hydrogen, a C1 to C10 aliphatic hydrocarbon group, a C6 to C20 aromatic hydrocarbon group, or a C6 to C20 alicyclic hydrocarbon group), —C(CF3)2—, —C(CF3)(C6H5)—, or —C(?O)NH—, and
B is a substituted or unsubstituted biphenylene group, wherein the substituted biphenylene group is substituted with an electron-withdrawing group.

US Pat. No. 10,689,512

RESIN COMPOSITION, AND PREPREG, METAL-CLAD LAMINATE, AND PRINTED CIRCUIT BOARD USING THE SAME

TAIWAN UNION TECHNOLOGY C...

1. A resin composition, comprising:(a) a resin system, which comprises a thermosetting resin constituent and a vinyl-containing elastomer and has a dissipation factor (Df) of not higher than 0.008 at 10 GHz after curing; and
(b) a phosphorous-containing flame retardant, which is a combination of a compound of formula (I) and a compound of formula (II):

wherein,
R1 is selected from the group consisting of a covalent bond, —CH2—,
wherein R11, R12, R13, and R14 are independently H, alkyl, or
R2 is

R21, R22, R23, and R24 are independently an aryl or an alkylaryl; and
n is 1 or 2, and
wherein the amount of the phosphorous-containing flame retardant (b) is 2 wt % to 22 wt % based on the dry weight of the resin composition.

US Pat. No. 10,689,511

COMPOSITIONS, COMPOSITES PREPARED THEREFROM, AND ELECTRONIC DEVICES INCLUDING THE SAME

SAMSUNG ELECTRONICS CO., ...

1. A composition comprising:a plurality of quantum dots;
a monomer combination comprising a first monomer having at least two thiol groups at terminal ends of the first monomer and a second monomer having at least two carbon-carbon double bonds at terminal ends of the second monomer; and
a non-polymeric additive,
wherein the non-polymeric additive comprises a dithiocarbamate salt of a polyvalent metal.

US Pat. No. 10,689,504

TWO PART CURABLE COMPOSITION

1. A two part curable composition comprising:Part A: one or more compounds selected from
andPart B: an oxidant,wherein at least one of Part A or Part B comprises a (meth)acrylate component.

US Pat. No. 10,689,503

EPOXY RESIN COMPOSITION

HUNTSMAN INTERNATIONAL LL...

1. A method for increasing pot-life of a curable composition comprising combining:a) a polyisocyanate composition comprising a polyisocyanate, a lithium halide and a urea compound having an average molecular weight of 500 to 15000 and comprising biuret groups; and
b) an epoxy resin composition comprising an epoxy resin, a monool and/or a polyol and a compound having a structure NH2—CO—R to form the curable composition
wherein R is selected from hydrogen, a C1-C20 hydrocarbyl group, NH2, NR1R2, C6H5 and

 where R1 and R2 are each independently OH or a C1-C10 hydrocarbyl optionally comprising 1-3 hydroxy and/or ether groups
wherein the curable composition has a number of hydroxy equivalents per epoxy equivalent of 0.02 to 100, a number of carboxamide equivalents per epoxy equivalent of 0.0005 to 1, a number of urea and biuret equivalents per isocyanate equivalent ranging from 0.0001 to 0.4 and a number of epoxy equivalents per isocyanate equivalent ranging from 0.003 to 1.

US Pat. No. 10,689,499

SOLVENT SEPARATION APPARATUS AND WASTE HEAT UTILIZATION METHOD

LG Chem, Ltd., (KR)

1. A solvent separation apparatus comprising a stripping unit for separating a polymer from a mixture comprising a polymer and a solvent; a water tank; a cooling unit, a condenser and a piping system,wherein said piping system comprises a first pipe line formed so that said mixture comprising the polymer and the solvent and water from said water tank can be mixed and then introduced into said stripping unit, and a second pipe line formed so that the mixed liquid of the water and the solvent discharged from said stripping unit can be transferred to said cooling unit, and
said piping system further comprises a heat exchange part formed so that before the water discharged from said water tank is mixed with said mixture, it can be heat-exchanged with the mixed liquid before being introduced into said cooling unit
wherein said condenser is installed at a position where before the mixed liquid discharged from said stripping unit is heat-exchanged, said mixed liquid can be condensed.

US Pat. No. 10,689,496

RESIN COMPOSITION, PREPREG, METAL FOIL-CLAD LAMINATE, RESIN SHEET AND PRINTED CIRCUIT BOARD

MITSUBISHI GAS CHEMICAL C...

1. A resin composition comprising:a cyanate compound (A) and/or a maleimide compound (B), and
an inorganic filler (C), wherein
the inorganic filler (C) consists of a boron nitride particle aggregate comprising primary hexagonal boron nitride particles, wherein (0001) planes of the primary hexagonal boron nitride particles are stacked on top of each other to thereby form the boron nitride particle aggregate.

US Pat. No. 10,689,495

LIGHT STABILIZED POLYOLEFIN FILMS, TAPES AND MONOFILAMENTS

BASF SE, Ludwigshafen (D...

1. A process for reducing water carry-over of a light stabilized polyolefin film, tape or monofilament, the process comprising:adding a light stabilizer (A) and a light stabilizer (B) to a polyolefin to obtain a mixture; and
extruding the mixture while passing the mixture through a water bath to obtain the light stabilized polyolefin film, tape or monofilament,
wherein water carry-over of the obtained light stabilized polyolefin film, tape or monofilament is lower than water carry-over of a light stabilized polyolefin film, tape or monofilament including the light stabilizer (A) and not including the light stabilizer (B),
wherein the light stabilizer (A) is at least one compound selected from the group consisting of a compound of formula (A-I), a compound of (A-II) and a compound of formula (A-III),

wherein A1 is hydrogen or C1-C4alkyl,
A2 is a direct bond or C1-C10alkylene, and
a1 is a number from 2 to 20;

wherein A3, A4 and A5 independently of one another are C2-C18alkylene,
A6, A7, A8, A9 and A10 independently of one another are hydrogen, C1-C12alkyl, C5-C12cycloalkyl or a group of formula (a-1),
wherein A11 independently of one another are hydrogen, C1-C12alkyl or C5-C12cycloalkyl, anda2 is a number from 1 to 20;

wherein A12 is C2-C18alkylene, C5-C7cycloalkylene or C1-C4alkylenedi(C5-C7cycloalkylene),
A13 and A14 independently of one another are hydrogen, C1-C12alkyl, C5-C12cycloalkyl or a group of formula (a-2),
wherein A15 independently of one another are hydrogen, C1-C12alkyl or C5-C12cycloalkylor A13 and A14, together with the nitrogen atom to which they are bonded, form a 5- to 10-membered heterocyclic ring,
and
a3 is a number from 2 to 20; and
the light stabilizer (B) is at least one compound selected from the group consisting of a compound of formula (B-I), a compound of formula (B-II), a compound of formula (B-III) and a compound of formula (B-IV),

wherein R1 is C1-C18alkyl, C1-C18hydroxyalkyl, cyclohexyl or hydroxycyclohexyl or R1 is a group —C(C6H5)(H)CH2—OH and R2 is C1-C25alkyl;

wherein R3 is C2-C18alkylene, C5-C7cycloalkylene or C1-C4alkylenedi(C5-C7cycloalkylene),
R4 independently of one another are C1-C12alkyl or C5-C12cycloalkyl,
R5 and R6 independently of one another are hydrogen, C1-C12alkyl, C5-C12cycloalkyl or a group of formula (b-2),

or R5 and R6, together with the nitrogen atom to which they are bonded, form a 5- to 10-membered heterocyclic ring and
b1 is a number from 1 to 20;

wherein R8, R9 and R10 independently of one another are C2-C18alkylene and R7 independently of one another are a group of formula (b-3)

wherein R11 and R12 independently of one another are hydrogen, C1-C12alkyl, C5-C12cycloalkyl or a group of formula (b-4)

and R13 independently of one another are C1-C12alkyl or C5-C12cycloalkyl;

wherein
R5 is C1-C25alkyl,
n is a number from 1 to 10, and
W is a wax residue comprising between 50 and 1000 carbon atoms.

US Pat. No. 10,689,491

SILICONE FORMULATIONS FOR 3D PRINTING

Lawrence Livermore Nation...

1. A silicone-based ink for extrusion of continuous filaments, the ink comprising:a vinyl-terminated diphenyl siloxane macromer;
a treated silica hydrophobic reinforcing filler;
a rheology modifying additive selected from the group consisting of: a silicone polyether, glycerol, 2-propanol, and a combination thereof;
a curing agent;
an effective amount of an inhibitor for controlling a rate of curing by the curing agent;
a crosslinking agent, wherein the crosslinking agent is a hydride terminated copolymer; and
a crosslinking additive, wherein the crosslinking additive is a hydride chain extender, wherein the crosslinking additive and the crosslinking agent have different molecular structures from each other, wherein the crosslinking additive is configured to decrease a crosslinking density of the silicone-based ink.

US Pat. No. 10,689,489

POLYIMIDE-BASED BLOCK COPOLYMER AND POLYIMIDE-BASED FILM COMPRISING THE SAME

LG CHEM LTD., Seoul (KR)...

1. A polyimide-based block copolymer includinga first repeating unit represented by Chemical Formula 1,
a second repeating unit represented by Chemical Formula 2, and
a third repeating unit represented by Chemical Formula 3:

in Chemical Formula 1,
each R11 is the same as or different from each other in each repeating unit, and each is independently a single bond, —O—, —S—, —C(?O)—, —CH(OH)—, —S(?O)2—, —Si(CH3)2—, —(CH2)p— (wherein 1?p?10), —(CF2)q— (wherein 1?q?10), —C(CF3)2—, —C(?O)NH—, or a C6 to C30 divalent aromatic organic group;
each R12 is independently —H, —F, —Cl, —Br, —I, —CF3, —CCl3, —CBr3, —CI3, —NO2, —CN, —COCH3, —CO2C2H5, a silyl group containing three C1 to C10 aliphatic organic groups, a C1 to C10 aliphatic organic group, or a C6 to C20 aromatic organic group;
n1 and m1 are independently an integer of 0 to 3;each Y10 is the same as or different from each other in each repeating unit, and each independently comprises a C6 to C30 divalent aromatic organic group, and the divalent aromatic organic group exists alone, or two or more aromatic organic groups are bonded to each other to form a divalent condensed ring, or two or more aromatic organic groups are linked by a single bond, a fluorenyl group, —O—, —S—, —C(?O)—, —CH(OH)—, —S(?O)2—, —(CH2)p— (wherein 1?p?10), —(CF2)q— (wherein 1?q?10), —C(CH3)2—, —C(CF3)2—, or —C(?O)NH— to form a divalent organic group;E11, E12, and E13 are independently a single bond or —NH—; and
each Z10 is the same as or different from each other in each repeating unit, and each is independently a trivalent linking group derived from at least one compound selected from the group consisting of triacyl halide, tricarboxylic acid, and tricarboxylate,
*?E21-Y20-E22-Z20-E23?*  [Chemical Formula 2]
*?E31-Y30-E32-Z30-E33?*  [Chemical Formula 3]
in Chemical Formulae 2 and 3,
Y20 and Y30 are the same as or different from each other in each repeating unit, and each independently includes a C6 to C30 divalent aromatic organic group, and the divalent aromatic organic group exists alone, or two or more aromatic organic groups are bonded to each other to form a divalent condensed ring, or two or more aromatic organic groups are linked by a single bond, a fluorenyl group, —O—, —S—, —C(?O)—, —CH(OH)—, —S(?O)2—, —Si(CH3)2—, —(CH2)p— (wherein 1?p?10), —(CF2)q— (wherein 1?q?10), —C(CH3)2—, —C(CF3)2—, or —C(?O)NH— to form a divalent organic group;
E21, E22, E23, E31, E32, and E33 are independently a single bond or —NH—;
Z20 and Z30 are the same as or different from each other in each repeating unit, and each is independently a divalent linking group of a —C(?O)-A-C(?O)— form derived from at least one compound selected from the group consisting of diacyl halide, dicarboxylic acid, and dicarboxylate;
in Z20 and Z30, A is a C6 to C20 divalent aromatic organic group, a C4 to C20 divalent heteroaromatic group, a C6 to C20 divalent alicyclic group, or a divalent organic group in which two or more of the organic groups are linked by a single bond, a fluorenyl group, —O—, —S—, —C(?O)—, —CH(OH)—, —S(?O)2—, —Si(CH3)2—, —(CH2)p— (wherein 1?p?10), —(CF2)q— (wherein 1?q?10), —C(CH3)2—, —C(CF3)2—, or —C(?O)NH—;
two carbonyl groups linked to both sides of A in the Z20 are bonded to the meta position with respect to A; and
two carbonyl groups linked to both sides of A in the Z30 are bonded to the para position with respect to A.

US Pat. No. 10,689,487

POLYCARBONATE COPOLYMER, OPTICAL LENS AND FILM IN WHICH SAID POLYCARBONATE COPOLYMER IS USED, AND METHOD FOR PRODUCING SAID COPOLYMER

MITSUBISHI GAS CHEMICAL C...

1. A polycarbonate copolymer, which comprises a structural unit represented by formula (K):
wherein in formula (K), R represents H, CH3 or CH2CH3; and
a structural unit represented by formula (1):

wherein in formula (1), Q represents a C5 or higher aliphatic hydrocarbon group optionally including a hetero atom, and
wherein general formula (1) is at least one selected from the group consisting of formulae (2), (4), (5), and (6):

US Pat. No. 10,689,485

POLYCARBONATE RESIN AND PRODUCTION METHOD THEREFOR

MITSUBISHI GAS CHEMICAL C...

1. A polycarbonate resin having a terminal structure represented by general formula (1) below and having a viscosity-average molecular weight of 10,000-18,000,wherein the amount of a low-molecular-weight carbonate compound having a molecular weight of 1,000 or less contained in the polycarbonate resin is less than 1 mass %:

where, R1 represents a halogen atom, a C5-14 alkyl group, a C1-23 alkyloxy group or a C2-23 alkyl ester group; and
r represents an integer of 1-5.

US Pat. No. 10,689,484

METHOD FOR ELECTROPOLYMERIZATION OF HYDROPHILIC EDOT MONOMERS IN AN AQUEOUS SOLUTION

THE UNIVERSITY OF AKRON, ...

1. A method of forming a polymer film or coating on a substrate from an aqueous solution of one or more hydrophilic 3 4-ethylenedioxythiophene (EDOT)-derived monomer(s) comprising:A. selecting a suitable substrate, said substrate having a conductive or semiconductive surface;
B. preparing a hydrophilic EDOT monomer comprising a terminal EDOT group and a betaine group;
C. dissolving said hydrophilic EDOT monomer in water or an aqueous solution;
D. placing said substrate in the solution of step C so that the solution of step C is in contact with the surface of said substrate;
E. applying an electric current to the solution of step C, thereby causing said hydrophilic EDOT monomer to polymerize on the surface of said substrate.

US Pat. No. 10,689,482

EPOXY COMPOUND HAVING ALKOXYSILYL GROUP, COMPOSITION AND HARDENED MATERIAL COMPRISING SAME, USE FOR SAME, AND PRODUCTION METHOD FOR EPOXY COMPOUND HAVING ALKOXYSILYL GROUP

KOREA INSTITUTE OF INDUST...

1. An epoxy composition comprising an epoxy compound having an alkoxysilyl group of the following Formula 1:
in Formula 1, a core unit C is independently selected from structures of the following Formulae 2-1 to 2-5, and each core unit C of a plurality of the core units C present in the above Formula 1 may be the same or different,

in Formula 2-1, X is —CH2—, —C(CH3)2—, —C(CF3)2—, —S— or —SO2—,
in Formula 2-3, Y is independently selected from the group consisting of H and an alkyl group of C1 to C5,
n is an integer from 1 to 2, in the case that n is 1, R has a structure of the following Formula 3a or 3b, and in the case that n is 2, at least one R of a plurality of R has a structure of the following Formula 3a or 3b, and the remainder thereof are hydrogen atoms,
—(CH2)m—SiRaRbRc  [Formula 3a]
—CONH(CH2)m—SiRaRbRc  [Formula 3b]
in Formulae 3a and 3b, at least one of Ra to Rc is an alkoxy group having 1 to 5 carbon atoms, and the remainder thereof are alkyl groups having 1 to 10 carbon atoms, the alkoxy group and the alkyl group may be a linear chain or a branched chain alkoxy group or alkyl group, and m is an integer from 3 to 10,
at least one kind of filler selected from the group consisting of an inorganic particle and a fiber;
a curing agent for the epoxy compound, the curing agent being selected from a group consisting of a phenol-based curing agent in an amount of from 0.5 to 1.5 of a stoichiometric equivalent ratio of reactive functional groups of the phenol-based curing agent to epoxy groups of the epoxy compound, and an acid anhydride-based curing agent in an amount of from 0.7 to 1.5 of a stoichiometric equivalent ratio of reactive functional groups of the anhydride-based curing agent to epoxy groups of the epoxy compound; and
a catalyst selected from a group consisting of an imidazole-based catalyst in an amount of 0.1 to 7.0 parts per hundred (phr) based on the epoxy compound and a phosphorous-based catalyst in an amount of 0.1 to 2.0 phr based on the epoxy compound,
wherein an epoxy group in the epoxy compound having an alkoxysilyl group reacts with the curing agent of the epoxy compound, and alkoxysilyl groups in the epoxy compound react with the filler and other alkoxysilyl groups in the epoxy compound when the composition is cured.

US Pat. No. 10,689,481

POLYISOCYANATE COMPOSITION, POLYURETHANE RESIN, TWO-COMPONENT CURABLE POLYURETHANE COMPOSITION, AND COATING MATERIAL

MITSUI CHEMICALS, INC., ...

1. A polyisocyanate composition containing:a modified product of xylylene diisocyanate and a modified product of pentamethylene diisocyanate, and/or
a modified product of the xylylene diisocyanate and the pentamethylene diisocyanate, and
the ratio of the pentamethylene diisocyanate with respect to the total amount of the xylylene diisocyanate and the pentamethylene diisocyanate is 60 mol % or more and 95 mol % or less, wherein
the modified product is a multiple molecular product containing two or more molecules of the xylylene diisocyanate and/or the pentamethylene diisocyanate, and
the content ratio of the multiple molecular product containing four or more molecules of the xylylene diisocyanate and/or the pentamethylene diisocyanate with respect to the total amount of the polyisocyanate composition is 30 mass % or more and 65 mass % or less.

US Pat. No. 10,689,480

LIQUID-CRYSTAL COMPOUND, THERMALLY RESPONSIVE MATERIAL, AND PRODUCTION METHOD THEREFOR

TOYO TIRE CORPORATION, I...

1. A liquid-crystal compound obtained by adding an alkylene oxide and/or styrene oxide to a mesogenic group-containing compound represented by a general formula (1) below:
wherein X is an active hydrogen group; R1 is a single bond, —N?N—, —CO—, —CO—O—, or —CH?N—; R2 is a single bond or —O—; and R3 is an alkylene group having 1 to 20 carbon atoms.

US Pat. No. 10,689,478

AMIDATE COMPOUND, CATALYST FOR POLYURETHANE PRODUCTION, AND METHOD FOR PRODUCING POLYURETHANE RESIN

KOEI CHEMICAL COMPANY, LI...

1. An amidate compound represented by formula (1):
wherein A is a substituted or unsubstituted hydrocarbon group, n is an integer of 1 or more, and D is a nitrogen-containing organic group represented by formula (2-1):

wherein R1 is a hydrocarbon group that may contain a heteroatom; R6 and R7 are the same or different, and are each a hydrogen atom or a C1-C6 hydrocarbon group that may contain a heteroatom; X is a nitrogen atom; and a is 1;
provided that 1,3-dimethylimidazolium-2-N-(p-chlorophenyl)amidate and 1,3-dimethylimidazolium-2-N-(3?,5?-dichlorophenyl)amidate are excluded.

US Pat. No. 10,689,477

POLYISOCYANATE COMPOSITION, POLYURETHANE RESIN, TWO-COMPONENT CURABLE POLYURETHANE COMPOSITION, AND COATING MATERIAL

MITSUI CHEMICALS, INC., ...

1. A polyisocyanate composition containing:a modified product of xylylene diisocyanate and a modified product of pentamethylene diisocyanate, and/or
a modified product of the xylylene diisocyanate and the pentamethylene diisocyanate,
the ratio of the pentamethylene diisocyanate with respect to the total amount of the xylylene diisocyanate and the pentamethylene diisocyanate is 5 mol % or more and 40 mol % or less,
the modified product of the xylylene diisocyanate contains a trimer,
in the modified product of the xylylene diisocyanate, the trimer conversion rate of the xylylene diisocyanate is 5 mass % or more and 45 mass % or less,
the modified product of the xylylene diisocyanate is modified with at least alcohols, and
an alcohol rate with respect to the total amount of the modified product of the xylylene diisocyanate is 0.1 mass % or more and 10 mass % or less.

US Pat. No. 10,689,476

OXAZOLIDINONE- AND ISOCYANURATE-CROSSLINKED MATRIX FOR FIBER-REINFORCED MATERIAL

1. A method for producing a cured polymer composition comprising at least one oxazolidinone ring and at least one isocyanurate ring, the method comprising the following steps:(1) providing a liquid reaction mixture, comprising:
(a) at least one liquid, aromatic epoxy resin;
(b) at least one liquid, aromatic polyisocyanate; and
(c) a catalyst composition, comprising an ionic compound of formula (I)

wherein
R1 and R3 are each selected independently of one another from the group consisting of substituted or unsubstituted, linear or branched alkyl having 1 to 20 carbon atoms, substituted or unsubstituted, linear or branched alkenyl having 3 to 20 carbon atoms, and substituted or unsubstituted aryl having 5 to 20 carbon atoms;
R4 and R5 are each selected independently of one another from the group consisting of hydrogen, substituted or unsubstituted, linear or branched alkyl having 1 to 20 carbon atoms, substituted or unsubstituted, linear or branched alkenyl having 3 to 20 carbon atoms, substituted or unsubstituted, linear or branched alkoxy having 1 to 20 carbon atoms, and substituted or unsubstituted aryl having 5 to 10 carbon atoms; or
R1 and R5 and/or R3 and R4 or R4 and R5, together with the carbon or nitrogen atoms to which they are bound, can form a 5- or 6-membered substituted or unsubstituted cycloalkyl, cycloheteroalkyl, aryl or heteroaryl ring, wherein the cycloheteroalkyl or heteroaryl ring comprises 1 to 3 heteroatoms selected from O, N and S;
R2 is hydrogen;
X is an anion not including Fl—, Cl—, Br— or I—; and
n is 1, 2 or 3;
wherein the at least one epoxy resin, relative to the at least one polyisocyanate, is used in amounts so that the molar equivalent ratio of epoxide groups to isocyanate groups is in the range of 0.4 to 1; and
(2) curing the reaction mixture so as to obtain a cured polymer composition comprising at least one oxazolidinone ring and at least one isocyanurate ring.

US Pat. No. 10,689,475

METHOD FOR SYNTHESIZING POLYARYLETHERKETONES

Arkema France, Colombes ...

1. A polyaryl ether ketone with a residual solvent content of less than 100 ppm and a residual aromatic ether content of less than 1%, wherein the residual solvent has a water solubility of less than 0.05% at 25° C., wherein the polyaryl ether ketone is free from any residual alcohol.

US Pat. No. 10,689,469

METHOD OF REACTIVE EXTRUSION COPOLYMERIZATION OF VINYL MONOMERS

EAST CHINA UNIVERSITY OF ...

1. A method of reactive extrusion copolymerization of vinyl monomers consisting of:(1) feeding a vinyl monomer and/or at least one sort of vinyl comonomer and an initiator into a first screw segment of a twin-screw extruder, and feeding a modified resin into subsequent screw segments;
(2) feeding the vinyl monomer and/or vinyl comonomer into a screw segment after an auto-acceleration zone, and feeding the initiator corresponding to a temperature of a barrel and micro- or nano-scale inorganic modified fillers after the half-life period of the initiator;
(3) feeding antioxidants and anti-UV agents at the end of polymerization, and removing unpolymerized monomers and by-products by devolatilization of a screw segment; and
(4) obtaining a vinyl copolymer resin with an anticipated molecular weight of 5×102 to 6×105 from reactive extrusion copolymerization by controlling the temperature of different screw segments.

US Pat. No. 10,689,468

COPOLYMER AND PIGMENTED COATING AGENT CONTAINING THE COPOLYMER

BASF Coatings GmbH, Muen...

1. A solventborne, pigmented coating composition comprising: based on its total weight ?0.02 to 0.5% by weight of at least one copolymer (A) having a glass transition temperature Tg of at least ?30° C. obtained by copolymerization of a mixture of olefinically unsaturated monomers (a) in at least one organic solvent and in the presence of at least one initiator, where the mixture of monomers (a) to be polymerized comprises:(a1) 10 to 60 mol % of at least one monomer of the formula (I)
whereinR1=C1 to C4 alkoxy,
R2=C1 to C4 alkyl, and m=0 to 2,and(a2) 40 to 90 mol % of at least one olefinically unsaturated monomer selected from the group consisting of monomers of the formulae H2C?CH—(C?O)—O—Rx, H2C?C(CH3)—(C?O)—O—Rx, and H2C?CH—O—(C?O)—Rx, where Rx is an alkyl radical having 1 to 20 carbon atoms,and wherethe sum total of the molar fractions of the monomers (a1) and (a2), based on the total molar amount of monomers (a) used, is at least 90 mol %, and where the copolymerization is carried out at a temperature from 60 to 200° C. and at a pressure of at least 2 bar.

US Pat. No. 10,689,466

MANUFACTURING POLYMERS OF THIOPHENE, BENZOTHIOPHENE, AND THEIR ALKYLATED DERIVATIVES

Saudi Arabian Oil Company...

1. A process for manufacturing a polymer of sulfur-containing heterocyclic compounds, the process comprising the steps of:isolating a sulfur-containing heterocyclic compound from cracked naphtha comprising the steps of:
isolating the cracked naphtha from a reaction product gas stream of a fluid catalytic cracking unit in a distillation column;
feeding the cracked naphtha to a secondary distillation column, wherein the sulfur-containing heterocyclic compound is isolated from the cracked naphtha according to a boiling point of the sulfur-containing heterocyclic compound, and
polymerizing the sulfur-containing heterocyclic compound with a super acid to produce the polymer of the sulfur-containing heterocyclic compound.

US Pat. No. 10,689,464

SELF-SUPPORTING, BIODEGRADABLE FILM BASED ON HYDROPHOBIZED HYALURONIC ACID, METHOD OF PREPARATION AND USE THEREOF

Contipro a.s., Dolni Dob...

1. A film based on a hyaluronic acid ester, characterized by that it comprises a C10-C22-acylated derivative of hyaluronic acid according to the general formula (I)
where R is H+ or Na+, and where R1 is H or C(?O)CxHy, where x is an integer within the range from 9 to 21 and y is an integer within the range from 11 to 43 and CxHy is a linear or branched, saturated or unsaturated chain C9-C21, wherein in at least one repeating unit one or more of R1 is —C(?O)CxHy and where n is within the range from 12 to 4000; and
wherein the film is self-supporting, the thickness of the film is homogeneous and is within a range of 2 ?m to 100 ?m, and the Young's modulus of the film is within a range from 1 to 5000 MPa in the dry state, and the surface roughness expressed in the form of a root mean square of at least one of the film surfaces is within the range from 0.5 to 100 nm.

US Pat. No. 10,689,463

FUC3S4S SUBSTITUTED OLIGOGLYCOSAMINOGLYCAN AND PREPARATION METHOD THEREOF

JIUZHITANG CO., LTD., Ch...

1. A Fuc3S4S substituted oligoglycosaminoglycan mixture or a pharmaceutically acceptable salt thereof, the Fuc3S4S is 3,4-disulfated-L-fucose-1-yl, the Fuc3S4S substituted oligoglycosaminoglycan mixture is a mixture of oligomeric homologous glycosaminoglycan compounds having a structure represented by Formula (I),
in Formula (I):
Ring A is ?-D-glucuronic acid group or ?-D-glucosyl group, wherein, R1 is —COO? or —COR10, R10 is independently substituted or unsubstituted linear or branched C1-C6 alkyl, C7-C12 aralkyl;
Ring B is substituted ?-D-2-amino-2-deoxy-galactosyl, wherein, R2 is —COCH3 or —H; R3 and R4 are independently —H or —SO3?;
Ring C is ?-L-fucosyl, wherein, R5, R6 and R7 are independently —H or —SO3?, and based on molar ratio, the ?-L-fucosyl wherein R5 is —H, R6 and R7 are —SO3?, i.e. 3,4-disulfated-L-fucose-1-yl, accounts for not less than 75% of the total ?-L-fucosyl;
R8 is the structure represented by Formula (III):

in Formula (III):
Ring A? is 4-deoxy-4-threo-hex-4-enopyranosyluronic acid group, R1 in the formula is defined as above;
Ring C is ?-L-fucosyl, wherein, R5, R6 and R7 are defined as above;
R9 is a structure represented by Formula (IV) or Formula (V):

in Formula (IV) and (V),
Ring B is substituted a or ?-D-2-amino-2-deoxy-galactosyl, B? is substituted 2-amino-2-deoxy-galactitol, glycosamine or N-substituted glucosamine, wherein, R3 and R4 are defined as above; R11 is hydroxy, amino, C1-C6 alkylamino, C7-C12 arylamino;
n is an integer of 2-20; and based on molar ratio, the compound that n is 4-9 accounts for not less than 75% of the total compounds;
the oligomeric homologues glycosaminoglycan mixture has a weight average molecular weight (Mw) of 4.5-9 kD, and a polydispersity index (PDI) of less than or equal to 1.6,
wherein the Fuc3S4S substituted oligoglycosaminoglycan mixture or a pharmaceutically acceptable salt thereof is produced by deacylated deaminated depolymerization or ?-eliminative depolymerization.

US Pat. No. 10,689,462

THERAPEUTIC AND IMAGING COMPOSITIONS AND USES THEREOF

Purdue Research Foundatio...

1. A polyrotaxane comprising the general formula:
or a salt thereof,
wherein:
n is an integer from 1 to 30;
C and C? are the same or different and represent endcapping groups of the formula:

wherein:
L1 is a (C1-C6)hydrocarbylene group,
G1 and G2, together, form a radical having the formula:

wherein each L2 is independently a bond or acyl; each G3 is a substituted or unsubstituted (C6-C50)hydrocarbyl group, interrupted by 0 to 5 groups chosen from —O—, —NH—, and —S—; and
each s is independently an integer from 1 to 5; and
t is an integer from 2 to 5:
B is a poly(ethylene glycol)-poly(propylene glycol)-poly(ethylene glycol) (PEG-PPG-PEG) triblock copolymer; and
A is a beta cyclodextrin;
wherein G3 is not a substituted or unsubstituted (C6-C12)aryl group.

US Pat. No. 10,689,461

ANTIBODY DUAL DISPLAY DUAL COMPOSITIONS AND METHODS OF USE THEREOF

NovImmune SA, Geneva (CH...

1. A display system for simultaneously displaying two ligand binding polypeptides at the surface of a filamentous bacteriophage, comprising:a. a phagemid comprising the coding sequence of a first ligand binding polypeptide fused in frame to a first dimerization domain and to minor coat protein 3 of filamentous bacteriophage;
b. a plasmid comprising the coding sequence of a second ligand binding polypeptide fused in frame to a second dimerization domain;
wherein the first dimerization domain and the second dimerization domain are leucine zippers that heterodimerize with high affinity, and
c. a helper phage comprising coding sequences of all proteins necessary for packaging the phage;
wherein the first and second ligand binding polypeptides are different scFvs and each bind to a different target ligand, and
wherein, when the first and second ligand binding polypeptide fusions and all phage proteins are expressed in a suitable host cell, the two ligand binding polypeptide fusions associate via their respective dimerization domains, resulting in simultaneous display of the two ligand binding polypeptides at the surface of phage.

US Pat. No. 10,689,459

TREATMENT OF BREAST CANCER BRAIN METASTASES

Novartis AG, Basel (CH) ...

1. A method of treating a brain metastases from breast cancer which comprises administering to a subject in need thereof a quantity of a jointly therapeutically effective pharmaceutical combination comprising:(a) a compound of formula (I),

wherein W is CRw or N,
wherein Rw is selected from the group consisting of:
(1) hydrogen,
(2) cyano,
(3) halogen,
(4) methyl,
(5) trifluoromethyl, and
(6) sulfonamide;
R1 is selected from the group consisting of:
(1) hydrogen,
(2) cyano,
(3) nitro,
(4) halogen,
(5) substituted and unsubstituted alkyl,
(6) substituted and unsubstituted alkenyl,
(7) substituted and unsubstituted alkynyl,
(8) substituted and unsubstituted aryl,
(9) substituted and unsubstituted heteroaryl,
(10) substituted and unsubstituted heterocyclyl,
(11) substituted and unsubstituted cycloalkyl,
(12) —COR1a,
(13) —CO2R1a,
(14) —CONR1aR1b,
(15) —NR1aR1b,
(16) —NR1aCOR1b,
(17) —NR1aSO2R1b,
(18) —OCOR1a,
(19) —OR1a,
(20) —SR1a,
(21) —SOR1a, and
(23) —SO2NR1aR1b;
wherein R1a, and R1b are independently selected from the group consisting of:
(a) hydrogen,
(b) substituted or unsubstituted alkyl,
(c) substituted and unsubstituted aryl,
(d) substituted and unsubstituted heteroaryl,
(e) substituted and unsubstituted heterocyclyl, and
(f) substituted and unsubstituted cycloalkyl;
R2 is selected from the group consisting of:
(1) hydrogen,
(2) cyano,
(3) nitro,
(4) halogen,
(5) hydroxy,
(6) amino,
(7) substituted and unsubstituted alkyl,
(8) —COR2a, and
(9) —NR2aCOR2b,
wherein R2a, and R2b are independently selected from the group consisting of:
(a) hydrogen, and
(b) substituted or unsubstituted alkyl;
R3 is selected from the group consisting of:
(1) hydrogen,
(2) cyano,
(3) nitro,
(4) halogen,
(5) substituted and unsubstituted alkyl,
(6) substituted and unsubstituted alkenyl,
(7) substituted and unsubstituted alkynyl,
(8) substituted and unsubstituted aryl,
(9) substituted and unsubstituted heteroaryl,
(10) substituted and unsubstituted heterocyclyl,
(11) substituted and unsubstituted cycloalkyl,
(12) —COR3a,
(13) —NR3aCOR3b,
(14) —NR3aR3b
(15) —NR3aSO2R3b,
(16) —OR3a,
(17) —SR3a,
(18) —SOR3a,
(19) —SO2R3a, wherein
R3a, and R3b are independently selected from the group consisting of:
(a) hydrogen,
(b) substituted or unsubstituted alkyl,
(c) substituted and unsubstituted aryl,
(d) substituted and unsubstituted heteroaryl,
(e) substituted and unsubstituted heterocyclyl, and
(f) substituted and unsubstituted cycloalkyl; and
R4 is selected from the group consisting of
(1) hydrogen, and
(2) halogen,
or a pharmaceutically acceptable salt thereof, and
(b) a Her3 antibody or fragment thereof that recognizes a conformational epitope of a HER3 receptor comprising amino acid residues 265-277, and 315 within domain 2 and amino acid residues 571, 582-584, 596-597, 600-602, and 609-615 within domain 4 of the HER3 receptor of SEQ ID NO: 1, wherein the Her3 antibody or fragment thereof comprises a heavy chain variable region comprising CDR1 of SEQ ID NO: 128; CDR2 of SEQ ID NO: 129; and CDR3 of SEQ ID NO: 130; and a light chain variable region comprising CDR1 of SEQ ID NO: 131; CDR2 of SEQ ID NO: 132; and CDR3 of SEQ ID NO: 133, and wherein the antibody or fragment thereof blocks both ligand-dependent and ligand-independent signal transduction, for simultaneous, separate or sequential administration for use in the treatment of a brain metastases from breast cancer.

US Pat. No. 10,689,430

INSULIN RECEPTOR PARTIAL AGONISTS

1. An insulin dimer selected from the group consisting of:wherein the disulfide linkages between the Cys6 and Cys11 residues of the A-chain polypeptide and the disulfide linkages between the Cys7 and Cys20 of the A-chain to the Cys7 and Cys19 of the B-chain polypeptide, respectively, are represented by the solid line therebetween; wherein the linking moieties are covalently linked to the epsilon amino acid of the shown lysine residue wherein the A-chain polypeptide for Dimers 1-32, 35-62, 64-66, 69-79 and 82-86 has the amino acid sequence shown in SEQ ID NO: 1; and the B-chain polypeptide for Dimers 1-32, 35-62, 64-66, 69-79 and 82-86 has the amino acid sequence shown in SEQ ID NO: 2.

US Pat. No. 10,689,420

AAV'S AND USES THEREOF

University of Massachuset...

1. A recombinant adeno-associated virus (rAAV) comprising a nucleic acid encoding a heterologous transgene and an AAV capsid, wherein the AAV capsid comprises a protein comprising an amino acid sequence selected from SEQ ID NOs.: 96, 98, 100, and 111.

US Pat. No. 10,689,419

PROCESS FOR THE PREPARATION OF CYCLIC DEPSIPEPTIDES

ONKURE, INC., Boulder, C...

1. A thioester compound of Formula (XXV)
or a pharmaceutically acceptable salt thereof,
wherein:
R1 and R2 are independently selected from the group consisting of H, C1-C10 alkyl and C3-C7 cycloalkyl, or R1 and R2 taken together with the carbon atom to which R1 and R2 are attached form a C3-C7 cycloalkyl or C3-C7 heterocycloalkyl wherein the C1-C10 alkyl, C3-C7 cycloalkyl and C3-C7 heterocycloalkyl are optionally substituted with one or more substituents selected from the group consisting of C1-C10 alkyl, C3-C7 cycloalkyl, C3-C7 heterocycloalkyl, aryl, heteroaryl, halo, hydroxyl, —CN, —COOH, —CF3, —OCH2F, —OCHF2, —OC1-C10 alkyl, —O-aryl, —O-heteroaryl, —NR8R9, —NR8C(O)R9, NR8C(O)OR9, —NR8CO2R9, and —C(O)NR8R9;
R3 and R4 are independently selected from the group consisting of H, C1-C10 alkyl and C3-C7 cycloalkyl, or R3 and R4 taken together with the carbon atom to which R3 and R4 are attached form a C3-C7 cycloalkyl or C3-C7 heterocycloalkyl wherein the C1-C10 alkyl, C3-C7 cycloalkyl and C3-C7 heterocycloalkyl are optionally substituted with one or more substituents selected from the group consisting of C1-C10 alkyl, C3-C7 cycloalkyl, C3-C7 heterocycloalkyl, aryl, heteroaryl, halo, hydroxyl, —CN, —COOH, —CF3, —OCH2F, —OCHF2, —OC1-C10 alkyl, —O-aryl, —O-heteroaryl, —NR8R9, —NR8C(O)R9, NR8C(O)OR9, —NR8CO2R9, and —C(O)NR8R9;
R5 and R6 are independently selected from the group consisting of H, C1-C10 alkyl and C3-C7 cycloalkyl, or R5 and R6 taken together with the carbon atom to which R5 and R6 are attached form a C3-C7 cycloalkyl or C3-C7 heterocycloalkyl wherein the C1-C10alkyl, C3-C7 cycloalkyl and C3-C7 heterocycloalkyl are optionally substituted with one or more substituents selected from the group consisting of C1-C10 alkyl, C3-C7 cycloalkyl, C3-C7 heterocycloalkyl, aryl, heteroaryl, halo, hydroxyl, —CN, —COOH, —CF3, —OCH2F, —OCHF2, —OC1-C10 alkyl, —O-aryl, —O-heteroaryl, —NR8R9, —NR8C(O)R9, NR8C(O)OR9, —NR8CO2R9 and —C(O)NR8R9;
R8 and R9 are independently selected from the group consisting of H, C1-C10 alkyl and C3-C7 cycloalkyl, wherein the C1-C10 alkyl, C3-C7 cycloalkyl and C3-C7 heterocycloalkyl are optionally substituted with one or more substituents selected from the group consisting C1-C10 alkyl, C3-C7 cycloalkyl, C3-C7 heterocycloalkyl, aryl, heteroaryl, halo, hydroxyl, —CN, —COOH, —CF3, —OCH2F, —OCHF2, —OC1-C10 alkyl, —O-aryl, —O-heteroaryl, —NR10R11, —NR10C(O)OR11 and —C(O)NR10R11;
R10 and R11 are independently selected from the group consisting of H, C1-C10 alkyl and C3-C7 cycloalkyl; and
R13 and R14 are independently selected from the group consisting of H, C1-C10 alkyl, C3-C7 cycloalkyl, C3-C7 heterocycloalkyl, aryl and heteroaryl.

US Pat. No. 10,689,416

PEPTIDE-BASED PROTEASOME INHIBITORS FOR TREATING CONDITIONS MEDIATED BY SENESCENT CELLS AND FOR TREATING CANCER

Unity Biotechnology, Inc....

1. A compound according to Formula (V):
wherein:
R0 is selected from H, alkyl, substituted alkyl, alkanoyl, substituted alkanoyl, alkylaminocarbonyl, substituted alkylaminocarbonyl, alkoxycarbonyl, substituted alkoxycarbonyl, alkylaminothiocarbonyl, substituted alkylaminothiocarbonyl, alkoxythiocarbonyl, substituted alkoxythiocarbonyl and promoiety;
X is O or S;
R1 to R4 are independently selected from alkyl, substituted alkyl, aralkyl, substituted aralkyl, heteroarylalkyl and substituted heteroarylalkyl;
Y is selected from O and NR15; and
R5 and R15 are independently selected from H, C(1-6)alkyl and substituted C(1-6)alkyl.

US Pat. No. 10,689,415

CONJUGATES OF RGD PEPTIDES AND (BACTERIO)CHLOROPHYLL PHOTOSENSITIZERS

YEDA RESEARCH AND DEVELOP...

1. A method for tumor diagnosis or visualization of organs, comprising:(a) administering to a subject suspected of having a tumor a conjugate of at least one RGD-containing peptide or RGD-peptidomimetic and a water soluble chlorophyll or bacteriochlorophyll photosensitizer; and
(b) subjecting the patient to diagnosis or visualization of organs,
wherein the conjugate of at least one RGD-containing peptide or RGD-peptidomimetic and a water soluble chlorophyll or bacteriochlorophyll photosensitizer has the formula II:

wherein
M represents 2H or an atom selected from the group consisting of Mg, Pd, Pt, Co, Ni, Sn, Sm, Cu, Zn, Mn, In, Eu, Fe, Au, Al, Gd, Dy, Er, Yb, Lu, Ga, Y, Rh, Ru, Si, Ge, Cr, Mo, P, Re, Tc, Tl and isotopes thereof;
R1 is —NH—P, wherein P is a residue of an RGD-containing peptide or an RGD-peptidomimetic;
R?2 is O—R8;
R6 is —NR9R?9 or —N+R9R?9R?9A?, wherein R1 and R6 may together form a ring;
R4 is —CH?CR9R?9, —CH?CR9Hal, —CH?CH—CH2—NR9R?9, —CH?CH—CH2—N+R9R?9R?9A?, —CHO, —CH?NR9, —CH?N+R9R?9A?, —CH2—OR9, —CH2—SR9, —CH2-Hal, —CH2—R9, —CH2—NR9R?9, —CH2—N+R9R?9R?9A?, —CH2—CH2R9, —CH2—CH2Hal, —CH2—CH2OR9, —CH2—CH2SR9, —CH2—CH2—NR9R?9, —CH2—CH2—N+R9R?9R?9A, —COCH3, —C(CH3)?CR9R?9, —C(CH3)?CR9Hal, —C(CH3)?NR9, —CH(CH3)?N+R9R?9A?, —CH(CH3)-Hal, —CH(CH3)—OR9, —CH(CH3)—SR9, —CH(CH3)—NR9R?9, —CH(CH3)—N+R9R?9R?9A?, or —C?CR9;
R?4 is methyl or formyl;
R8, R9, R?9 and R?9 each independently is:
(a) H;
(b) C1-C25 hydrocarbyl;
(c) C1-C25 hydrocarbyl substituted by one or more functional groups selected from the group consisting of halogen, nitro, oxo, —OR, —SR, epoxy, epithio, —NRR?, —CONRR?, —CONR—NRR?, —NHCONRR?, —NHCONRNRR?, —COR, —COOR, —OSO3R, —SO3R, —SO2R, —NHSO2R, —SO2NRR?, ?N—OR, —(CH2)n—CO—NRR?, —O—(CH2)n—OR, —O—(CH2)n—O—(CH2)n—R, —OPO3RR?, —PO2HR, and —PO3RR?, wherein R and R? each independently is H, hydrocarbyl or heterocyclyl, R may further be a cation, R? may further be a residue of an RGD peptide or RGD peptidomimetic, or R and R? together with the N atom to which they are attached form a 5-7 membered saturated ring optionally containing a further heteroatom selected from O, S and N, wherein the further N atom may be substituted, and n is 1 to 6;
(d) C1-C25 hydrocarbyl substituted by one or more functional groups selected from the group consisting of positively charged groups, negatively charged groups, basic groups that are converted to positively charged groups under physiological conditions, and acidic groups that are converted to negatively charged groups under physiological conditions;
(e) C1-C25 hydrocarbyl containing one or more heteroatoms and/or one or more carbocyclic or heterocyclic moieties;
(f) C1-C25 hydrocarbyl containing one or more heteroatoms and/or one or more carbocyclic or heterocyclic moieties and substituted by one or more functional groups as defined in (c) and (d) above;
(g) C1-C25 hydrocarbyl substituted by a residue of an amino acid, a peptide, a protein, a monosaccharide, an oligosaccharide, a polysaccharide, or a polydentate ligand and its chelating complexes with metals; or
(h) a residue of an amino acid, a peptide, a protein, a monosaccharide, an oligosaccharide, a polysaccharide, or a polydentate ligand and its chelating complexes with metals;
A? is a physiologically acceptable anion;
m is 0 or 1;
the dotted line at positions 7-8 represents an optional double bond; and
pharmaceutically acceptable salts and optical isomers thereof;
wherein said RGD containing peptide or RGD peptidomimetic is:
(A) a cyclic RGD-containing peptide selected from the group consisting of:
(i) the pentapeptide cycloRGDfK (SEQ ID NO:1), wherein f indicates D-Phe;
(ii) the nonapeptide herein designated RGD-4C (SEQ ID NO:2);
(iii) the tetrapeptide cycloRGDK (SEQ ID NO:4);
(iv) the pentapeptide cycloRGDf-N(Me)K (SEQ ID NO:7), wherein f indicates D-Phe; and
(v) the pentapeptide cycloRGDyK (SEQ ID NO:8), wherein y indicates D-Tyr; or
(B) a linear RGD-containing peptide selected from the group consisting of:
(i) the hexapeptide GRGDSP (SEQ ID NO:3);
(ii) the heptapeptide GRGDSPK (SEQ ID NO:5), and
(iii) the peptide of sequence (GRGDSP)4K (SEQ ID NO:6); or
(C) an RGD-peptidomimetic selected from the group consisting of H2N—C(?NH)NH—(CH2)5—CO—NH—CH(CH2)—(CH2)2—COOH; and H2N—C(?NH)NH—(CH2)3—CO-piperidine-CONH—CH[(CH2)4]—CH2—COOH; or
(D) an RGD-containing peptide or RGD-peptidomimetic selected from the group consisting of —NH-RGD-CO—NH—(CH2)2—NH—; and —NH-RGD-CO—NH—(CH2)3piperazino-(CH2)3—NH— comprised within a ring formed by R1 and R6.

US Pat. No. 10,689,414

THERAPEUTICALLY ACTIVE COMPOUNDS AND THEIR METHODS OF USE

Agios Pharmaceuticals, In...

1. A method for treating Maffucci syndrome comprising administering to a patient in need thereof a compound of formula:or a pharmaceutically acceptable salt, tautomer, isotopologue or hydrate thereof.

US Pat. No. 10,689,413

COMPOSITION ENRICHED IN SINGLE ISOMER OF NUC-1031 AND PREPARATION METHOD AND USE THEREOF

BrightGene Bio-Medical Te...

1. A method for preparing the compound of formula Sp-1, wherein said method comprises:reacting a compound 61501b with a compound 61501c to prepare a compound 61501a:

and,
deprotecting the hydroxyl protecting group of the compound 61501a to obtain the compound Sp-1:

US Pat. No. 10,689,412

DNA SEQUENCING BY SYNTHESIS USING RAMAN AND INFRARED SPECTROSCOPY DETECTION

THE TRUSTEES OF COLUMBIA ...

1. A nucleoside triphosphate analogue having the structure:
wherein B is a base and is adenine, guanine, cytosine, uracil or thymine,
wherein R? is OH or H, and
wherein R?:
(i) comprises an azidomethyl moiety with chemical side groups, wherein said chemical side groups generate a unique or multiple Raman band shifts;
(ii) has a Raman spectroscopy peak with wavenumber from 2000 cm?1 to 2300 cm?1 or a Fourier transform-infrared spectroscopy peak with wavenumber from 2000 cm?1 to 2300 cm?1; and
(iii) is cleaved by treatment with a reducing agent, which destroys the N3 group of the azidomethyl moiety with chemical side groups, thereby resulting in a 3?-OH.

US Pat. No. 10,689,411

EFFICIENT AND SCALABLE SYNTHESES OF NICOTINOYL RIBOSIDES AND REDUCED NICOTINOYL RIBOSIDES, MODIFIED DERIVATIVES THEREOF, PHOSPHORYLATED ANALOGS THEREOF, ADENYLYL DINUCLEOTIDE CONJUGATES THEREOF, AND NOVEL CRYSTALLINE FORMS THEREOF

ChromaDex Inc., Irvine, ...

1. A crystalline Form I of nicotinic acid riboside triacetate (NARTA) according to formula (X):

US Pat. No. 10,689,409

AMINO COMPOUNDS FOR TREATMENT OF COMPLEMENT MEDIATED DISORDERS

Achillion Pharmaceuticals...

1. A compound of Formula:
or a pharmaceutically acceptable salt thereof, wherein:
the

 ring is

q is 0, 1, 2, or 3;
r is 1, 2, or 3;
A is a group selected from:

R4 is chosen from —CHO, —CONH2, C2-C6alkanoyl, hydrogen, —SO2NH2, —C(CH2)2F, —CH(CF3)NH2, C1-C6alkyl, —C0-C4alkyl(C3-C7cycloalkyl), and —C(O)C0-C2alkyl(C3-C7cycloalkyl);
R5 and R6 are independently selected from CHO, —C(O)NH2, —C(O)NH(CH3), C2-C6alkanoyl, hydrogen, hydroxyl, halogen, cyano, nitro, —COOH, —SO2NH2, vinyl, C1-C6alkyl C2-C6alkenyl, C1-C6alkoxy, —C0-C4alkyl(C3-C7cycloalkyl), —C(O)C0-C4alkyl(C3-C7cycloalkyl), —P(O)(OR9)2, —OC(O)R9, —C(O)OR9, —C(O)N(CH2CH2R9)(R10), —NR9C(O)R10, phenyl, or 5- to 6-membered heteroaryl;
R7 is hydrogen, C1-C6alkyl, or —C0-C4alkyl(C3-C7cycloalkyl);
R8 and R8? are hydrogen;
R9 and R10 are independently chosen at each occurrence from hydrogen, C1-C6alkyl, (C3-C7cycloalkyl)C0-C4alkyl, —C0-C4alkyl(C3-C7cycloalkyl), and —O—C0-C4alkyl(C3-C7cycloalkyl);
X11 is N or CR11;
X12 is N or CR12;
X13 is N or CR13;
X14 is N or CR14, and wherein no more than two of X11, X12, X13, and X14 are N;
R11 and R14 are independently chosen at each occurrence from hydrogen, halogen, hydroxyl, nitro, cyano, —O(PO)(OR9)2, —(PO)(OR9)2, C1-C6alkyl, C2-C6alkenyl, C2-C6alkynyl, C2-C6alkanoyl, C1-C6alkoxy, C1-C6thioalkyl, —C0-C4alkyl(mono- and di-C1-C6alkylamino), —C0-C4alkyl(C3-C7cycloalkyl), —C0-C4alkoxy(C3-C7cycloalkyl), C1-C2haloalkyl, and C1-C2haloalkoxy;
one of R12 and R13 is chosen from R31 and the other of R12 and R13 is chosen from R32;
R31 is chosen from hydrogen, halogen, hydroxyl, nitro, cyano, amino, —COOH, C1-C2haloalkyl, C1-C2haloalkoxy, C1-C6alkyl, —C0-C4alkyl(C3-C7cycloalkyl), C2-C6alkenyl, C2-C6alkanoyl, C1-C6alkoxy, C2-C6alkenyloxy, —C(O)OR9, C1-C6thioalkyl, —C0-C4alkylNR9R10, —C(O)NR9R10, —SO2R9, —S02NR9R10, —OC(O)R9, and —C(NR9)NR9R10;
R32 is NR9SO2R38 or NR37R38;
R37 is selected from aryl, heteroaryl, heterocycle, alkynyl, hydroxyl, C1-C6alkoxy, (C3-C7cycloalkyl)C0-C4alkyl, (aryl)C0-C4alkyl, (heterocycle)C0-C4alkyl, (heteroaryl)C0-C4alkyl, —C1-C4alkylOC(O)OC1-C6alkyl, —C1-C4alkylOC(O)C1-C6alkyl, —C1-C4alkylC(O)OC1-C6alkyl, —S(O)(O)(alkyl), —S(O)(alkyl), —S(O)(O)(aryl), —S(O)(aryl), —S(O)(O)(heteroaryl), and —S(O)(heteroaryl), each of which R37 groups can be optionally substituted with one or more substituents independently chosen from halogen, hydroxyl, amino, cyano, —CHO, —COOH, —CONH2, C1-C6alkyl, C2-C6alkenyl, C2-C6alkynyl, —C1-C6alkoxy, C2-C6alkanoyl, C1-C6alkylester, (mono- and di-C1-C6alkylamino)C0-C2alkyl, C1-C2haloalkyl, hydoxyC1-C6alkyl, ester, carbamate, urea, sulfonamide, —C1-C6alkyl(heterocyclo), C1-C6alkyl(heteroaryl), —C1-C6alkyl(C3-C7cycloalkyl), O—C1-C6alkyl(C3-C7cycloalkyl), B(OH)2, phosphate, phosphonate and C1-C2haloalkoxy;
R38 is chosen at each occurrence from hydrogen, hydroxyl, cyano, amino, C1-C6alkyl, C1-C6haloalkyl, C1-C6alkoxy, (C3-C7cycloalkyl)C0-C4alkyl, (phenyl)C0-C4alkyl, —C1-C4alkylOC(O)OC1-C6alkyl, —C1-C4alkylOC(O)C1-C6alkyl, —C1-C4alkylC(O)OC1-C6alkyl, (4- to 7-membered heterocycloalkyl)C0-C4alkyl having 1, 2, or 3 heteroatoms independently chosen from N, O, and S, and (5- or 6-membered unsaturated or aromatic heterocycle)C0-C4alkyl having 1, 2, or 3 heteroatoms independently chosen from N, O, and S, each of which R38 groups can be optionally substituted with one or more substituents independently chosen from halogen, hydroxyl, amino, cyano, —CHO, —COOH, —CONH2, C1-C6alkyl, C2-C6alkenyl, C2-C6alkynyl, —C1-C6alkoxy, C2-C6alkanoyl, C1-C6alkylester, (mono- and di-C1-C6alkylamino)C0-C2alkyl, C1-C2haloalkyl, hydoxyC1-C6alkyl, ester, carbamate, urea, sulfonamide,—C1-C6alkyl(heterocyclo), C1-C6alkyl(heteroaryl), —C1-C6alkyl(C3-C7cycloalkyl), O—C1-C6alkyl(C3-C7cycloalkyl), B(OH)2, phosphate, phosphonate and C1-C2haloalkoxy;
R21 and R22 are independently chosen at each occurrence from hydrogen, hydroxyl, cyano, amino, C1-C6alkyl, C1-C6haloalkyl, C1-C6alkoxy, (C3-C7cycloalkyl)C0-C4alkyl, (phenyl)C0-C4alkyl, —C1-C4alkylOC(O)OC1-C6alkyl, —C1-C4alkylOC(O)C1-C6alkyl, —C1-C4alkylC(O)OC1-C6alkyl, (4- to 7-membered heterocycloalkyl)C0-C4alkyl having 1, 2, or 3 heteroatoms independently chosen from N, O, and S, and (5- or 6-membered unsaturated or aromatic heterocycle)C0-C4alkyl having 1, 2, or 3 heteroatoms independently chosen from N, O, and S;
R23 is independently chosen at each occurrence from C1-C6alkyl, C1-C6haloalkyl, (aryl)C0-C4alkyl, (C3-C7cycloalkyl)C0-C4alkyl, (phenyl)C0-C4alkyl, (4- to 7-membered heterocycloalkyl)C0-C4alkyl having 1, 2, or 3 heteroatoms independently chosen from N, O, and S, and (5- or 6-membered unsaturated or aromatic heterocycle)C0-C4alkyl having 1, 2, or 3 heteroatoms independently chosen from N, O, and S;
L is

R17 is hydrogen;
R18 and R18? are independently chosen from hydrogen, halogen, hydroxymethyl, and methyl;
m is 0, 1, 2, or 3;
B is a monocyclic or bicyclic carbocyclic; a monocyclic or bicyclic carbocyclic-oxy group; a monocyclic, bicyclic, or tricyclic heterocyclic group having 1, 2, 3, or 4 heteroatoms independently selected from N, O, and S and from 4 to 7 ring atoms per ring; C2-C6alkenyl; C2-C6alkynyl; —(C0-C4alkyl)(aryl); —(C0-C4alkyl)(heteroaryl); or —(C0-C4alkyl)(biphenyl) each of which B is unsubstituted or substituted with one or more substituents independently chosen from R33 and R34, and 0 or 1 substituents chosen from R35 and R36;
R33 is independently chosen from halogen, hydroxyl, —COOH, cyano, C1-C6alkyl, C2-C6alkanoyl, C1-C6alkoxy, —C0-C4alkylNR9R10, —SO2R9, C1-C2haloalkyl, and C1-C2haloalkoxy;
R34 is independently chosen from nitro, C2-C6alkenyl, C2-C6alkynyl, C1-C6thioalkyl, -JC3-C7cycloalkyl, —B(OH)2, -JC(O)NR9R23, -JOSO2OR21, —C(O)(CH2)1-4S(O)R21, —O(CH2)1-4 S(O)NR21R22, -JOP(O)(OR21)(OR22), -JP(O)(OR21)(OR22), -JOP(O)(OR21)R22, -JP(O)(OR21)R22, -JOP(O)R21R22, -JP(o)R21R22, -JSP(O)(OR21)(OR22), -JSP(O)(OR21)(R22), -JSP(O)(R21)(R22), -JNR9P(O)(NHR21)(NHR22), -JNR9P(O)(OR21)(NHR22), -JNR9P(O)(OR21)(OR22), -JC(S)R21, -JNR21SO2R22, -JNR9S(O)NR10R22, -JNR9SO2NR10R22, -JSO2NR9COR22, -JSO2NR9CONR21R22, -JNR21SO2R22, -JC(O)NR21SO2R22, -JC(NH2)NR22, -JC(NH2)NR9S(O)2R22, -JOC(O)NR21R22, -JNR21C(O)OR22, -JNR21OC(O)R22, —(CH2)1-4C(O)NR21R22, -JNR9C(O)R21, -JC(O)R21, -JNR9C(O)NR10R22, —CCR21, —(CH2)1-4OC(O)R21, and -JC(O)OR23; each of which R34 may be unsubstituted or substituted with one or more substituents independently chosen from halogen, hydroxyl, nitro, cyano, amino, oxo, —B(OH)2, —Si(CH3)3, —COOH, —CONH2, —P(O)(OH)2, C1-C6alkyl, —C0-C4alkyl(C3-C7cycloalkyl), C1-C6alkoxy, —C0-C2alkyl(mono- and di-C1-C4alkylamino), C1-C6alkylester, C1-C4alkylamino, C1-C4hydroxylalkyl, C1-C2haloalkyl, and C1-C2haloalkoxy;
R35 is independently chosen from naphthyl, naphthyloxy, indanyl, (4- to 7-membered heterocycloalkyl)C0-C4alkyl containing 1 or 2 heteroatoms chosen from N, O, and S, and bicyclic heterocycle containing 1, 2, or 3 heteroatoms independently chosen from N, O, and S, and containing 4- to 7-ring atoms in each ring; each of which R35 is unsubstituted or substituted with one or more substituents independently chosen from halogen, hydroxyl, nitro, cyano, C1-C6alkyl, C2-C6alkenyl, C2-C6alkanoyl, C1-C6alkoxy, (mono- and di-C1-C6alkylamino)C0-C4alkyl, C1-C6alkylester, —C0-C4alkyl(C3-C7cycloalkyl), —SO2R9, C1-C2haloalkyl, and C1-C2haloalkoxy; and
R36 is independently chosen from tetrazolyl, (phenyl)C0-C2alkyl, (phenyl)C1-C2alkoxy, phenoxy, and 5- or 6-membered heteroaryl containing 1, 2, or 3 heteroatoms independently chosen from N, O, B, and S, each of which R36 is unsubstituted or substituted with one or more substituents independently chosen from halogen, hydroxyl, nitro, cyano, C1-C6alkyl, C2-C6alkenyl, C2-C6alkanoyl, C1-C6alkoxy, (mono- and di-C1-C6alkylamino)C0-C4alkyl, C1-C6alkylester, —C0-C4alkyl(C3-C7cycloalkyl), —SO2R9, —OSi(CH3)2C(CH3)3, —Si(CH3)2C(CH3)3, C1-C2haloalkyl, and C1-C2haloalkoxy; and
J is independently selected at each occurrence from a covalent bond, C1-C4alkylene, —OC1-C4alkylene, C2-C4alkenylene, and C2-C4alkynylene.

US Pat. No. 10,689,408

BISPHOSPHONIC ACID COMPOUND

FUJIYAKUHIN CO., LTD., S...

1. A bisphosphonic acid compound of formula (1) or a pharmaceutically acceptable salt thereof:
wherein - - - - - - represents a single bond or a double bond;
A represents a C3-8 saturated cyclic hydrocarbon, wherein the saturated cyclic hydrocarbon is optionally substituted by 1 to 6 groups selected from the group consisting of a C1-6 alkyl group, a C2-6 alkenyl group, a C2-6 alkynyl group, a C1-6 alkoxy group, a C6-10 aryloxy group, a C1-6 haloalkoxy group, a C1-6 haloalkyl group and a halogen atom; and
R1 and R2 each independently represent a C1-6 alkyl group, a C2-6 alkenyl group, a C2-6 alkynyl group, a C1-6 alkoxy group, a C6-10 aryloxy group, a C1-6 haloalkoxy group, a C1-6 haloalkyl group, a halogen atom or a hydrogen atom, wherein when - - - - - - is a double bond, R2 is absent.

US Pat. No. 10,689,407

PHOTO-CLEAVABLE PRIMER COMPOSITIONS AND METHODS OF USE

ENVISTA, Brea, CA (US)

1. A surface binding compound of the Formula I:
wherein:
each a is independently 1, 2, 3, 4 or 5;
m is 1, 2 or 3; n is 1, 2 or 3; i is 1, 2 or 3;
each EG is an end group independently selected from the group consisting of CH2?CH—, CH2?C(C1-3alkyl)-, CH2?CHC(O)—, CH2?C(C1-3alkyl)C(O)—, CH2?CHC(O)O—, CH2?C(C1-3alkyl)C(O)O—, CH2?C(phenyl)C(O)O—, and CH2?C(C1-3alkyl)S(O)nO—, wherein each R, R1, R2 and R3 is independently H and C1-3alkyl, X? is Cl?, Br? and I? and Y+ is H+ or N+R1R2R3;
each of SP1, SP2 and SP3 is a spacer independently selected from the group consisting of —O—, —C(O)—, —S—, —S(O)—, —S(O)2—, —N—, —NH—, —NCH3—, —C—, —CH—, —(CH2)q—, —(CH(OH))q—, —(CH2CH(OH)CH2)q—, —(C(CH3)2)q—, —(CH(CH3))q—, —NH(CH2)2NH—, —OC(O)—, —CO2—, —NHCH2CH2C(O)—, —OCH2CH2C(O)—, —C(O)CH2CH2C(O)—, —C(O)NHCH2CH2NH—, —NHCH2C(O)—, —NHC(O)—, —C(O)N—, —NC(O)—, —C(O)NH—, —NCH3C(O)—, —C(O)NCH3—, —(CH2CH2O)pCH2CH2—, —CH2CH2—(CH2CH2O)p—, —OCH(CH2O—)2—, —(CH2)q—N+R1R2—, —(CH2)q—PO4?—, —N+R1R2—, —PO4?—, —(CH2)q—N+R1R2—X?—, —(CH2)q—PO4?Y+—, —N+R1R2—X?—, —PO4?Y+—, —SO4?Y+—, —O—PO?(O)O—(CH2)2-4—N+(R1R2)—, -(AA)r-, aryl, cyclopentanyl, cyclohexanyl, unsubstituted phenylenyl and phenylenyl substituted by 1 or 2 substituents selected from the group consisting of halo, CF3—, CF3O—, CH3O—, —C(O)OH, —C(O)OC1-3alkyl, —C(O)CH3, —CN, —NH2, —OH, —NHCH3, —N(CH3)2 and C1-3alkyl, wherein each AA is independently an amino acid, p is 1-6, q is 1-6 and r is 1-6;
provided that:
a) at least one of SP1, SP2 and SP3 is a spacer selected from the group consisting of A, A1, A2, B, C, D, E, F, and G:

wherein:
Z is selected from the group consisting of C, S, S(O), P(OH) and P(OR);
each E is independently selected from the group consisting of halo, CF3—, CF3O—, and HO— and e is 0, 1, 2 or 3; and
provided that
b) when one of SP1, SP2 and SP3 is not a spacer selected from the group consisting of A, B, C, D, E, F, and G, then each of the group
is independently selected from the group consisting of:
wherein:
each Z is independently selected from the group consisting of C, S, S(O), P(OH) and P(OR)
Ar is an aryl or heteroaryl group;
each BG is a bonding group independently selected from the group consisting of —OH, —SiR2OH, —COOH, —SO3H, and —P(O)3OH.

US Pat. No. 10,689,404

PREPARATION METHOD OF TETRABORONIC ACID COMPOUNDS, AND TETRABORONIC ACID COMPOUNDS

TAMKANG UNIVERSITY, New ...

1. A preparation method for a tetraboronic acid compound, comprising:mixing an aldehyde with an amine and dissolving in a solvent to obtain a first solution, wherein the amine has a protective group of R2, the protective group of R2 is phenylboronic acid pinacol ester, the aldehyde has a protective group of R3, and the protective group of R3 is 3-phenylboronic acid pinacol ester, 4-phenylboronic acid pinacol ester, or 2-fluoro-5-phenylboronic acid pinacol ester;
stirring the first solution;
adding a carboxylic acid and an isocyanide to the stirred first solution to obtain a second solution, wherein the carboxylic acid has a protective group of R1, the protective group of R1 is 4-phenylboronic acid pinacol ester or 2-fluoro-4-phenylboronic acid pinacol ester, and the isocyanide has a protective group of R4, and the protective group of R4 is 3-benzylboronic acid, 4-benzylboronic acid, or 2-fluoro-4-benzylboronic acid;
heating the second solution to obtain a first product;
extracting and purifying the first product to obtain a tetraboronate ester compound; and
conducting a deprotection reaction on the tetraboronate ester compound to obtain a second product, wherein the second product contains a tetraboronic acid compound, and the tetraboronic acid compound has a structure in Formula (I):

wherein R1 is 4-phenylboronic acid or 2-fluoro-4-phenylboronic acid, R2 is 4-phenylboronic acid, R3 is 3-phenylboronic acid, 4-phenylboronic acid, or 2-fluoro-5-phenylboronic acid, and R4 is 3-benzylboronic acid, 4-benzylboronic acid, or 2-fluoro-4-benzylboronic acid.

US Pat. No. 10,689,403

METHOD FOR PREPARING FOUR-COORDINATED ORGANIC BORON COMPOUND

Korea Research Institute ...

1. A method for preparing a four-coordinated organic boron compound comprising reacting a bidentate compound capable of coordination at a N or O position with an aryl, heteroaryl, or vinyl-functional boronic acid, boroxine, or borate compound in a solvent in the presence of a base,wherein the amount of the solvent used in the reaction is controlled to adjust the concentration of the bidentate compound to be 0.05 mol % or less,
wherein the bidentate compound is a compound represented by:

US Pat. No. 10,689,402

POLYCYCLIC AROMATIC COMPOUND AND LIGHT EMISSION LAYER-FORMING COMPOSITION

JNC Corporation, Tokyo (...

1. A light emitting layer-forming composition for applying and forming a light emitting layer of an organic electroluminescent element, comprising:at least one selected from the group consisting of a polycyclic aromatic compound represented by the following general formula (A) and a polycyclic aromatic multimer compound having a plurality of structures represented by the following general formula (A) as a first component;
at least one selected from the group consisting of compounds represented by the following general formulas (B-1) to (B-6) as a second component; and
at least one organic solvent as a third component

wherein in the above formula (A) ring A, ring B, and ring C each independently represent an aryl ring or a heteroaryl ring, at least one hydrogen atom in these rings may be substituted,
Y1 represents B,
X1 and X2 each independently represent O or N—R, while at least one of X1 and X2 represents N—R, R of the N—R is an optionally substituted aryl, an optionally substituted heteroaryl or alkyl, R of the N—R may be bonded to the ring A, ring B, and/or ring C with a linking group or a single bond,
at least one hydrogen atom in a compound or a structure represented by the above formula (A) may be substituted by a group represented by the following general formula (FG-1), a group represented by the following general formula (FG-2), an alkyl having 1 to 24 carbon atoms, a halogen atom, or a deuterium atom, further any —CH2— in the alkyl may be substituted by —O— or —Si(CH3)2—, any —CH2— excluding —CH2— directly bonded to the compound or structure represented by the above formula (A) in the alkyl may be substituted by an arylene having 6 to 24 carbon atoms, and any hydrogen atom in the alkyl may be substituted by a fluorine atom

wherein in the above formulas (B-1) to (B-4) Ar's each independently represent a hydrogen atom, an aryl, a heteroaryl, a diarylamino, a diheteroarylamino, an arylheteroarylamino, or an aryloxy, at least one hydrogen atom in these may be further substituted by an aryl, a heteroaryl, or a diarylamino,
adjacent groups among Ar's may be bonded to each other to form an aryl ring or a heteroaryl ring together with a mother skeleton of an anthracene ring, a pyrene ring, a fluorene ring, or a carbazole ring, at least one hydrogen atom in the ring thus formed may be substituted by an aryl, a heteroaryl, a diarylamino, a diheteroarylamino, an arylheteroarylamino, or an aryloxy, and
n represents an integer of 1 to a maximum substitutable number;
wherein in the above formula (B-5) R1 to R11 each independently represent a hydrogen atom, an aryl, a heteroaryl, a diarylamino, a diheteroarylamino, an arylheteroarylamino, or an aryloxy, at least one hydrogen atom in these may be further substituted by an aryl, a heteroaryl, or a diarylamino,
adjacent groups among R1 to R11 may be bonded to each other to form an aryl ring or a heteroaryl ring together with ring a, ring b, or ring c, at least one hydrogen atom in the ring thus formed may be substituted by an aryl, a heteroaryl, a diarylamino, a diheteroarylamino, an arylheteroarylamino, or an aryloxy, and at least one hydrogen atom in these may be further substituted by an aryl, a heteroaryl, or a diarylamino;
wherein in the above formula (B-6) monomer units (MU's) each independently represent at least one selected from the group consisting of divalent groups of compounds represented by the above general formulas (B-1) to (B-5), two hydrogen atoms in MU are substituted by an endcap unit (EC) or MU,
EC's each independently represent a hydrogen atom, an aryl, a heteroaryl, a diarylamino, a diheteroarylamino, an arylheteroarylamino, or an aryloxy, at least one hydrogen in these may be further substituted by an aryl, a heteroaryl, or a diarylamino, and
k is an integer of 2 to 50,000;
at least one hydrogen atom in compounds represented by the above formulas (B-1) to (B-5), a divalent group of compounds represented by the above formulas (B-1) to (B-5) in the above formula (B-6), or EC in the above formula (B-6) may be substituted by a group represented by the following general formula (FG-1), a group represented by the following general formula (FG-2), an alkyl having 1 to 24 carbon atoms, a halogen atom, or a deuterium atom,
further any —CH2— in the alkyl may be substituted by —O— or —Si(CH3)2—, any —CH2— in the alkyl excluding —CH2— directly bonded to compounds represented by the above formulas (B-1) to (B-6), a divalent group of a compound represented by the above formulas (B-1) to (B-5) in the above formula (B-6), or EC in the above formula (B-6) may be substituted by an arylene having 6 to 24 carbon atoms, and any hydrogen atom in the alkyl may be substituted by a fluorine atom;

wherein in the above formula (FG-1) R's each independently represent a fluorine atom, a trimethylsilyl, a trifluoromethyl, an alkyl having 1 to 24 carbon atoms, or a cycloalkyl having 3 to 24 carbon atoms, any —CH2— in the alkyl may be substituted by —O—, any —CH2-excluding —CH2— directly bonded to a phenyl or a phenylene in the alkyl may be substituted by an arylene having 6 to 24 carbon atoms, at least one hydrogen atom in the cycloalkyl may be substituted by an alkyl having 1 to 24 carbon atoms or an aryl having 6 to 12 carbon atoms,
when two adjacent R's each represent an alkyl or a cycloalkyl, these R's may be bonded to each other to form a ring,
m's each independently represent an integer of 0 to 4,
n represents an integer of 0 to 5, and
p represents an integer of 1 to 5;

wherein in the above formula (FG-2) R's each independently represent a fluorine atom, a trimethylsilyl, a trifluoromethyl, an alkyl having 1 to 24 carbon atoms, a cycloalkyl having 3 to 24 carbon atoms, or an aryl having 6 to 12 carbon atoms, any —CH2— in the alkyl may be substituted by —O—, any —CH2— excluding —CH2— directly bonded to a phenyl or a phenylene in the alkyl may be substituted by an arylene having 6 to 24 carbon atoms, at least one hydrogen atom in the cycloalkyl may be substituted by an alkyl having 1 to 24 carbon atoms or an aryl having 6 to 12 carbon atoms, at least one hydrogen atom in the aryl may be substituted by an alkyl having 1 to 24 carbon atoms,
when two adjacent R's each represent an alkyl or a cycloalkyl, these R's may be bonded to each other to form a ring,
m represents an integer of 0 to 4, and
n's each independently represent an integer of 0 to 5.

US Pat. No. 10,689,401

C5-C6-OXACYCLIC FUSED IMINOTHIAZINE DIOXIDE COMPOUNDS BEARING AN ETHER LINKER AS BACE INHIBITORS, COMPOSITIONS, AND THEIR USE

1. A compound, or a pharmaceutically acceptable salt thereof, said compound having the structural Formula (I):
or a tautomer thereof having the structural Formula (I?):

or pharmaceutically acceptable salt thereof, wherein:
ring C is selected from the group consisting of:

wherein RC1 and RC2 are each independently selected from the group consisting of H, halogen, —CO2—(C1-C6-alkyl), alkyl, cycloalkyl, -alkyl-cycloalkyl, heterocycloalkyl, -alkyl-heterocycloalkyl, aryl, -alkyl-aryl, heteroaryl, and -alkyl-heteroaryl,
wherein each said alkyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl of RC1 and RC2 are optionally substituted with one or more R3, and
wherein 1 to 2 non-adjacent, non-terminal carbon atoms in each said alkyl of RC1 and RC2 are optionally independently replaced with —O—, —NH—, —N(C1-C6-alkyl)-, —S—, —S(O)—, or —S(O)2—,
or, alternatively, wherein said RC1 and RC2 of one said —C(RC1RC2)— group are taken together with the carbon to which they are attached form a spirocyclic ring consisting of from 3 to 6 carbon atoms,
wherein 1 of said carbon atoms may be replaced with —O—, —NH—, —N(C1-C6-alkyl)-, —N(C1-C6-haloalkyl)-, —S—, —S(O)—, or —S(O)2—, and
wherein 1 to 2 of the carbon atoms of said spirocyclic ring may be optionally independently substituted with 1 to 2 fluorine, C1-C6-alkyl, C1-C6-haloalkyl, or —CH2O—(C1-C6-alkyl);
R1 is selected from the group consisting of H, halogen, and alkyl,
wherein said alkyl is optionally substituted with one or more fluorine, and
wherein 1 to 2 non-adjacent, non-terminal carbon atoms in said alkyl are optionally independently replaced with —O—, —NH—, —N(alkyl)-, —S—, —S(O)—, or —S(O)2—;
R2 and R3 are each independently selected from the group consisting of H, halogen, alkyl, cycloalkyl, -alkyl-cycloalkyl, heterocycloalkyl, -alkyl-heterocycloalkyl, aryl, -alkyl-aryl, heteroaryl, and -alkyl-heteroaryl,
wherein each said alkyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl of R2 and R3 are optionally substituted with one or more R4, and
wherein 1 to 2 non-adjacent, non-terminal carbon atoms in each said alkyl of R2 and R3 are optionally independently replaced with —O—, —NH—, —N(C1-C3-alkyl)-, —S—, —S(O)—, or —S(O)2—,
or, alternatively, R2 and R3 are taken together with the carbon to which they are attached form a spirocyclic ring consisting of from 3 to 6 carbon atoms,
wherein 1 of said carbon atoms may be replaced with —O—, —NH—, —N(C1-C3-alkyl)-, —N(C1-C3-haloalkyl)-, —S—, —S(O)—, or —S(O)2—, and
wherein 1 to 2 of the carbon atoms of said spirocyclic ring may be optionally independently substituted with 1 to 2 fluorine, C1-C3-alkyl, C1-C3-haloalkyl, or —CH2O—(C1-C3-alkyl);
ring A is selected from the group consisting of aryl and heteroaryl;
m is 0 or more, with the proviso that the value of m does not exceed the number of available substitutable hydrogen atoms on ring A;
each RA (when present) is independently selected from the group consisting of halogen, oxo, —OH, —CN, alkyl, —O-alkyl, and cycloalkyl,
wherein said alkyl, —O-alkyl, and cycloalkyl of RA are each optionally independently unsubstituted or substituted with one or more fluorine, and
wherein 1 to 2 non-adjacent, non-terminal carbon atoms in said alkyl and —O-alkyl are optionally independently replaced with —O—, —NH—, —N(C1-C3-alkyl)-, —S—, —S(O)—, or —S(O)2—;
n is 0;
each R4 (when present) is independently selected from the group consisting of halogen, —OH, —CN, C1-C6-alkyl, —(C1-C6-alkyl)-OH, —O—(C1-C6-alkyl), cycloalkyl, —(C1-C6-alkyl)-cycloalkyl, —O-cycloalkyl, —O—(C1-C6-alkyl)-cycloalkyl, heterocycloalkyl, —(C1-C6-alkyl)-heterocycloalkyl, —O-heterocycloalkyl and —O—(C1-C6-alkyl)-heterocycloalkyl,
wherein each said C1-C6-alkyl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more halogen,
and wherein 1 to 2 non-adjacent, non-terminal carbon atoms in each said C1-C6-alkyl is optionally independently replaced with —O—, —NH—, —N(C1-C3-alkyl)-, —S—, —S(O)—, or —S(O)2—.

US Pat. No. 10,689,400

MACROCYCLE KINASE INHIBITORS

Turning Point Therapeutic...

1. A method of treating cancer, pain, neurological diseases, autoimmune diseases, or inflammation comprising administering to a subject in need of such treatment an effective amount of at least one compound of the formula Icor a pharmaceutically acceptable salt thereof,whereinR1 is H, deuterium, C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl, C6-C10 aryl, —C(O)OR8 or —C(O)NR8R9; wherein each hydrogen atom in C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl and C6-C10 aryl is independently optionally substituted by deuterium, halogen, —OH, —CN, —OC1-C6 alkyl, —NH2, —NH(C1-C6 alkyl), —N(C1-C6 alkyl)2, NHC(O)C1-C6 alkyl, —N(C1-C6 alkyl)C(O)C1-C6 alkyl, —NHC(O)NH2, —NHC(O)NHC1-C6 alkyl, —N(C1-C6 alkyl)C(O)NH2, —N(C1-C6 alkyl)C(O)NHC1-C6 alkyl, —NHC(O)N(C1-C6 alkyl)2, N(C1-C6 alkyl)C(O)N(C1-C6 alkyl)2, —NHC(O)OC1-C6 alkyl, —N(C1-C6 alkyl)C(O)OC1-C6 alkyl, —NHS(O)(C1-C6 alkyl), —NHS(O)2(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)2(C1-C6 alkyl), —NHS(O)NH2, —NHS(O)2NH2, —N(C1-C6 alkyl)S(O)NH2, —N(C1-C6 alkyl)S(O)2NH2, —NHS(O)NH(C1-C6 alkyl), —NHS(O)2NH(C1-C6 alkyl), —NHS(O)N(C1-C6 alkyl)2, —NHS(O)2N(C1-C6 alkyl)2, —N(C1-C6 alkyl)S(O)NH(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)2NH(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)N(C1-C6 alkyl)2, —N(C1-C6 alkyl)S(O)2N(C1-C6 alkyl)2, —CO2H, —C(O)OC1-C6 alkyl, —C(O)NH2, —C(O)NH(C1-C6 alkyl), —C(O)N(C1-C6 alkyl)2, —SC1-C6 alkyl, —S(O)C1-C6 alkyl, —S(O)2C1-C6 alkyl, —S(O)NH(C1-C6 alkyl), —S(O)2NH(C1-C6 alkyl), —S(O)N(C1-C6 alkyl)2, —S(O)2N(C1-C6 alkyl)2, —P(C1-C6 alkyl)2, —P(O)(C1-C6 alkyl)2, C3-C6 cycloalkyl, or 3- to 7-membered heterocycloalkyl;
each R2 and R3 is independently H, deuterium, C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl, C6-C10 aryl, —C(O)OR8 or —C(O)NR8R9; wherein each hydrogen atom in C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl and C6-C10 aryl is independently optionally substituted by deuterium, halogen, —OH, —CN, —OC1-C6 alkyl, —NH2, —NH(C1-C6 alkyl), —N(C1-C6 alkyl)2, —NHC(O)C1-C6 alkyl, —N(C1-C6 alkyl)C(O)C1-C6 alkyl, —NHC(O)NH2, —NHC(O)NHC1-C6 alkyl, —N(C1-C6 alkyl)C(O)NH2, —N(C1-C6 alkyl)C(O)NHC1-C6 alkyl, —NHC(O)N(C1-C6 alkyl)2, —N(C1-C6 alkyl)C(O)N(C1-C6 alkyl)2, —NHC(O)OC1-C6 alkyl, —N(C1-C6 alkyl)C(O)OC1-C6 alkyl, —NHS(O)(C1-C6 alkyl), —NHS(O)2(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)2(C1-C6 alkyl), —NHS(O)NH2, —NHS(O)2NH2, —N(C1-C6 alkyl)S(O)NH2, —N(C1-C6 alkyl)S(O)2NH2, —NHS(O)NH(C1-C6 alkyl), —NHS(O)2NH(C1-C6 alkyl), —NHS(O)N(C1-C6 alkyl)2, —NHS(O)2N(C1-C6 alkyl)2, —N(C1-C6 alkyl)S(O)NH(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)2NH(C1-C6 alkyl), —N(C1-C6 alkyl)S(O)N(C1-C6 alkyl)2, —N(C1-C6 alkyl)S(O)2N(C1-C6 alkyl)2, —CO2H, —C(O)OC1-C6 alkyl, —C(O)NH2, —C(O)NH(C1-C6 alkyl), —C(O)N(C1-C6 alkyl)2, —SC1-C6 alkyl, —S(O)C1-C6 alkyl, —S(O)2C1-C6 alkyl, —S(O)NH(C1-C6 alkyl), —S(O)2NH(C1-C6 alkyl), —S(O)N(C1-C6 alkyl)2, —S(O)2N(C1-C6 alkyl)2, —P(C1-C6 alkyl)2, —P(O)(C1-C6 alkyl)2, C3-C6 cycloalkyl, or 3- to 7-membered heterocycloalkyl; or R2 and R3 taken together with the carbon atoms to which they are attached optionally form a C5-C7 cycloalkyl or a 5- to 7-membered heterocycloalkyl;
R4 is H, C1-C6 alkyl or 3- to 7-membered heterocycloalkyl, wherein each hydrogen atom in C1-C6 alkyl or 3- to 7-membered heterocycloalkyl is independently optionally substituted by halogen, —OH, —CN, —OC1-C6 alkyl, —NH2, —NH(C1-C6 alkyl), —N(C1-C6 alkyl)2, —CO2H, —C(O)OC1-C6 alkyl, —C(O)NH2, —C(O)NH(C1-C6 alkyl), —C(O)N(C1-C6 alkyl)2, C3-C6 cycloalkyl, or monocyclic 5- to 7-membered heterocycloalkyl;
R5 is selected from the group consisting of fluoro, chloro, bromo, C1-C6 alkyl, —OH, —CN, —OC1-C6 alkyl, —NHC1-C6 alkyl, —N(C1-C6 alkyl)2, C3-C6 cycloalkyl, 3- to 7-membered heterocycloalkyl, —O—(C3-C6 cycloalkyl), —O-(3- to 7-membered heterocycloalkyl), 5- to 7-membered heteroaryl, C6-C10 aryl, and CF3; wherein each hydrogen atom in C1-C6 alkyl, —OC1-C6 alkyl, —NHC1-C6 alkyl, —N(C1-C6 alkyl)2, C3-C6 cycloalkyl, 3- to 7-membered -heterocycloalkyl, —O—(C3-C6 cycloalkyl), —O-(3- to 7-membered heterocycloalkyl), 5- to 7-membered heteroaryl and C6-C10 aryl is independently optionally substituted by fluoro, chloro, bromo, —OH, —CN, —OC1-C6 alkyl, —NH2, NH(C1-C6 alkyl), —N(C1-C6 alkyl)2, C3-C7 cycloalkyl, 3- to 7-membered heterocycloalkyl, C6-C10 aryl, 5- to 7-membered heteroaryl, —CO2H, —C(O)OC1-C6 alkyl, —C(O)NH2, —C(O)NH(C1-C6 alkyl) and —C(O)N(C1-C6 alkyl)2;
R6 is selected from the group consisting of H, fluoro, chloro, bromo, C1-C6 alkyl —OH, —CN, —OC1-C6 alkyl, —NHC1-C6 alkyl, —N(C1-C6 alkyl)2, 5- to 7-membered heteroaryl, C6-C10 aryl, and -CF3; wherein each hydrogen atom in C1-C6 alkyl, 5- to 7-membered heteroaryl and C6-C10 aryl is independently optionally substituted by fluoro, chloro, bromo, —OH, —CN, —OC1-C6 alkyl, —NH2, —NH(C1-C6 alkyl), —N(C1-C6 alkyl)2, —CO2H, C(O)OC1-C6 alkyl, —C(O)NH2, —C(O)NH(C1-C6 alkyl) and —C(O)N(C1-C6 alkyl)2;
R7 is H;
each R8 and R9 is independently H, deuterium, C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl, 3- to 7-membered heterocycloalkyl C6-C10 aryl or heteroaryl;
R10 is independently H, deuterium, C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl, 3- to 7-membered heterocycloalkyl, C6-C10 aryl, or mono- or bicyclic heteroaryl: wherein each hydrogen atom in C1-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C3-C6 cycloalkyl, 3- to 7-membered heterocycloalkyl, C6-C10 aryl, or mono- or bicyclic heteroaryl is independently optionally substituted by deuterium, halogen, C1-C6 alkyl, C1-C6 haloalkyl or —OR8; and
n is 1 or 2;
and wherein the disease is mediated by Bruton's tyrosine kinase (BTK).

US Pat. No. 10,689,399

SUBSTITUTED 3,4,5,6,8,10,14,14A-OCTAHYDRO-2H-2,6-METHANOPYRIDO[1?,2?:4,5]PYRAZINO[2,1-B][1,3]OXAZOCINES AND METHODS FOR TREATING VIRAL INFECTIONS

Gilead Sciences, Inc., F...

4. A pharmaceutical composition comprising a compound of claim 1, or a pharmaceutically acceptable salt or stereoisomer thereof, and a pharmaceutically acceptable carrier, diluent or excipient.

US Pat. No. 10,689,398

OXA-DIAZASPIRO COMPOUNDS HAVING ACTIVITY AGAINST PAIN

ESTEVE PHARMACEUTICALS, S...

1. A compound of general Formula (I):
wherein
R1 is

m is 1, 2, 3, 4 or 5;
n is 0, 1, 2, 3, 4 or 5;
p is 0 or 1;
q is 0, 1 or 2;
r is 0 or 2;
X is a bond, —C(RxRx?)—, —C(O)—, —O—, —C(O)NR7—, —NR7C(O)— or —C(O)O—;
wherein Rx is selected from the group consisting of halogen or substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl substituted or unsubstituted C2-6 alkynyl, and —OR7;
Rx? is selected from the group consisting of hydrogen, halogen or substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl and substituted or unsubstituted C2-6 alkynyl;
R7 is selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl and substituted or unsubstituted C2-6 alkynyl;
Y is —CH2— or —C(O)—;
R1? is selected from the group consisting of substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl, substituted or unsubstituted C2-6 alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heterocyclyl;
R2 is selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl, substituted or unsubstituted C2-6 alkynyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heterocyclyl,
R3 is selected from the group consisting of substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl and substituted or unsubstituted C2-6 alkynyl;
R3? is selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl and substituted or unsubstituted C2-6 alkynyl; or
R3 and R3?, together with the carbon atom to which they are attached, form a substituted or unsubstituted cycloalkyl;
R4 and R4? are independently selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl, substituted or unsubstituted C2-6 alkynyl, —CHOR9 and —C(O)OR9;
wherein R9 is selected from the group consisting of hydrogen, substituted or unsubstituted C1-9 alkyl, substituted or unsubstituted C2-9 alkenyl and substituted or unsubstituted C2-9 alkynyl;
R5 and R5? are independently selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl, substituted or unsubstituted C2-6 alkynyl, —CHOR8 and —C(O)OR8;
wherein R8 is selected from hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl and substituted or unsubstituted C2-6 alkynyl;
R6 and R6? are independently selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl, substituted or unsubstituted C2-6 alkynyl, —CHOR10 and —C(O)OR10;
wherein R10 is selected from the group consisting of hydrogen, substituted or unsubstituted C1-6 alkyl, substituted or unsubstituted C2-6 alkenyl and substituted or unsubstituted C2-6 alkynyl;
or a stereoisomer, a racemate or a mixture of at least two stereoisomers, in any mixing ratio, or a corresponding salt thereof, or a corresponding solvate thereof;
with the following proviso applying:
when Y is —C(O)—, then R1 is not

US Pat. No. 10,689,397

ULK1 INHIBITORS AND METHODS USING SAME

SALK INSTITUTE FOR BIOLOG...

1. A compound, or pharmaceutically acceptable salt thereof, having a structure of Formula A:wherein in Formula A:R10 is selected from the group consisting of: halogen; OR11 wherein R11 is H, optionally substituted aryl, or optionally substituted heteroaryl; and NR1R2 wherein R1 is H or alkyl and R2 is selected from the group consisting of H, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, and optionally substituted alkyl, wherein the aryl or heteroaryl of R2 is optionally substituted with one or more substituent, wherein each substituent of the aryl or heteroaryl of R2 is selected from the group consisting of alkyl, alkynyl, alkenyl, aryl, halide, nitro, amino, ester, ketone, aldehyde, hydroxy, carboxylic acid, and alkoxy;
R4 is optionally substituted aryloxy, optionally substituted heteroaryloxy, optionally substituted alkoxy, N-heterocyclic, optionally substituted thiol, optionally substituted alkyl, or hydroxyl;
R5 is selected from the group consisting of hydroxyl, substituted alkyl, chloro, bromo, substituted alkoxy, optionally substituted aryl, optionally substituted carboxyl, cyano, and nitro, or R5 and R6 together form a cyclic structure;
wherein each substituent of the substituted alkyl of R5 is selected from the group consisting of halogen, cycloalkyl, alkoxy, amino, hydroxyl, and carboxyl; and
R6 is H or haloalkyl.

US Pat. No. 10,689,396

INHIBITORS OF BRUTON'S TYROSINE KINASE AND METHODS OF THEIR USE

Janssen Pharmaceutica NV,...

1. A compound of Formula (I?), pharmaceutically acceptable salts, stereoisomers, isotopes, or N-oxides thereof,
wherein
R1 is H or C1-6alkyl;
R2 is selected from the group consisting of: C0-2alk-piperidinyl; C0-2alk-pyrrolidinyl; oxazepanyl; azetidinyl; azepanyl; quinuclidinyl; C2alk-imidazolidinyl; C2alk-piperazinyl; C2alk-morpholinyl; tetrahydropyranyl; and C0-1alk-tetrahydrofuranyl; wherein the R2 is optionally substituted with 1, 2, or 3 substituents each independently selected from the group consisting of:
(C?O)—C(R3)?CR4(R5); oxo; halogen; OH; NH2; CN; C1-6alkyl; C1-6alk-OH; OC1-6alkyl; C1-6haloalkyl; C3-6cycloalkyl; SO2C1-6alkyl; SO2—C2-6alkenyl; C1-2alk-aryl; (C?O)H; (C?O)C1-6alkyl; (C?O)C1-6haloalkyl; (C?O)—C2-6alkenyl; (C?O)—C2-6alkynyl; (C?O)C3-6cycloalkyl; (C?O)-phenyl; (C?O)-imidazolyl; (C?O)—C1-6alkCN; (C?O)—C1-6alk-OH; (C?O)—C1-6alk-SO2C1-6alkyl; (C?O)—C16alk-NR6R7; (C?O)—C1-6alk-O—C1-6alkyl wherein the —C1-6alk- is optionally substituted with OH, OC1-6alkyl, or NR6R7; (C?O)C0-1alk-heterocycloalkyl wherein the -alk- is optionally substituted with oxo and the heterocycloalkyl is optionally substituted with C1-6alkyl; and NH(C?O)—C(R3)?CR4(R);whereinR3 is selected from the group consisting of: H, CN, halogen, C1-6haloalkyl, and C1-6alkyl;
R4 and R5 are each independently selected from the group consisting of: H; halogen; C1-6alkyl; CH2OH; C1-6alk-OC1-6alkyl; OC1-6alkyl; C1-4alk-NR6R7; C3-6cycloalkyl substituted with NH2 or CH3; oxetanyl substituted with CH3; 1-acetylpyrrolidin-2-yl; CH2-pyrrolidinyl; CH2-piperidinyl; C(CH3)2-piperidinyl; CH2-morpholinyl; C(CH3)2-morpholinyl; CH2-(4aR,7aS)-tetrahydro-2H-[1,4]dioxino[2,3-c]pyrrol-6(3H)-yl; C(CH3)2NH(CH2CH2OCH3); CH2SO2CH3; CH2NHSO2CH3; NH(C?O)C1-6alkyl; and linker-PEG-Biotin; and
R6 and R7 are each independently selected from the group consisting of: H, C1-6alkyl, cyclopropyl, (C?O)H, and CN;
A is selected from the group consisting of: a bond, phenyl; naphthalenyl, pyridyl; pyrimidinyl; pyrazinyl; pyridazinyl; benzothiophenyl; and pyrazolyl; wherein the A is optionally substituted with 1, 2, or 3 substituents each independently selected from the group consisting of: C1-6alkyl, halogen, OC1-6alkyl, (C?O)C1-6alkyl, and C1-6haloalkyl;
E is selected from the group consisting of: —O—, a bond, (C?O)—NH, CH2, and CH2—O; and
G is selected from the group consisting of: H, C1-6alkyl; C1-6haloalkyl; C1-6alk-OC1-6alkyl; NR6R7; SO2C1-6alkyl; OH; C3-6cycloalkyl; phenyl; thiophenyl; pyrimidinyl; pyridyl; pyridazinyl; benzofuranyl; heterocycloalkyl that contains an oxygen heteroatom; phenyl-CH2—O-phenyl; wherein the phenyl, thiophenyl, pyrimidinyl, pyridyl, pyridazinyl, or benzofuranyl is optionally substituted with 1, 2, or 3 substituents each independently selected from the group consisting of: halogen, C1-6alkyl, C1-6haloalkyl, OC1-6haloalkyl, OC1-6alkyl, OC1-6alkyl-OC1-6alkyl, C3-6cycloalkyl, CN, OH, NH2, N(CH3)2, C1-6alk-OC1-6alkyl, SO2C1-6-alkyl, (C?O)—NR6R7, SF5, and (C?O)C1-6alkyl.

US Pat. No. 10,689,395

TRICYCLIC FUSED PYRIDIN-2-ONE DERIVATIVES AND THEIR USE AS BRD4 INHIBITORS

JUBILANT BIOSYS LIMITED, ...

1. A compound of the Formula (I)
wherein;
---- is absent or a single bond;
X is —O—;
n is 0-6;
R1 is selected from the group consisting of hydrogen, halogen, C1-6 alkyl, C1-6 alkoxy, C1-6 haloalkyl, C3-8 cycloalkyl, C5-6 aryl, C1-6 heteroaryl with heteroatoms selected from N, O, and S, and C1-6 alkoxyalkyl;
wherein C1-6 alkyl, C3-8 cycloalkyl, C5-6 aryl, or C1-6 heteroaryl is optionally substituted with one or more of the groups selected from hydrogen, C1-6 alkyl, halogen, and OH;
R2 and R3 are independently selected from hydrogen, halogen, hydroxy, nitro, cyano, azido, nitroso, oxo (?O), thioxo (?S), amino, hydrazino, formyl, C1-6 alkyl, haloalkyl, C1-6 alkoxy, C1-6 haloalkoxy, arylalkoxy, C3-8 cycloalkyl, C3-8 cycloalkyloxy, C5-6 aryl, C2-6 heterocyclyl, C1-6 heteroaryl, alkylamino, —COORa, —C(O)Rb, —C(S)Ra, —C(O)NRaRb, —C(S)NRaRb, —NRaC(O)NRbRc, NRaC(S)NRbRc, —N(Ra)SORb, —N(Ra)SO2Rb, —NRaC(O)ORb, —NRaRb, —NRaC(O)Rb, —NRaC(S)Rb, —SONRaRb, —SO2NRaRb, —ORa, —OC(O)NRaRb, —OC(O)Ra, —SRa, —SORa, and —SO2Ra, wherein Ra, Rb and Rc are independently selected from hydrogen, C1-6 alkyl, C3-8 cycloalkyl, C5-6 aryl, C5-6 arylalkyl, C2-6 heterocyclyl, C1-6 heteroaryl, and C2-6 heteroarylalkyl;
R4 is selected from the group consisting of hydrogen, C1-6 alkyl, C1-6 haloalkyl, C3-8 cycloalkyl, C5-6 aryl, C1-6 heteroaryl with heteroatoms selected from N, O, and S, and C1-6 alkoxyalkyl;
wherein C1-6 alkyl, C3-8 cycloalkyl, C5-6 aryl, or C2-6 heteroaryl is optionally substituted with one or more of the groups selected from hydrogen, C1-6 alkyl, C3-8 cycloalkyl, halogen, OH, and cyano;
ring A is selected from the group consisting of C1-6 heteroaryl, C3-8 cycloalkyl, C4-6 heterocycloalkyl, and C4-10 heterocycloaryl with heteroatoms selected from N, O, and S;
Z is selected from —CH2OR5, —COOR5, —CONR5R6, —NR5R6, —NR5CO—OR6, —NR5CO—NR6R7, —NR5COR6, —NR5SO2R6, and —O—CO—NR5R6;
R5, R6, and R7 are independently selected from hydrogen, substituted or unsubstituted C5-6 aryl, C1-6 heteroaryl, C3-8 cycloalkyl, and C1-6 alkyl;
wherein when R5, R6, and R7 are substituted, the one or more substituents are selected from hydrogen, halogen, hydroxy, nitro, cyano, azido, nitroso, thioxo (?S), amino, hydrazino, formyl, C1-6 alkyl, haloalkyl, C1-6 alkoxy, C1-6 haloalkoxy, C5-6 arylalkoxy, C3-8 cycloalkyl, C3-8 cycloalkyloxy, C5-6 aryl, C2-6 heterocyclyl, C1-6 heteroaryl, alkylamino, —COORa, —C(O)Rb, —C(S)Ra, —C(O)NRaRb, —C(S)NRaRb, —NRaC(O)NRbRc, —NRaC(S)NRbRc, —N(Ra)SORb, —N(Ra)SO2Rb, —NRaC(O)ORb, —NRaRb, —NRaC(O)Rb, NRaC(S)Rb, SONRaRb, —SO2NRaRb, —ORa, —OC(O)NRaRb, —OC(O)Ra, —SRa, —SORa, and —SO2Ra, wherein Ra, Rb and Rc are independently selected from hydrogen, C1-6 alkyl, C3-8 cycloalkyl, C5-6 aryl, C5-6 arylalkyl, C2-6 heterocyclyl, C1-6 heteroaryl, and C1-6 heteroarylalkyl.

US Pat. No. 10,689,394

THIENO[2,3-B]PYRIDINE DERIVATIVE, QUINOLINE DERIVATIVE, AND USE THEREOF

THE UNIVERSITY OF TOKYO, ...

1. A compound represented by the following formula (1) or a salt thereof, or a solvate or hydrate thereof:wherein X represents a sulfur atom or —CH?CH—; A1 to A4 each independently represent a carbon atom or a nitrogen atom, and at least one of A1 to A4 is a nitrogen atom; R1 represents any one of a 1,2,3,4-tetrahydroquinolyl group (or a 3,4-dihydro-1(2H)-quinolyl group), a 3,4-dihydro-4,4-dimethyl-1(2H)-quinolyl group, a 2,3,4,5-tetrahydro-1H-1-benzazepinyl group, or a substituent represented by the following formula (2):
wherein R4 represents a 2,3,4-trifluorophenyl group, a 4-iodophenyl group, a 2,3-difluorophenyl group, a 3,5-difluorophenyl group, a 5-fluoro-2-methylphenyl group, a 3-pentafluorosulfanylphenyl group, a 2,6-dimethylphenyl group, a 4-benzyloxyphenyl group, a 3,5-bis(trifluoromethyl)biphenyl group, a 4-tert-butylphenyl group, a 3-methoxyphenyl group, an unsubstituted or substituted pyridyl group, or an unsubstituted or substituted naphthyl group; R5 represents a hydrogen atom, a lower alkyl group, a lower alkenyl group, a lower alkynyl group optionally containing an oxygen atom and/or a double bond, or an unsubstituted or substituted aromatic lower alkyl group; R2 represents a hydrogen atom, a lower alkyl group, a lower acyl group, or an unsubstituted or substituted aromatic lower alkyl group; and R3 represents a hydrogen atom, or R2 and R3 may bind to each other to form a ring.

US Pat. No. 10,689,393

TETRAHYDROISOQUINOLINE DERIVATIVES

Astellas Pharma Inc., To...

1. A method for preventing or treating chronic obstructive pulmonary disease (COPD), comprising administering to a subject in need thereof an effective amount of a compound of formula (I) or a salt thereof:wherein,X1 is C—R11 or N;
X2 is C—R12 or N;
R11 is i) H, ii) halogen, iii) —CN, or iv) —O—C1-6 alkyl;
R12 is H or halogen;
R1 is i) H, ii) C1-6 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of halogen(s), and pyrazolyl(s), iii) C2-6 alkenyl, or iv) —OR0;
R2 is i) C1-6 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of —OR0(s), halogen(s), —COOR0(s), —CONR21R22(s), phenyl(s) which may be substituted with one or more substituent(s) selected from the G?group, and heteroaryl(s) which is selected from the group consisting of pyridyl, pyrazolyl, imidazolyl, thiazolyl, thiadiazolyl, thienyl, oxazolyl, isoxazolyl, and triazolyl, wherein, the heteroaryl may be substituted with one or more substituent(s) selected from the G2 group, ii) C2-6 alkenyl, iii) C2-6 alkynyl, iv) —OR0, v) —NR23R24, vi) —COOR0, or vii) phenyl;
R21 is H or C1-6 alkyl;
R22 is i) C1-6 alkyl which may be substituted with one or more phenyl(s), or ii) phenyl;
R23 is i) H, or ii) C1-6 alkyl which may be substituted with one or more —OH(s);
R24 is i) C1-6 alkyl which may be substituted with one or more phenyl(s) which may be substituted with one or more halogen(s), ii) C3-8 cycloalkyl which may be substituted with one or more C1-6 alkyl(s), iii) phenyl which may be substituted with one or more halogen(s), or iv) tetrahydropyranyl; or
R1, R2, and a carbon atom bounded by R1 and R2 may interact to form a 4-piperidine ring or 4-tetrahydropyran ring, and the carbon atom bounded by R1 and R2 is a spiro atom and the 4-piperidine ring may be substituted with one or more substituent(s) selected from the group consisting of —SO2—(C1-6 alkyl) and —COOR0;
R3 and R4 are the same or different each other, i) C1-3 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of halogen(s) and —OH(s) or ii) C2-6 alkenyl which may be substituted with one or more substituent(s) selected from the group consisting of —OH(s) and heteroaryl(s) which is selected from the group consisting of pyrazolyl and thienyl, wherein the heteroaryl may be substituted with one or more C1-6 alkyl(s), or,
R3, R4, and a carbon atom bounded by R3 and R4 may interact to form a 3-oxetane ring and the carbon atom bounded by R3 and R4 is a spiro atom;
R5 is i) H, ii) C1-6 alkyl which may be substituted with one or more —O—(C1-6 alkyl)(s), iii) —O—C1-6 alkyl, iv) halogen, v) —COO—(C1-6 alkyl), or vi) C3-8 cycloalkyl;
R6 is i) H, ii) C1-6 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of —O—(C1-6 alkyl(s) which may be substituted with one or more halogen(s)) and halogen(s), iii) —OH, iv) —O—(C1-6 alkyl which may be substituted with one or more halogen(s)), v) halogen, vi) —CN, vii) —S—(C1-6 alkyl), viii) C3-8 cycloalkyl, ix) —NR0R0, or x) C2-6 alkenyl;
G1 group is i) halogen, ii) —COOR0, iii) —CONR0R0, iv) —OH, v) C1-6 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of —OH(s) and halogen, or vi) —O—(C1-6 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of —OH(s) and halogen(s));
G2 group is i) halogen, ii) C1-6 alkyl which may be substituted with one or more substituent(s) selected from the group consisting of —OH(s) and halogen(s) or iii) —CONR0R0;
R0 is the same or different each other, H or C1-6 alkyl,provided that said compound is not methyl 1,1-diallyl-3-oxo-2,4-dihydroisoquinoline-4-carboxylate or a salt thereof.

US Pat. No. 10,689,391

ISOXAZOLE ANALOGS AS FXR AGONISTS AND METHODS OF USE THEREOF

Enanta Pharmaceuticals, I...

22. A pharmaceutical composition comprising a compound of claim 1 and a pharmaceutically acceptable carrier.