US Pat. No. 10,111,856

COMPOSITION FOR PREVENTING OR TREATING CLIMACTERIC SYMPTOMS COMPRISING SOYBEAN EXTRACT COMPRISING COUMESTROL AS AN ACTIVE INGREDIENT

AMOREPACIFIC CORPORATION,...

1. A method for preventing or treating a climacteric disease, wherein the method comprises administering an effective amount of a germinated and fermented bean extract comprising coumestrol to a subject in need thereof, wherein the method is for preventing or treating a climacteric disease,wherein the fermented bean extract is a fermented product by Aspergillus oryzae of the germinated bean,
wherein the climacteric disease is osteoporosis.
US Pat. No. 10,113,138

APE-FREE SURFACTANT COMPOSITIONS AND USE THEREOF IN TEXTILE APPLICATIONS

Dow Global Technologies L...

1. A process of removing wax or oil from a textile material, comprising contacting the textile material with a composition comprising:an alkyl alkoxylate sulfate of formula I:
R1O—(CH2CH(R2)—O)x—(CH2CH2O)y—SO3M  (I);
a nonionic alkyl alkoxylate of formula II:
R1O—(CH2CH(R2)—O)x—(CH2CH2O) y—H  (II); and
waterwherein R1 is linear or branched C4-C10 alkyl;R2 is CH3 or CH3CH2;
x is a real number from 1 to 11;
y is a real number from 1 to 20; and
M is an alkali metal or NH4, andwherein R1, R2, x, and y in formula I and formula II may be the same or different.
US Pat. No. 10,111,857

MICROCAPSULES CONTAINING AN OXIDIZABLE ACTIVE, AND A PROCESS FOR PREPARING THE SAME

IDCAPS, La Rochelle (FR)...

1. A microcapsule consisting of:a single core consisting of an oxidizable active (OA), and at least one additional element selected from drying agents, antioxidant agents, filmogen agents and emulsifying agents, the outer part of said core being in a solid form; and
a water insoluble coating obtained from a water soluble encapsulating agent (EA) selected from alginates of monovalent cations, water insolubility being induced by a salt having a divalent metallic cation, said coating surrounding said core,
wherein said OA is selected from the group consisting of vitamin B5, vitamin B6, vitamin B8, vitamin B9, vitamin A, vitamin D3, vitamin K and vitamin E,
with the proviso that:
said core does not comprise a metal oxide, and
said coating does not comprise a disintegrant.
US Pat. No. 10,113,139

SOLID FABRIC CONDITIONER COMPOSITION AND METHOD OF USE

Ecolab USA Inc., Saint P...

1. A solid fabric softening composition comprising:(a) from about 5 wt. % to about 10 wt. % of one or more surfactants;
(b) from about 5 wt. % to about 20 wt. % of a polyethylene glycol with a molecular weight of 4000 (PEG-4000) or 8000 (PEG-8000) and about 19 wt. % to about 30 wt. % of urea as solidification agents; and
(c) from about 30 wt. % to about 45 wt. % of a quaternary ammonium component and about 5 wt. % to about 10 wt. % of an amino-functional silicone compound,
wherein the surfactants are a C10-C16 alcohol ethoxylate or mixtures thereof;
wherein the ester quaternary ammonium component is methyl bis[ethyl (tallowate)]-2-hydroxyethyl ammonium; and
wherein a ratio of the ester quaternary ammonium component to amino-functional silicone compound is between about 3:1 to about 9:1.
US Pat. No. 10,113,395

ORGANOPHILIC NANOPARTICLES IN DIRECT EMULSION SYSTEMS AND METHODS FOR THEIR USE AS WELLBORE DRILLING FLUIDS

M-I L.L.C., Houston, TX ...

14. A direct emulsion fluid comprising:an aqueous continuous phase;
an oleaginous discontinuous phase;
a phospholipid surfactant stabilizing the oleaginous discontinuous phase within the aqueous continuous phase; and
a viscosifier.
US Pat. No. 10,112,885

PROCESS AND SYSTEM FOR PRODUCING ACRYLIC ACID

Arkema Inc., King of Pru...

1. A process for the recovery of (meth)acrylic acid using coupled distillation columns comprising a dehydration column that is coupled to a finishing column such that a tails stream from the dehydration column is fed directly or indirectly into a top of the finishing column while an overhead stream of the finishing column is fed directly or indirectly into a base of the dehydration column, the process comprising:A. dehydrating a gaseous reaction mixture comprising (meth)acrylic acid in said dehydration column to produce a dehydration column overhead stream and a dehydration column bottoms stream, wherein the dehydrating step is carried out without using azeotropic solvent;
B. passing at least a portion of the dehydration column bottoms stream to the upper half of said finishing column;
C. subjecting the portion of the bottoms stream passed to the finishing column to distillation at less than atmospheric pressure within the finishing column to produce at least a finishing column overhead stream and a finishing column bottoms stream;
D. at least partially condensing the finishing column overhead stream using an overhead aspirating direct contact (ADC) condenser system to form a finishing column overhead condensate, and passing at least a portion of the finishing column overhead condensate to the dehydration column, wherein said ADC condenser system at least partially condenses the finishing column overhead stream and comprises at least one liquid jet eductor supplied with condensate from the finishing column overhead stream to generate a vacuum; at least one liquid-vapor separatory vessel; and at least one condensate cooler;
E. collecting (meth)acrylic acid from the finishing column; wherein said (meth)acrylic acid collected is technical grade containing at least 98.5% by weight (meth)acrylic acid, less than 0.5% water, and less than 0.4% acetic acid, and without producing a wastewater stream.
US Pat. No. 10,111,860

COMPOSITIONS AND METHODS FOR TREATING CONCUSSION

1. A method for treating concussion, the method comprising:administering a therapeutic dose of an active compound comprising one or more of: phenserine, a phenserine metabolite, a phenserine prodrug, or combinations thereof.
US Pat. No. 10,115,963

NEGATIVE ELECTRODE MATERIAL FOR SECONDARY BATTERY AND SECONDARY BATTERY USING THE SAME

LG Chem, Ltd., (KR)

1. A negative electrode material for a secondary battery capable of intercalating and de-intercalating lithium, wherein the negative electrode material consists of alloy particles including a silicon phase and a metal phase, and a carbonaceous material, whereinthe silicon phase has a crystallite size of 10 nm or less,
the metal phase comprises two or more kinds of metals alloying with silicon but not with lithium,
the carbonaceous material has a crystallite size of 30 nm or more, and
the carbonaceous material is present on a surface of, or within the alloy particles.
US Pat. No. 10,112,888

NITROXIDE HYDROXYLAMINE AND PHENYLENEDIAMINE COMBINATIONS AS POLYMERIZATION INHIBITORS FOR ETHYLENICALLY UNSATURATED MONOMER PROCESSES

ECOLAB USA INC., St. Pau...

1. A method of inhibiting polymerization of isoprene comprising:providing a fluid comprising the isoprene;
adding an effective amount of a polymerization inhibitor composition to the fluid, wherein the polymerization inhibitor composition comprises an effective amount of 4-hydroxy-2,2,6,6-tetramethyl piperidinol and an effective amount of N,N?-di-1,4-dimethylpentyl-1,4-phenylenediamine; and
inhibiting polymerization of the isoprene.
US Pat. No. 10,112,119

METHOD FOR MODIFYING LOCAL PROPERTIES OF MATERIALS

Disney Enterprises, Inc.,...

1. A method for altering at least one local property of a primary material, comprising:reducing an elasticity of the primary material, wherein the primary material is an artificial skin material;
while the elasticity of the primary material is reduced, creating a delivery aperture through a portion of the primary material; and
introducing through the delivery aperture a secondary material into the primary material.
US Pat. No. 10,115,965

POSITIVE ACTIVE MATERIAL FOR RECHARGEABLE LITHIUM BATTERY, METHOD OF PREPARING SAME, AND RECHARGEABLE LITHIUM BATTERY INCLUDING SAME

Samsung SDI Co., Ltd., Y...

1. A positive active material for a rechargeable lithium battery, comprisinga core comprising a compound capable of intercalating and deintercalating lithium, the compound capable of intercalating and deintercalating lithium being a nickel-based oxide; and
a lithium metal phosphate on the surface of the core, the lithium metal phosphate being included in an amount of about 0.01 parts by weight to about 20 parts by weight based on 100 parts by weight of the compound capable of intercalating and deintercalating lithium,
wherein the lithium metal phosphate is different from the compound capable of intercalating and deintercalating lithium and is represented by Chemical Formula 1:
Li1+(x+y)InxMyTi2-(x+y)(PO4)3  Chemical Formula 1
wherein, in Chemical Formula 1, M is Al, Y, Sc, Mg, V, Cr, Mn, Fe, Ga, Lu, Cr, La, Ge, or a combination thereof, 0 wherein the nickel-based oxide comprises a lithium nickel cobalt aluminum oxide, a lithium nickel cobalt manganese oxide, or a combination thereof.
US Pat. No. 10,111,608

METHOD AND APPARATUS FOR PROVIDING DATA PROCESSING AND CONTROL IN MEDICAL COMMUNICATION SYSTEM

ABBOTT DIABETES CARE INC....

1. A method for notifying a user about an alarm condition without causing interruption to a predetermined routine, the method comprising:executing a concurrent passive notification routine on an analyte monitoring device, the concurrent passive notification routine comprising monitoring analyte levels received from a sensor for the alarm condition;
executing the predetermined routine comprising one or more of performing a finger stick blood glucose test, calibrating a sensor unit, configuring a device setting, reviewing historical glucose data, reviewing historical alarms, events, or entries in a data log, managing a data communication setting, transferring data to a data processing terminal, or reviewing a higher priority alarm condition;
in response to detecting the alarm condition by the concurrent passive notification routine during the execution of the predetermined routine, outputting to a user interface a first indication associated with the alarm condition, wherein the first indication is outputted during the execution of and without interruption to the predetermined routine; and
in response to a termination or a completion of the predetermined routine, outputting to the user interface by the concurrent passive notification routine a second indication for the alarm condition associated with the first indication.
US Pat. No. 10,112,892

PROCESS FOR PREPARING POLYISOCYANATES

Covestro Deutschland AG, ...

1. A continuous process for liquid phase preparation of a polyisocyanate by reaction of a corresponding polyamine with phosgene, with a corresponding carbamoyl chloride and a corresponding amine hydrochloride occurring as intermediates, comprising:(i) mixing a phosgene-containing stream, a polyamine-containing stream and a stream containing carbamoyl chloride and amine hydrochloride in a mixing device to obtain a mixed stream, where phosgene is used in a stoichiometric excess of from >0% to 50% of theory, based on the amine groups of the polyamine present in the polyamine-containing stream;
(ii) conveying the mixed stream obtained in step (i) through a reactor in which an absolute pressure of from 20 bar to 60 bar and a temperature of from 80° C. to 200° C., prevail, thereby forming a stream containing carbamoyl chloride and amine hydrochloride;
(iii) optionally discharging a gaseous purge stream from the stream containing carbamoyl chloride and amine hydrochloride which is formed in step (ii), giving a stream which contains carbamoyl chloride and amine hydrochloride and has been depleted in gaseous components, and
(iv) dividing the stream containing carbamoyl chloride obtained in step (ii) or the stream contains carbamoyl chloride and amine hydrochloride and has been depleted in gaseous components obtained in step (iii) into two substreams, where
(a) one substream is used as the stream containing carbamoyl chloride and amine hydrochloride in step (i) and
(b) the other substream converted into the desired polyisocyanate.
US Pat. No. 10,113,148

METHOD FOR OBTAINING MONOCYTES OR NK CELLS

1. A method for obtaining monocytes or NK cells, comprising:(a) collecting a monocyte sample by separating the monocytes from peripheral blood by using an antibody specific for a surface marker of the monocytes, wherein the peripheral blood is obtained from a human;
(b) collecting, as an NK cell sample, cell populations remaining after the separation of the monocytes; and
(c) growing the monocytes or the NK cells by culturing at least one of the monocyte sample and the NK cell sample,
wherein in the step (c), at least the NK cells are grown by culturing the NK cell sample without carrying out further separation steps by use of a second medium containing an anti-CD56 antibody.
US Pat. No. 10,112,123

FRACTIONATOR FOR SEPARATING SOLUBILIZED RUBBER FROM A CO-SOLVENT BASED MISCELLA AND RELATED PROCESSES

Bridgestone Corporation, ...

1. A fractionator for separating solubilized rubber from a co-solvent based miscella, the fractionator comprising:a primary vessel comprising:
a feed inlet for feeding a co-solvent based miscella into the primary vessel, wherein the co-solvent based miscella separates to form (i) a non-polar solvent viscous rubber phase in a lower portion of the primary vessel and (ii) a polar solvent solubilized resin phase above the non-polar solvent viscous rubber phase;
a side outlet for removing the polar solvent solubilized resin phase from the primary vessel; and
a bottom outlet for removing the non-polar solvent viscous rubber phase from the primary vessel.
US Pat. No. 10,113,149

REPROGRAMMING OF HUMAN ENDOTHELIUM INTO HEMATOPOIETIC MULTI-LINEAGE PROGENITORS BY DEFINED FACTORS

CORNELL UNIVERSITY, Itha...

1. A method of generating human hematopoietic multi-lineage, progenitor cells (HMLPs) from human endothelial cells (ECs), comprising culturing human ECs expressing each of the transcription factors Finkel-Biskis-Dinkins murine osteosarcoma viral oncogene homolog B (FOSB), growth factor independent 1 transcription repressor (GFI1), Runt-related transcription factor 1 (RUNX1), spleen focus forming virus proviral integration oncogene (SPI1), in serum-free media with endothelial feeder cells, thereby generating HMLPs.
US Pat. No. 10,113,405

METHOD AND MATERIALS FOR HYDRAULIC FRACTURING WITH DELAYED CROSSLINKING OF GELLING AGENTS

Independence Oilfield Che...

1. A method of generating a fracture network within a subterranean formation penetrated by a wellbore, the subterranean formation having a permeability less than 10 mD, the method comprising:(A) pumping into the wellbore under shear an aqueous well treatment fluid comprising a crosslinking agent and a water-soluble gellant and delaying crosslinking between the crosslinking agent and the water-soluble gellant during pumping, wherein:
(a) the aqueous well treatment fluid when pumped into the wellbore has a viscosity less than 20 cP at 40 sec?1;
(b) the aqueous well treatment fluid comprises a non-aqueous slurry and the water-soluble gellant, wherein the non-aqueous slurry comprises (i) a non-aqueous liquid immiscible in water; (ii) an oil-wetting surface active material; and (iii) the crosslinking agent;
(c) the amount of the water-soluble gellant in the aqueous well treatment fluid is from about 6 to about 15 lb/1000 gal water; and
(d) the aqueous well treatment fluid increases in viscosity by forming a crosslinked gel from the water-soluble gellant and the crosslinking agent; and
(B) reducing the viscosity of the aqueous well treatment fluid by thermally thinning the aqueous well treatment fluid under in-situ conditions and generating a fracture network within the formation from the thermally thinned aqueous well treatment fluid.
US Pat. No. 10,113,150

ENGINEERED CARDIAC TISSUES AND METHODS OF USING THEM

InvivoSciences, Inc., Ma...

1. An engineered cardiac tissue comprising human cardiomyocyte cells comprising a transgene encoding a protein that results in resistance to a pharmacologic inhibitor wherein said transgene is operably linked to a cardiac-specific promoter, cardiac fibroblast cells and an extracellular matrix component, wherein the ratio of fibroblasts to cardiomyocytes is between 0.1:1 and 2:1, and wherein the tissue contracts coherently.
US Pat. No. 10,111,870

METHOD FOR INDUCING A SUSTAINED IMMUNE RESPONSE

1. A method for treating or preventing viral infections chosen from the group consisting of molluscum contagiosum infection, HTLV infection, HTLV-1 infection, hepatitis-A, HCV, HBV, HIV/AIDS infection, human papilloma virus infection, viral dysentery, flu, measles, rubella, chickenpox, mumps, polio, rabies, mononucleosis, ebola, respiratory syncytial virus, dengue fever, yellow fever, lassa fever, arena virus, bunyavirus, filovirus, flavivirus, hantavirus, rotavirus, viral meningitis, west Nile fever, arbovirus, parainfluenza, smallpox, Epstein-Barr virus, dengue hemorrhagic fever, cytomegalovirus, infant cytomegalic virus, progressive multifocal leukoencephalopathy, viral gastroenteritis, a hepatitis, meningitis, encephalitis, shingles, encephalitis, california serogroup viral, St. Louis encephalitis, rift valley fever, hand, foot, and mouth disease, hendra virus, enteroviruses, astrovirus, adenoviruses, Japanese encephalitis, lymphocytic choriomeningitis, roseola infantum, sandfly fever, SARS, warts, cat scratch disease, slap-cheek syndrome, orf, pityriasis rosea and lyssavirus in a mammal comprising administering to a patient in need thereof an immediate release pharmaceutical composition comprising between about 0.01 mg and about 10.0 mg of naltrexone or a pharmaceutically acceptable salt thereof wherein said immediate release pharmaceutical composition is to be administered alone or in combination with one or more antiviral agents.
US Pat. No. 10,113,154

METHOD FOR PRODUCING STEVIOL GLYCOSIDE

SUNTORY HOLDINGS LIMITED,...

1. A polynucleotide selected from:a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 1; and
a polynucleotide comprising a heterologous regulatory element operably linked to a polynucleotide sequence encoding a protein consisting of the amino acid sequence of SEQ ID NO: 2.
US Pat. No. 10,113,155

STEVIOL GLYCOSYLTRANSFERASE AND GENE ENCODING SAME

SUNTORY HOLDINGS LIMITED,...

1. A polynucleotide selected from:a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 1; and
a polynucleotide comprising a heterologous regulatory element operably linked to a polynucleotide sequence encoding a protein consisting of the amino acid sequence of SEQ ID NO: 2.
US Pat. No. 10,113,157

ALPHA-AMYLASE VARIANTS

1. A variant of a parent Termamyl-like alpha-amylase, comprising an alteration at one or more positions selected from the group of:W13, G48, T49, S50, Q51, A52, D53, V54, G57, G107, G108, A111, S168, M197, wherein (a) the alteration(s) are independently
(i) a deletion of the amino acid which occupies the position, or
(ii) a substitution of the amino acid which occupies the position with a different amino acid,
(b) the variant has alpha-amylase activity;
(c) each position corresponds to a position of the amino acid sequence of the parent Termamyl-like alpha-amylase having the amino acid sequence of SEQ ID NO: 4; and
(d) the variant has at least 90% sequence identity with the amino acid sequence of SEQ ID NO: 41 or 42.
US Pat. No. 10,111,621

DISPOSABLE PRINTED CONDUCTIVE LEAD ELEMENTS FOR MEDICAL APPLICATIONS

Nikohed USA Inc., Hatbor...

1. A conductive lead for connecting a medical sensor to a machine, said conductive lead comprising:a dielectric flexible substrate extending a first length between a first end and a second end;
a first contact pad printed on said dielectric flexible substrate proximate said first end;
a second contact pad printed on said dielectric flexible substrate proximate said second end;
a connection line that extends said first length to create a single electrical pathway from said first contact pad to said second contact pad, wherein said first contact pad, said second contact pad and said connection line are all printed from a common conductive ink;
peel-away protective covers that cover said first contact pad and said second contact pad; and
an insulation layer applied over said peel-way protective covers and said connection line, wherein said peel-way protective covers and said connection line are interposed between said flexible substrate and said insulation layer, wherein said first contact pad and said second contact pad can be exposed by removal of said peel-away protective covers.
US Pat. No. 10,113,161

MUTANT GLUTAMATE-CYSTEINE LIGASE AND METHOD FOR MANUFACTURING GAMMA GLUTAMYL-VALYL-GLYCINE

AJINOMOTO CO., INC., Tok...

1. A method for producing ?-Glu-Val and/or a salt thereof, the method comprising:contacting a mutant glutamate-cysteine ligase with Glu and Val to produce ?-Glu-Val and/or a salt thereof,
wherein the mutant glutamate-cysteine ligase comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2 wherein the amino acid residue corresponding to at least one residue selected from the group consisting of L135, Q144, Y241, N243, and Y300 of SEQ ID NO: 2 is mutated to a different amino acid in the mutant glutamate-cysteine ligase, and
wherein the mutant has ?-glutamylvaline synthetase activity.
US Pat. No. 10,113,163

ADENOSINE NUCLEOBASE EDITORS AND USES THEREOF

President and Fellows of ...

1. An adenosine deaminase comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NOs: 1, 8, 9, 371, 372, 373, 374, or 375 with the exception of one or more substitutions at positions selected from the group consisting of amino acid residues corresponding to positions 8, 17, 18, 23, 34, 36, 45, 48, 51, 56, 59, 84, 85, 94, 95, 102, 104, 106, 107, 108, 110, 118, 123, 127, 138, 142, 146, 147, 149, 151, 152, 153, 154, 155, 156, and 157 of the amino acid sequence of SEQ ID NO: 1, wherein said adenosine deaminase deaminates adenine in deoxyribonucleic acid (DNA).
US Pat. No. 10,113,165

MODULATION OF EXON RECOGNITION IN PRE-MRNA BY INTERFERING WITH THE SECONDARY RNA STRUCTURE

ACADEMISCH ZIEKENHUIS LEI...

1. A method for inducing the skipping of exon 53 of the human dystrophin pre-mRNA in a subject with Duchenne Muscular Dystrophy (DMD) or Becker Muscular Dystrophy (BMD), or a cell derived from the subject, said method comprising providing to said subject or said cell, an antisense oligonucleotide of 18 nucleotides consisting of the base sequence of the sequence CUGUUGCCUCCGGUUCUG (SEQ ID NO: 29), wherein said oligonucleotide induces exon 53 skipping in the human dystrophin pre-mRNA in the subject or a cell derived from the subject, said oligonucleotide comprising a modification selected from the group consisting of: 2?-O-methyl, 2?-O-methylphosphorothioate, a morpholine ring, a phosphorodiamidate linkage, a peptide nucleic acid and a locked nucleic acid.
US Pat. No. 10,112,910

CATALYSIS OF DIKETOPIPERAZINE SYNTHESIS

MannKind Corporation, We...

1. A method for the synthesis of N-protected 3,6-bis[4-aminoalkyl]-2,5-diketopiperazine comprising:a. a step for catalyzing a dehydrative cyclocondensation reaction of an amino acid having a free ?-amine group and a protected amine group, and
b. collecting the N-protected 3,6-bis[4-aminoalkyl]-2,5-diketopiperazine on a filter.
US Pat. No. 10,113,166

TREATMENT OF FILAGGRIN (FLG) RELATED DISEASES BY MODULATION OF FLG EXPRESSION AND ACTIVITY

CuRNA, Inc., Miami, FL (...

1. A method of upregulating a function of and/or the expression of a Filaggrin (FLG) polynucleotide in patient cells or tissues in vivo or in vitro comprising:contacting said cells or tissues with at least one single-stranded antisense oligonucleotide of 15 to 25 nucleotides in length or a siRNA oligonucleotide of 19 to 25 nucleotides in length wherein said at least one is 100% complementary with and specifically hybridizes to a 15 to 25 nucleotide region or, in the case of siRNA, to a 19 to 25 nucleotide non-overlapping sequence of SEQ ID NO: 2; thereby upregulating a function of and/or the expression of the Filaggrin (FLG) polynucleotide in patient cells or tissues in vivo or in vitro.
US Pat. No. 10,113,170

PREVENTING AND TREATING INFLAMMATORY SKIN DISEASES

TEL HASHOMER MEDICAL RESE...

1. A method of treating an inflammatory skin disease, condition or lesion in a human subject, comprising the step of administering to the subject a therapeutically effective amount of a composition comprising, as the only active ingredient, at least one sequence selected from mature miR-197 [SEQ ID NO: 8], mature miR-99a [SEQ ID NO: 17], or a combination thereof, and, optionally, at least one additional sequence selected from the group consisting of pre-miR-197 [SEQ ID NO: 9], pre-miR-99a [SEQ ID NO: 16], pre-miR-Let7c [SEQ ID NO: 12], mature miR-Let7c [SEQ ID NO: 13], pre-miR-125b-2 [SEQ ID NO: 14], mature miR-125b-2 [SEQ ID NO: 15], or any combination thereof.
US Pat. No. 10,111,889

USES OF GANAXOLONE

WISCONSIN ALUMNI RESEARCH...

1. A method of treating sleep disruptions due to absence epilepsy in a mammalian subject in need thereof, comprising administering ganaxolone to the mammalian subject in an amount of 0.2 to 2 mg/kg per dose, wherein the epilepsy is characterized by a deficit in tonic inhibition.
US Pat. No. 10,113,171

METHODS FOR IMPROVING COGNITIVE FUNCTION VIA MODULATION OF QUINONE REDUCTASE 2

Carmel-Haifa University E...

1. A method for improving cortex or hippocampus dependent cognition in an Alzheimer disease patient or a patient with senility, comprising administering intracerebrally to said patient a nucleic acid molecule that reduces gene expression level of quinone reductase 2; a vector comprising said nucleic acid molecule; or a pharmaceutical composition comprising said nucleic acid molecule or said vector and a pharmaceutically acceptable carrier, wherein said quinone reductase 2 is a human quinone reductase 2 encoded by a nucleic acid sequence identified as SEQ ID NO:1.
US Pat. No. 10,113,172

NUCLEIC ACID APTAMERS

University of Iowa Resear...

1. A nucleic acid molecule not more than 90 nucleotides in length comprising an aptamer, wherein the aptamer is aptamer-1 (SEQ ID NO:2322), aptamer-35 (SEQ ID NO:2356), aptamer-41 (SEQ ID NO:2362) or aptamer-51 (SEQ ID NO:2372).
US Pat. No. 10,112,150

POROUS GRAPHENE BASED COMPOSITE MEMBRANES FOR NANOFILTRATION, DESALINATION, AND PERVAPORATION

The Research Foundation f...

1. An article comprising:a nanofibrous scaffold;
at least a first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof on at least a portion of a surface of the nanofibrous scaffold;
an additive selected from the group consisting of cross-linking agents and particles on an outer surface of the at least first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof; and
at least a second layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof on at least a portion of the surface of the first layer of nanoporous graphene, nanoporous graphene oxide, or combinations thereof, such that the additive is between the first and second layers of nanoporous graphene, nanoporous graphene oxide, or combinations thereof.
US Pat. No. 10,113,176

ISOLATED POLYNUCLEOTIDES AND POLYPEPTIDES, AND METHODS OF USING SAME FOR INCREASING NITROGEN USE EFFICIENCY, YIELD, GROWTH RATE, VIGOR, BIOMASS, OIL CONTENT, AND/OR ABIOTIC STRESS TOLERANCE

Evogene Ltd., Rehovot (I...

1. A method of increasing nitrogen use efficiency, yield, biomass, growth rate, and/or abiotic stress tolerance of a plant as compared to a wild type plant of the same species which is grown under the same growth conditions, comprising expressing within the plant an exogenous polynucleotide comprising a nucleic acid sequence encoding the polypeptide set forth by SEQ ID NO: 672, thereby increasing the nitrogen use efficiency, yield, biomass, growth rate, and/or abiotic stress tolerance of the plant as compared to the wild type plant of the same species which is grown under the same growth conditions.
US Pat. No. 10,111,895

ANDROGEN EFFECTORS

Suzanne J. Paxton-Pierson...

1. A novel androgen effector method for treating diseases, these diseases selected from the list consisting of low androgenicity, low ergogenisis, male andropause, male climacteric, low anabolism, low metabolism, low catabolism, low libido in males, low muscle tone, low muscle development, erectile dysfunction, low facial hair, low libido in females and female menopause, the method consisting essentially of administering to a human or mammal subject in need thereof, a therapeutic composition or formulation consisting essentially of a therapeutically effective amount of the testosterone mimetic androgen receptor agonist protogracillin as an active principle, plus one or more excipients, said formulation optionally being combined with one or more agents selected from the list consisting of alpha-linolenic acid, alpha terpineol, 5-alpha reductase inhibitors, androstenedione, Angelica Tenuissima, arachidonic acid, artocarpin, beta-sitosterol, biochanin-A, boron, Castanea sativa, Cichorium intybus, coconut medium chain fatty acids, Cyperus rotundus, daidzein, dehydroepiandrosterone, dioscin, Dioscorea collettii, Dioscorea deltoidea, Dioscorea pseudojaponica, Dioscorea septemloba, Dioscorea zingiberensis, dutasteride, epicatechin, epigallocatechin, escins, estrogens, fenugreek, finasteride, flutamide, gamma linolenic acid (GLA), genistein, glabradin, glabrene, gracillin, icariin, leucoanthocyanidin, licochalcone A, linoleic acid, licorice, myristoleic acid, Nelumbo nucifera, octacosanol, oleic acid, Paeonia suffruticosa, palm fruit kernel, palmitic acid, palmitoleic acid, Panax japonicas, papaverine, Paris polyphylla, perennisosides, Perilla sikokiana, PDE5 inhibitors, phentolamine, phenoxybenzamine, phytosterols, Primula root, progesterone, prostaglandin E2, protodioscin, pumpkin seed extract, Pygium africanum, Quaiilla bark, Saponaria officinalis, S. Flavescens, secoisolariciresinol, Senega root, Serenoa repens, sildenafil, solasodine, stearic acid, testosterone, testosterone receptor agonists, unsaturated fatty acids vasoactive intestinal polypeptide or VIP, and Yucca via an effective dosage form in a pharmaceutically acceptable vehicle; wherein protogracillin is a direct androgen mimetic, xenoandrogen, or agonist of androgen receptor to provide androgenic effect, and whereby androgen receptor stimulation is increased by protogracillin.
US Pat. No. 10,113,177

YIELD IMPROVEMENT IN PLANTS

Koch Biological Solutions...

1. A transgenic plant having greater photosynthetic resource use efficiency than a control plant;wherein the transgenic plant comprises an exogenous recombinant polynucleotide comprising a photosynthetic tissue-enhanced promoter which is operably linked to a nucleic acid sequence that encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 2;
wherein the promoter regulates expression of the polypeptide in a photosynthetic tissue to a level that is effective in conferring greater photosynthetic resource use efficiency in the transgenic plant relative to the control plant;
wherein the control plant does not comprise the recombinant polynucleotide; wherein the promoter does not regulate protein expression in a constitutive manner; and wherein expression of the polypeptide under the regulatory control of the promoter confers greater photosynthetic resource use efficiency in the transgenic plant relative to the control plant.
US Pat. No. 10,111,896

COMPOSITION COMPRISING A COMBINATION OF DNA METHYLATION INHIBITOR AND A VITAMIN D RECEPTOR AGONIST FOR THE TREATMENT OF DRUG RESISTANT CANCER OR FOR THE PREVENTION OF TUMOR RELAPSE

Institut National de la S...

1. A method of restoring or enhancing sensitivity to a chemotherapeutic agent in a patient suffering from hematopoietic malignancy, comprising simultaneously or sequentially administering to the patient a combination of:i. a DNA methylation inhibitor; and
ii. inecalcitol in an amount sufficient to restore or enhance sensitivity to the chemotherapeutic agent,
wherein said hematopoietic malignancy is acute myeloid leukemia,
wherein said acute myeloid leukemia is AML with normal karyotype with mutations in a gene selected from the group consisting of: FLT3, NPM1, KIT, CEBPA and MLL,
wherein said acute myeloid leukemia expresses mutated FLT3-ITD.
US Pat. No. 10,113,178

TRANSGENIC MAIZE EVENT MON 87419 AND METHODS OF USE THEREOF

Monsanto Technology LLC, ...

1. A recombinant DNA molecule comprising a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO:10.
US Pat. No. 10,112,923

1,2,4-TRIAZINE-4-AMINE DERIVATIVES

Heptares Therapeutics Lim...

1. A method of treatment of cancer, comprising administering an effective amount of 6-(2-chloro-6-methylpyridin-4-yl)-5-(4-fluorophenyl)-1,2,4-triazin-3-amine, or a pharmaceutically acceptable salt or solvate, to a patient in need of such treatment, wherein the cancer is selected from the group consisting of prostate cancer, rectal cancer, renal cancer, ovarian cancer, endometrial cancer, thyroid cancer, pancreatic cancer, breast cancer, colon cancer, bladder cancer, brain cancer, glia cancer, melanoma cancer, pineal gland cancer, and lung cancer.
US Pat. No. 10,113,179

COMPOSITIONS AND METHODS FOR MODIFYING GENOMES

BENSON HILL BIOSYSTEMS, I...

1. A method of modifying a nucleotide sequence at a target site in the genome of a eukaryotic cell, said method comprising:introducing into said eukaryotic cell
(i) a DNA-targeting RNA, or a DNA polynucleotide encoding a DNA-targeting RNA, wherein the DNA-targeting RNA comprises: (a) a first segment comprising a nucleotide sequence that is complementary to a targeted sequence in the genome of said eukaryotic cell; and (b) a second segment that interacts with a Cpf1 polypeptide; and
(ii) a Cpf1 polypeptide, or a polynucleotide encoding a Cpf1 polypeptide, wherein the Cpf1 polypeptide comprises: (a) an RNA-binding portion that interacts with the DNA-targeting RNA; and (b) an activity portion that exhibits site-directed enzymatic activity,wherein said Cpf1 polypeptide has at least 95% identity with a sequence selected from the group consisting of: SEQ ID NOs: 125, 133, 138, 142, 143, and 173, and has Cpf1 nuclease activity, wherein said method modifies said nucleotide sequence at said target site, wherein said targeted sequence is located immediately 3? of a PAM site in the genome of said eukaryotic cell, wherein said Cpf1 polypeptide recognizes a TTTC PAM site, and wherein said genome of a eukaryotic cell is a nuclear, plastid, or mitochondrial genome.
US Pat. No. 10,111,898

ANTI-TUMOR COMPOSITIONS AND METHODS

PeptiMed, Inc., Madison,...

1. A composition for targeting tumor cells and inhibiting tumor growth by activating a subject's innate immune response, the composition comprising:an isolated double stranded oligonucleotide comprising a strand comprising the nucleic sequence of SEQ ID NO: 1 and a strand comprising the nucleic sequence of SEQ ID NO: 2;
a tumor cell-targeting moiety; and
a pharmaceutically acceptable salt thereof,
wherein said oligonucleotide activates a subject's innate immune response through activation of one or more toll-like receptors (“TLRs”).
US Pat. No. 10,112,154

POLYAMIDE-BASED WATER-TREATMENT SEPARATION MEMBRANE HAVING EXCELLENT DURABILITY, AND MANUFACTURING METHOD THEREFOR

LG CHEM, LTD., Seoul (KR...

1. A water treatment separation membrane comprising:a porous support;
a polyamide active layer formed on the porous support; and
a protective layer formed on the polyamide active layer, the protective layer comprising
polyvinyl pyrrolidone and a polymer including an amine group-containing compound, an epoxy group-containing compound and a fluoro-containing compound,
wherein a thickness of the protective layer is 0.5 nm to 1000 nm.
US Pat. No. 10,113,180

WHEAT STEM RUST RESISTANCE GENE

Commonwealth Scientific a...

1. A transgenic plant which has integrated into its genome a transgene comprising an exogenous polynucleotide encoding an Sr33 polypeptide, the polypeptide comprising an amino acid sequence which is at least 95% identical to the sequence set forth as SEQ ID NO: 1, wherein the polynucleotide is operably linked to a promoter capable of directing expression of the polynucleotide in a cell of the plant.
US Pat. No. 10,113,181

MANIPULATION OF DOMINANT MALE STERILITY

PIONEER HI-BRED INTERNATI...

1. A method of propagating wheat male sterile seeds, comprising:(a) emasculating a first wheat plant that is hemizygous for a GOF-MF (gain of function male fertility) gene which comprises a promoter operably linked to a polynucleotide encoding a male fertility polypeptide, and wherein the GOF-MF gene is linked to (1) a gene that disrupts the function and/or development of male-reproductive tissue and (2) a marker gene;
(b) pollinating the first wheat plant with pollen from a second wheat plant, wherein the second wheat plant is male fertile and comprises (1) a GOF-MF gene that when expressed in male tissue maintains fertility in said second plant, and (2) an exogenous LOF-mf (loss of function of male fertility) nucleic acid construct which comprises a promoter inverted repeat (pIR) sequence comprising at least a 20 nucleotide fragment that targets the promoter of the second plant's GOF-MF gene, wherein said GOF-MF gene is a wheat male fertility gene;
(c) harvesting seeds from the cross of part (b);
(d) selecting from among the harvested seeds of part (c) for those seeds comprising
(1) the GOF-MF gene linked to the gene that disrupts the function and/or development of male-reproductive tissue, and the marker gene; and
(2) the exogenous LOF-mf nucleic acid construct that targets the promoter of the second plant's GOF-MF gene,
wherein said seeds are hemizygous for the GOF-MF gene and the exogenous LOF-mf nucleic acid construct;
(e) planting the selected seeds of step (d) and allowing the plants grown from said seeds to self-pollinate, to produce progeny plants;
(f) screening the progeny plants produced by the selfed plants of step (e) and selecting those progeny plants homozygous for the exogenous LOF-mf nucleic acid construct;
(g) allowing the progeny plants selected in step (f) to self-pollinate to produce seeds;
(h) harvesting the seeds from step (g);
(i) planting the seeds harvested in step (h) that express the marker, and growing said seeds into plants;
(j) selecting the plants of step (i) that are
(1) hemizygous for the GOF-MF gene linked to the gene that disrupts the function and/or development of male-reproductive tissue, and the marker gene, and
(2) homozygous for the exogenous LOF-mf nucleic acid construct,
which selected plants can be used as maintainer plants to propagate a male-sterile inbred; and
(k) selecting the seeds from the plants of step (j) that do not express the marker, which seeds are homozygous for the exogenous LOF-mf nucleic acid construct, and which seeds produce male-sterile progeny.
US Pat. No. 10,111,900

?-GLUCAN METHODS AND COMPOSITIONS THAT AFFECT THE TUMOR MICROENVIRONMENT

BIOTHERA, INC., Eagan, M...

1. A method of treating a subject having cancer, the method comprising administering soluble ?(1,6)-[poly-(1,3)-D-glucopyranosyl]-poly-?(1,3)-D-glucopyranose and an anti-PD-1 antibody.
US Pat. No. 10,113,182

SUBFAMILY E SIMIAN ADENOVIRUSES A1302, A1320, A1331 AND A1337 AND USES THEREOF

THE TRUSTEES OF THE UNIVE...

1. An adenovirus having a capsid comprising a hexon protein, a penton protein, and a fiber protein, wherein said hexon protein is the hexon protein of SAdV-A1302 with the amino acids 1 to 950 of SEQ ID NO: 9, said capsid encapsidating a heterologous nucleic acid comprising a gene operably linked to expression control sequences which direct at least one of transcription, translation, and expression of said gene in a host cell.
US Pat. No. 10,116,002

PRODUCTION METHOD OF SOLID ELECTROLYTE

IDEMITSU KOSAN CO., LTD.,...

1. A method of producing a sulfide-based solid electrolyte comprising:contacting an alkali metal sulfide with a sulfur compound without pulverizing in a mixed solvent of an aromatic hydrocarbon solvent and a polar aprotic solvent, wherein:
the polar aprotic solvent is at least one of an ether solvent and a nitrile solvent, and a volume ratio of the aromatic hydrocarbon solvent to the polar aprotic solvent (aromatic hydrocarbon solvent: polar aprotic solvent) is 95:5 to 5:95.
US Pat. No. 10,111,901

BETA-GLUCAN IN COMBINATION WITH ANTI-CANCER AGENTS AFFECTING THE TUMOR MICROENVIRONMENT

BIOTHERA, INC., Eagan, M...

1. A method of treating a subject having cancer, the method comprising administering soluble ?(1,6)-[poly-(1,3)-D-glucopyranosyl]-poly-?(1,3)-D-glucopyranose and an anti-PD-L1 antibody, wherein the anti-PD-L1 antibody is a non-complement-activating antibody.
US Pat. No. 10,112,414

IMAGE RECORDING METHOD AND IMAGE RECORDED ARTICLE

Fujifilm Corporation, To...

1. An image recording method, comprising:subjecting a recording substrate to a surface treatment by irradiating an image recording surface of the recording substrate with light from excimer emission using a xenon gas, the recording substrate comprising an aggregate of non-absorbent or low absorbent fiber materials; and
applying an ink composition by an ink jet method onto the image recording surface of the recording substrate after the surface treatment,
wherein the fiber materials comprise at least one selected from the group consisting of polypropylene fibers and polyethylene fibers, and
wherein the aggregate is a non-woven fabric.
US Pat. No. 10,113,184

MICROBE TRANSFORMANT FOR WEIGHT LOSS AND LIPID REDUCTION, THE METHOD FOR CONSTRUCTING THE TRANSFORMANT, AND APPLICATION THEREOF

1. A transformant for weight loss and blood lipid reduction, wherein the transformant is obtained by replacing Lactococcus lactis (L. lactis) thyA gene with a codon-optimized human oxyntomodulin gene through homologous recombination.
US Pat. No. 10,115,490

METHOD FOR NUCLEAR WASTE STORAGE AND MONITORING

MWD-IP Holdings, LLC, Da...

1. A waste storage method, comprising:storing nuclear waste, including:
identifying a subterranean storage site location having a shale rock layer, the layer having an expected fluid overpressure in a range corresponding to greater than hydrostatic pressure to less than lithostatic pressure from overlying rock layers;
forming a storage borehole, with an end segment of the storage borehole located within the layer;
measuring the fluid pressure in the end segment of the storage borehole; and
if the measured fluid pressure in the end segment of the storage borehole is in the expected fluid overpressure range:
forming a monitoring borehole in the layer with an end segment of each of the monitoring boreholes being in a vicinity of the end segment of the storage borehole and
storing nuclear waste in the end segment of the storage borehole.
US Pat. No. 10,116,004

ELECTROLYTE FOR LITHIUM BATTERY FOR SOLID STATE DRIVE BACKUP POWER AND LITHIUM BATTERY FOR SOLID STATE DRIVE BACKUP POWER INCLUDING THE SAME

Samsung SDI Co., Ltd., Y...

1. An electrolyte for a lithium battery for solid state drive backup power, the electrolyte comprising:propylene carbonate;
ethylene carbonate;
diethyl carbonate; and
LiBF4, wherein:
the propylene carbonate is present in an amount of about 20 parts by weight to about 50 parts by weight, the ethylene carbonate is present in an amount of about 40 parts by weight to about 90 parts by weight, and the diethyl carbonate is present in an amount of about 1 part by weight to 10 parts by weight, based on 100 parts by weight of the combined propylene carbonate, ethylene carbonate, and diethylene carbonate, and
the electrolyte contains the LiBF4 in a molar concentration of about 0.8 M to about 1.2 M.
US Pat. No. 10,113,186

ALKENOL DEHYDRATASE VARIANTS

Global Bioenergies, Evry...

1. An alkenol dehydratase variant showing an improved activity in converting prenol into isoprene over the corresponding alkenol dehydratase from which it is derived, wherein the alkenol dehydratase variant is characterized in that it shows one or more substitutions, deletions and/or insertions in comparison to the corresponding sequence from which it is derived and wherein these substitutions, deletions and/or insertions occur at one or more of the positions corresponding to positions: 2, 7, 54, 55, 58, 88, 94, 105, 110, 111, 112, 113, 117, 139, 171, 177, 189, 203, 208, 231, 240, 257, 270, 291, 299, 305, 349, 350, 395 and 397 in the amino acid sequence at least 85% identical to the sequence of SEQ ID NO:1.
US Pat. No. 10,113,187

METHODS AND SYSTEMS FOR REDUCING ONE OR MORE IMPURITIES AND/OR MOISTURE FROM GRAIN OIL, AND RELATED COMPOSITIONS

Poet Research, Inc., Sio...

1. A method of making a grain oil product comprising:providing a grain material comprising:
grain oil;
grain solids; and
one or more oligosaccharides and/or one or more polysaccharides;
converting at least a portion of the one or more oligosaccharides and/or one or more polysaccharides into one or more monosaccharides;
fermenting at least a portion of the one or more monosaccharides to form a fermentation product comprising the grain oil and a biochemical;
distilling the fermentation product to remove at least a portion of the biochemical from the fermentation product and form a whole stillage composition, wherein the whole stillage comprises the grain oil, the grain solids, and water;
separating the whole stillage into cake and thin stillage;
separating the thin stillage into syrup and a first grain oil product, wherein separating the thin stillage into syrup and a first grain oil product comprises:
concentrating the thin stillage to form an intermediate composition;
centrifugally separating at least a first portion of the intermediate composition into an aqueous component and an oil emulsion component; and
de-emulsifying the oil emulsion component to form the first grain oil product
providing at least a portion of the first grain oil product into a vessel; and
injecting a gas into the first grain oil product in the vessel in a manner to form gaseous bubbles in the first grain oil product and allow the gaseous bubbles to rise through at least a portion of the first grain oil product within the vessel and form a second grain oil product.
US Pat. No. 10,116,007

LEAD-ACID BATTERY SEPARATORS, ELECTRODES, BATTERIES, AND METHODS OF MANUFACTURE AND USE THEREOF

Daramic, LLC, Charlotte,...

1. A battery separator for a lead-acid battery with enhanced lead-acid energy storage performance comprises:a coating applied to a silica based material filled, polyolefinic lead acid battery separator, the coating comprising an engineered carbon material having a surface area (BET) of from 1500 to 3000 sqm/g;
wherein the battery separator has two surfaces, one surface which faces a positive electrode of a battery and one surface which faces a negative electrode of a battery and wherein the coating is placed on the surface which faces the negative electrode of the battery.
US Pat. No. 10,111,906

SERUM FRACTION OF PLATELET-RICH FIBRIN

Lacerta Technologies Inc....

1. A pharmaceutical preparation comprising a blood-derived serum product which is an isolated serum fraction of platelet rich fibrin (PRF) said blood-derived serum product being contained in an application device for administration of the serum fraction to an individual and being obtained by a method comprising the steps of:a. separating and removing the red blood cell fraction from a venous blood sample without the addition of an anticoagulant to provide a plasma;
b. clotting said plasma spontaneously by centrifugation carried out at 1000 to 5000 g to obtain a coagel of PRF and a supernatant, wherein in said method the centrifugation is carried out for 2 to 20 minutes;
c. pressing or squeezing the coagel to obtain a fluid fraction which comprises an activated platelet releasate from the coagel, wherein said isolated serum fraction of PRF contains the fluid fraction; and
d. providing the serum fraction in a pharmaceutical preparation which is contained in an application device for administration of the serum fraction to an individual, said serum fraction comprising a platelet releasate from activated platelets,wherein said isolated serum fraction of PRF comprises a reduced content of red blood cells, platelets or fibrinogen as compared to whole blood or a reduced content of fibrin as compared to said plasma, andwherein said serum fraction of PRF is depleted in PDGF-AB, PDGF-BB and TGF beta-1 as compared to said plasma or whole blood, and has a non-inflammatory blood factor profile, and a non-differentiating but cell proliferating profile on osteoblasts.
US Pat. No. 10,113,188

COMPOSITIONS AND METHODS FOR BIOLOGICAL PRODUCTION OF FATTY ACID DERIVATIVES

Calysta, Inc., Menlo Par...

1. A alpha-proteobacterial methanotroph, comprising a heterologous nucleic acid molecule encoding a fatty acid converting enzyme, wherein the alpha-proteobacterial methanotroph comprising the heterologous nucleic acid molecule encoding the fatty acid converting enzyme is capable of converting a C1 substrate into a C8-C24 fatty aldehyde, fatty alcohol, fatty ester wax, a hydroxy fatty acid, dicarboxylic acid, or a combination thereof, and wherein the encoded fatty acid converting enzyme comprises:(a) a fatty acyl-CoA reductase capable of forming a fatty alcohol; or
(b) a fatty acyl-CoA reductase capable of forming a fatty aldehyde; or
(c) a carboxylic acid reductase; and
(d) a thioesterase; and/or
(e) an acyl-CoA synthetase.
US Pat. No. 10,111,395

MELON PLANTS WITH ENHANCED FRUIT YIELDS

1. A Cucumis melo plant or a part thereof carrying a loss of function mutation in the MELO3 C009603 gene, wherein the plant bears more than 12 fruit, said fruit being seedless.
US Pat. No. 10,111,907

METHODS OF TREATING ISCHEMIA

Fate Therapeutics, Inc., ...

1. A method of increasing stem or progenitor cell homing to an ischemic tissue or a tissue damaged by ischemia, comprising:(a) treating stem or progenitor cells ex vivo with a prostaglandin pathway agonist and a glucocorticoid; and
(b) administering a composition comprising the treated stem or progenitor cells to a subject having an ischemic tissue or a tissue damaged by ischemia.
US Pat. No. 10,111,396

SOYBEAN VARIETY 5PZCY11

PIONEER HI-BRED INTERNATI...

1. A plant or a seed of soybean variety 5PZCY11, representative seed of the variety having been deposited under ATCC Accession Number PTA-125128.
US Pat. No. 10,113,190

METHOD FOR PRODUCING L-LEUCINE, L-VALINE, L-ISOLEUCINE, ?-KETOISOVALERATE, ?-KETO-BETA-METHYLVALERATE, OR ?-KETOISOCAPROATE USING RECOMBINANT CORYNEBACTERIA THAT CONTAIN THE ILVBN OPERON WHICH CAN BE INDUCED BY PROPIONATE

Evonik Degussa GmbH, Ess...

1. A process for the production of an L-amino acid selected from the group consisting of L-leucine, L-valine and L-isoleucine or of an ?-keto acid selected from the group consisting of ?-ketoisovalerate, ?-keto-methylvalerate and ?-ketoisocaproate, said process comprising:a) fermenting microorganisms of the genus Corynebacterium, wherein:
i) said microorganisms comprise, in replicable form, a polynucleotide with operator activity, the sequence of which is at least 85% identical to the sequence of position 1 to 121 of SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:3 and to which the activator PrpR binds; and
ii) functionally downstream of the polynucleotide with operator activity, at the 3?-end, are a second polynucleotide having propionate- or 2-methylcitrate-inducible promoter activity; as well as genes ilvB and ilvN encoding for the subunits of an acetolactate synthase, and which regulates the transcription of the genes ilvBN as a function of the addition of the activator PrpR, in a medium;
b) during the fermenting of said microorganisms, there is a first phase (growth phase), which takes place without inducer, and a second phase during which propionate or 2-methylcitrate is added as an inducer, whereupon the desired L-amino acid or ?-keto acid is synthesized under conditions in which the desired L-amino acid or ?-keto acid is enriched in the medium and/or in the cells.
US Pat. No. 10,111,909

THERAPEUTICS USING ADIPOSE CELLS AND CELL SECRETIONS

Cell Ideas Pty Ltd, Gord...

1. A method of alleviating pain in a mammalian subject, the method comprising,administering to the subject a pharmaceutical composition which comprises a combination of adipose tissue-derived cell secretions and multiply-passaged adherent cells from an adipose tissue-derived cell suspension,
wherein said adipose tissue-derived cell secretions are prepared by culturing multiply-passaged adherent progeny cells from an adipose tissue-derived cell suspension and harvesting supernatant from the cell culture after about 3 or more days,
said adherent progeny cells having a fibroblast-like appearance, and
wherein said combination has been cryopreserved.
US Pat. No. 10,113,192

METHOD FOR PRODUCING FRUCTOSE

ANNIKKI GMBH, Graz (AT)

1. A method for producing D-fructose from D-glucose, comprising:a) enzymatically oxidizing D-glucose to D-glucosone in a reaction vessel, and
b) enzymatically reducing the D-glucosone to D-fructose in reaction vessel,
wherein a redox cofactor is used in step b) and the redox cofactor is recycled by a cofactor regeneration system comprising a redox enzyme
wherein both enzymatic reaction of steps a) and b) are carried out in the reaction vessel and without the D-glucosone being isolated.
US Pat. No. 10,113,193

METHOD FOR OPTIMIZING THE ASSEMBLY AND PRODUCTION OF HETERO-MULTIMERIC PROTEIN COMPLEXES

NovImmune SA, Geneva (CH...

1. A method to increase production yield of a protein complex that comprises more than one polypeptide, the method comprising:(a) providing more than one nucleic acid molecules encoding the polypeptides in the protein complex, wherein the protein complex is a multispecific antibody or a bispecific antibody;
(b) introducing the nucleic acid molecule(s) into a cell;
(c) culturing the cell under conditions that allow for the expression of polypeptides in the protein complex; and
(d) decreasing expression of at least one of the polypeptides in the protein complex by modifying transcription rate, by modifying translation rate, by modifying mRNA stability, by modifying mRNA secondary structure, or by modifying any combination of these factors,
wherein the production yield of the protein complex is increased compared to when the expression of at least one of the polypeptides is not decreased.
US Pat. No. 10,111,912

HERBAL FORMULATIONS

MONTERO GIDA SANAYI VE TI...

1. A formulation for treating or preventing a respiratory tract disease comprising effective amounts of Propolis extract, Ginseng root extract and Zingiber officinale extract, wherein:the percentage amount of the Propolis extract based on the total volume of the formulation, is between 0.02% and 30% (w/v);
the percentage amount of the Ginseng root extract based on the total volume of the formulation, is between 0.05% and 60% (w/v);
the percentage amount of the Zingiber officinale extract based on the total volume of the formulation, is less than 30% (w/v); and wherein the formulation further comprises Glycyrrhiza glabra extract.
US Pat. No. 10,111,914

COMPOSITIONS AND METHODS COMPRISING BACTERIA FOR IMPROVING BEHAVIOR IN NEURODEVELOPMENTAL DISORDERS

California Institute of T...

1. A method for improving behavioral performance in a human subject, the method comprising:identifying a human subject who is at least 20 years old, having:
anxiety, autism spectrum disorder (ASD), or schizophrenia; and
an adult gut microbiota signature, said adult gut microbiota signature comprising at least 500 different species of microbes,
as a human subject in need of improving behavioral performance; and
administering to the human subject in need of improving behavioral performance an effective amount of one or more Bacteroides bacteria, thereby improving behavioral performance in the human subject.
US Pat. No. 10,111,915

METHOD TO TREAT FATTY LIVER DISEASE USING PARABACTEROIDES GOLDSTEINII

CHANG GUNG BIOTECHNOLOGY ...

1. A method for treating fatty liver disease in a subject on a high fat diet, comprising administering a composition comprising an effective amount of Parabacteroides goldsteinii bacterium, wherein the composition is orally administered to the subject for at least eight weeks.
US Pat. No. 10,111,916

COMPOSITIONS COMPRISING BACILLUS COAGULANS SPORES AND WHEY

Ganeden Biotech, Inc., M...

1. A composition which is in powdered or granular form, comprising Bacillus coagulans spores and a component obtained from the milk of a cow, sheep or goat, wherein the component is whey, and wherein said Bacillus coagulans is GBI-30, ATCC Designation Number PTA-6086.
US Pat. No. 10,113,198

GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID ARTHRITIS, METHODS OF DETECTION AND USES THEREOF

Celera Corporation, San ...

1. A diagnostic method for identifying a human for administration of a therapeutic agent to reduce their increased risk for RF-positive rheumatoid arthritis, the method comprising:a) testing nucleic acid from said human for a polymorphism in gene PTPN22 as represented by position 101 of SEQ ID NO:36673 or its complement by contacting said nucleic acid with an oligonucleotide that specifically hybridizes to T at said position 101 of SEQ ID NO:36673 or A at said complement, wherein the nucleotide sequence of said oligonucleotide consists of a segment of at least 12 contiguous nucleotides of SEQ ID NO:36673 or its complement and includes said position 101;
b) detecting the presence of said T or said A;
c) identifying said human for administration of a therapeutic agent to reduce their increased risk for RF-positive rheumatoid arthritis due to the presence of said T or said A; and
d) administering a therapeutic agent suitable for prevention or treatment of RF-positive rheumatoid arthritis to said human.
US Pat. No. 10,111,917

METHOD FOR PREPARING PURIFIED EXTRACTS OF HARPAGOPHYTUM PROCUMBENS

NATUREX, Avignon (FR)

1. A method for preparing an extract of Harpagophytum procumbens for consumption as a food product, wherein said extract is in liquid or dry form, and wherein the extract has a harpagoside titer from 5% to 50% w/w, said method comprising:i.) preparing a crude extract of Harpagophytum procumbens by extracting roots of Harpagophytum procumbens with water and/or ethanol to provide an aqueous crude extract and plant material;
ii.) optionally filtering the plant material from the aqueous crude extract and removing the plant material from the crude aqueous extract to produce a crude filtered aqueous extract; and
iii.) purifying the crude aqueous extract or the crude filtered aqueous extract by liquid-liquid extraction using an ester organic solvent, wherein the crude aqueous extract or the crude filtered aqueous extract is extracted with the ester organic solvent, and the ester organic solvent provides an ester organic phase containing the extract of Harpagophytum procumbens.
US Pat. No. 10,112,173

ZEOLITE-BASED ADSORBENTS BASED ON ZEOLITE X WITH A LOW BINDER CONTENT AND A LOW OUTER SURFACE AREA, PROCESS FOR PREPARING THEM AND USES THEREOF

Arkema France, Colombes ...

1. An adsorbent comprising a zeolite-based phase and a non-zeolite-based phase, wherein said adsorbent:has an outer surface area of less than or equal to 30 m2·g?1,
a pore diameter distribution, determined by mercury intrusion according to standard ASTM D 4284-83 and expressed by the volume distribution dV/d log DHg, wherein DHg is the apparent pore diameter and V is the pore volume, the mode of which is between 100 nm and 250 nm, limits inclusive,
and the zeolite-based phase comprises at least one zeolite of FAU structure of X type.
US Pat. No. 10,113,199

BIOMARKERS FOR NON-HODGKIN LYMPHOMAS AND USES THEREOF

British Columbia Cancer A...

1. A method, comprising testing a sample from a human subject having B-cell non-Hodgkin lymphoma (NHL) for a mutation in Enhancer of Zeste Homolog 2 (EZH2), wherein the mutation in EZH2 is a non-synonymous substitution of Alanine (A) at position 682 (A682) of the wild-type EZH2 protein sequence and/or a non-synonymous substitution of Alanine (A) at position 692 (A692) of the wild-type EZH2 protein sequence.
US Pat. No. 10,111,918

METHOD OF PREPARING BIOLOGICALLY ACTIVE DERIVATIVES FROM CALOTROPIS GIGANTEA FLOWERS

KING SAUD UNIVERSITY, Ri...

1. A method of preparing biologically active derivatives from Calotropis gigantea flowers, comprising:obtaining Calotropis gigantea flowers;
drying the Calotropis gigantea flowers to provide dried flowers;
soaking the dried flowers in an oil to provide oil-soaked flowers; and
burning the oil-soaked flowers at a temperature of at least about 600° C., to provide flower ash, the flower ash including biologically active derivatives.
US Pat. No. 10,113,201

METHODS AND COMPOSITIONS FOR DIAGNOSIS OF GLIOBLASTOMA OR A SUBTYPE THEREOF

The Wistar Institute of A...

1. A kit consisting of ligands that quantitatively detect or identify every one of 121 target isoforms of a glioblastoma (GBM) isoform transcript signature SEQ ID Nos: 1-78 and 95-137, wherein each ligand is a nucleotide or oligonucleotide sequence that binds or hybridizes to a single said target isoform, wherein each ligand is 17 to 30 bases in length, and wherein at least one ligand is covalently joined to a detectable diagnostic label capable of generating a measurable signal; and optionally at least one assay component selected from a substrate for immobilization, a substrate for an enzymatic label, a reagent for conducting an RNA-based assay or an RT-qPCR assay, and computer software.
US Pat. No. 10,111,920

SALT-FREE MISO PRODUCTION METHOD, SALT-FREE MISO, HEPATIC FUNCTION IMPROVEMENT AGENT, AND HYPERTENSION IMPROVEMENT AGENT

MARUZEN PHARMACEUTICALS C...

1. A method of producing salt-free product of reaction of steamed soybeans with koji culture, comprising the step of fermenting steamed soybeans and koji culture under applied heat and pressure,wherein the applied heat and pressure conditions are a pressure of 50 to 80 MPa and a temperature of 50 to 60° C., and
the length of the fermenting step is one to five days.
US Pat. No. 10,112,176

SURFACE-MODIFIED SUPER ABSORBENT RESIN AND METHOD FOR PREPARING SAME

LG Chem, Ltd., (KR)

1. A surface-modified superabsorbent polymer, having a surface modified with a water-soluble polyvalent cationic salt and a polycarbonic acid-based copolymer.
US Pat. No. 10,113,202

METHOD FOR DETERMINING THE METHYLATION STATUS OF THE PROMOTER REGION OF THE TWIST1 GENE IN GENOMIC DNA FROM BLADDER CELLS

MDxHealth SA, Herstal (B...

1. A method comprising:(a) treating genomic DNA isolated from bladder cells in a urine sample with a reagent which selectively modifies unmethylated cytosine residues in DNA contained in the sample to produce detectable modified residues but which does not modify methylated cytosine residues;
(b) amplifying the treated genomic DNA with primers that bind to the promoter region of the TWIST1 gene to produce an amplicon; and
(c) detecting the amplicon to determine the methylation status of the promoter region of the TWIST1 gene;
wherein the amplicon is detected by contacting the amplicon with a probe, and:
(i) the probe comprises the nucleotide sequence of SEQ ID NO:24; or
(ii) the amplicon comprises the probe binding site for SEQ ID NO:24.
US Pat. No. 10,113,203

DIAGNOSIS KIT AND CHIP FOR BLADDER CANCER USING BLADDER CANCER SPECIFIC METHYLATION MARKER GENE

GENOMICTREE, INC., Daeje...

1. A method for detecting CpG methylation of PENK (proenkephalin gene), the method comprising the steps of:(a) isolating a genomic DNA from a clinical sample;
(b) treating the genomic DNA from step (a) with bisulfite; and
(c) determining hypermethylation of the CpG of the PENK gene in the bisulfite-treated genomic DNA from step (b) by using primer(s) to amplify a methylated CpG of the bisulfite-treated PENK gene, wherein the primer(s) for amplifying a methylated CpG of PENK comprises sequence(s) selected from the group consisting of SEQ ID NOs: 43-44, 46-185, 187-298, 300-341, 343-468, 470-579, 581-704, 706-841, 843-976, 978-1097, 1099-1210, 1212-1221.
US Pat. No. 10,113,204

METHODS AND MATERIALS FOR DETECTING VIRAL OR MICROBIAL INFECTIONS

Cascade Biosystems, Inc.,...

1. A kit for assessing a mammal for an infection, said kit comprising:(a) probe nucleic acid comprising a nucleotide sequence complementary to a sequence of a target nucleic acid present within a microorganism or virus capable of infecting said mammal, wherein at least a portion of said target nucleic acid is capable of hybridizing to at least a portion of said probe nucleic acid to form a double-stranded portion of nucleic acid comprising a restriction endonuclease cut site, wherein said probe nucleic acid comprises a restriction endonuclease, and
(b) signal expansion nucleic acid comprising an amplifying restriction endonuclease, a label, and a double-stranded portion of nucleic acid comprising a restriction endonuclease cut site of said restriction endonuclease of said probe nucleic acid.
US Pat. No. 10,111,924

DIETARY SUPPLEMENT FOR THE TREATMENT OF ACID REFLUX AND GASTRO-OESOPHAGEAL REFLUX DISEASE (GORD/GERD)

KFSU LTD, Queensland (AU...

1. A method of treating acid reflux in a human in need thereof consisting essentially of administering therapeutically effective amounts of sugarcane fiber and a component selected from the group consisting of psyllium and bran to effectively treat the acid reflux in the human in need thereof.
US Pat. No. 10,112,180

CERIA-ZIRCONIA COMPOSITE OXIDE, METHOD FOR PRODUCING THE SAME, AND CATALYST FOR PURIFYING EXHAUST GAS USING THE CERIA-ZIRCONIA COMPOSITE OXIDE

TOYOTA JIDOSHA KABUSHIKI ...

1. A ceria-zirconia composite oxide containing a composite oxide of ceria and zirconia, comprisinglanthanum, wherein
a ratio of a total content of lanthanum to a total content of cerium and zirconium in the ceria-zirconia composite oxide is 0.25 atomic % to 2.5 atomic %,
a content of lanthanum present in near-surface regions accounts for 90 atomic % or more of the total content of lanthanum, the near-surface regions being at a distance of less than 50 nm from surfaces of primary particles of the ceria-zirconia composite oxide,
a content ratio of cerium to zirconium in the ceria-zirconia composite oxide is in a range from 43:57 to 48:52 by molar ratio,
an average particle size of the primary particles of the ceria-zirconia composite oxide is 2.2 ?m to 4.5 ?m, and
an intensity ratio I(14/29) of a diffraction line at 2?=14.5° to a diffraction line at 2?=29° and an intensity ratio I(28/29) of a diffraction line at 2?=28.5° to the diffraction line at 2?=29° respectively satisfy the following conditions:
I(14/29)?0.02; and
I(28/29)?0.08,
wherein the intensity ratio I(14/29) and the intensity ratio I(28/29) are calculated from an X-ray diffraction pattern of the ceria-zirconia composite oxide, the X-ray diffraction pattern being obtained by an X-ray diffraction measurement using CuK? after heating the ceria-zirconia composite oxide under a temperature condition of 1100° C. in air for 5 hours.
US Pat. No. 10,113,206

METHODS, COMPOSITIONS, AND KITS FOR DETERMINING HUMAN IMMUNODEFICIENCY VIRUS (HIV)

Grifols Therapeutics Inc....

1. A method for amplifying an HIV-1 group M, HIV-1 group O, and HIV-2 target sequence, the method comprising:performing a single multiplex real time PCR with the HIV-1 group M, HIV-1 group O, and HIV-2 target sequences as templates, wherein performing comprises providing the PCR with forward primer and reverse primer pairs, wherein the forward primer and the reverse primer pairs consist of, respectively, the sequences as set forth in SEQ ID NO:1 and SEQ ID NO:2; SEQ ID NO:3 and SEQ ID NO:4; and SEQ ID NO:5 and SEQ ID NO:6.
US Pat. No. 10,111,925

FORMULATIONS COMPRISING PLANT EXTRACTS

MONTERO GIDA SANAYI VE TI...

1. A formulation for treating or preventing a respiratory tract disease comprising effective amounts of a Hedera helix extract, a Pelargonium sidoides extract, and a Zingiber officinale extract, wherein the percentage amount of the Hedera helix extract based on the total volume of the formulation is between 0.05% and 20% (w/v); the percentage amount of the Pelargonium sidoides extract based on the total volume of the formulation is between 0.05% and 30% (w/v); and the percentage amount of the Zingiber officinale extract based on the total volume of the formulation is between 0.05% and 30% (w/v).
US Pat. No. 10,113,207

METHODS AND COMPOSITIONS FOR TARGETED SINGLE-STRANDED CLEAVAGE AND TARGETED INTEGRATION

Sangamo Therapeutics, Inc...

1. A method of modifying a genomic sequence in a cell, the method comprising introducing a polynucleotide encoding an artificial nuclease into the cell, the artificial nuclease comprising(i) first and second cleavage domains from an endonuclease, wherein the first cleavage domain is catalytically inactive and the second cleavage domain is catalytically active; and
(ii) a DNA-binding molecule that is heterologous to the first and second cleavage domains, and further wherein the DNA-binding molecule of the nuclease binds to a target sequence in a double-stranded genome and the nuclease induces a site-specific single-stranded break at or near the target sequence in the double-stranded genome such that the genomic sequence is modified.
US Pat. No. 10,112,182

CATALYTIC ADSORBENT FOR THE CAPTURE OF ARSENIC AND THE SELECTIVE HYDRODESULFURIZATION OF GASOLINES

IFP ENERGIES NOUVELLES, ...

1. A catalytic adsorbent comprising at least cobalt and molybdenum deposited on a porous substrate in which the content of cobalt, expressed in terms of CoO oxide, is between 20 and 25% by weight relative to the total weight of said adsorbent, and the content of molybdenum, expressed in terms of MoO3 oxide, is between 3 and 30% by weight relative to the total weight of said adsorbent and in which the Co/Mo molar ratio is between 1 and 6, and wherein the cobalt and molybdenum are in part in sulfur form, the content and ratios of Co and Mo being determined before adding sulfur to put them part in sulfur form.
US Pat. No. 10,113,208

COMBINATORIAL METABOLIC ENGINEERING OF SACCHAROMYCES CEREVISIAE FOR TERMINAL ALKENE PRODUCTION

National University of Si...

1. A modified Saccharomyces cerevisiae yeast wherein the modification comprises:insertion of at least one heterologous fatty acid decarboxylase gene encoding a fatty acid decarboxylase that synthesizes terminal alkenes selected from 1-undecene, 1-tridecene, 1-pentadecene, 1-heptadecene or 1-nonadecene,
deletion of fatty acyl-Coenzyme A synthetases, FAA1 and FAA4,
overexpression of porphobilinogen deaminase, HEM3, and
triple-deletion of catalase T, CTT1, catalase A CTA1 and cytochrome c peroxidase, CCP1.
US Pat. No. 10,111,927

PSEUDOMONAS EXOTOXIN A WITH LESS IMMUNOGENIC B CELL EPITOPES

The United States of Amer...

1. A Pseudomonas exotoxin A (PE) comprising a PE amino acid sequence, wherein one or more of amino acid residues selected from the group consisting of E420, D463, Y481, L516, R563, D581, and D589 as defined by reference to SEQ ID NO: 1 are, independently, substituted, with the proviso that when the amino acid residue at position 516 is substituted with alanine, at least one of amino acid residues E420, D463, Y481, R563, D581, and D589 is substituted,wherein the PE has a further substitution of one or more amino acid residues within one or more B cell epitopes, and the further substitution of one or more amino acid residues within one or more B-cell epitopes is a substitution of independently, one or more of amino acid residues selected from the group consisting of E285, P290, R313, N314, P319, D324, E327, E331, Q332, D403, D406, R412, R427, E431, R432, R458, D461, R467, R490, R505, R513, E522, R538, E548, R551, R576, Q592, and L597 as defined by reference to SEQ ID NO: 1, and
wherein the PE optionally has (i) a further substitution of one or more amino acid residues within one or more T-cell epitopes, (ii) a deletion of one or more continuous amino acid residues of residues 1-273 and 285-394 as defined by SEQ ID NO: 1, or (iii) a combination of (i) and (ii).
US Pat. No. 10,111,928

PULSED INTRODUCTION OF LOW-DOSE RANKL AS A THERAPY FOR OSTEOGENESIS IMPERFECTA

Saint Louis University, ...

1. A method for treating osteogenesis imperfecta in a patient, the method comprising:providing said patient a RANK agonist being of:
sufficient amount to induce osteoclasts of said patient to produce FoxP3+ CD8 T-cells (TcREG); and
insufficient amount to activate enough of said osteoclasts to create new bone loss in said patient;
repeating said providing according to a fixed schedule so as to provide said RANK agonist to said patient at pulsed intervals, said patient having as a result of said fixed schedule increased bone mass compared to a patient not on said fixed schedule.
US Pat. No. 10,112,184

ALUMINOSILICATE AEI ZEOLITE PREPARATION

Johnson Matthey Public Li...

andb. reacting the reaction mixture at an elevated temperature for a period of time sufficient to form zeolite crystals having an AEI framework and a silica-to-alumina ratio (SAR) of about 10 to about 30, wherein the reacting step, prior to removal of SDAs from the zeolite crystals, has a relative yield based on the weight of the AEI to the weight of the reaction mixture of ?about 5%.
US Pat. No. 10,111,929

GROWTH HORMONE RELEASING FACTOR ANALOGS AND USES

EZ IP, LLC, Castle Rock,...

1. A growth hormone releasing factor (GHRF) analog comprising a sequence of Xaa1-D-2-Nal-Trp-His-Trp-D-Phe-Xaa2, wherein Xaa1 is an amino acid residue selected from D-Ala, D-Val and Gly and Xaa2 is an amino acid residue selected from Lys and Arg, or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,112,185

CATALYST AND MANUFACTURING METHOD OF CATALYST

HYUNDAI MOTOR COMPANY, S...

1. A catalyst manufacturing method comprising:preparing UZM-35 zeolite;
manufacturing ion-containing UZM-35 zeolite by exchanging ions in the UZM-35 zeolite; and
manufacturing metal-containing UZM-35 zeolite by exchanging copper (Cu) ions or iron (Fe) ions in the ion-containing UZM-35 zeolite.
US Pat. No. 10,111,930

TREATMENT OF SHORT BOWEL SYNDROME PATIENTS WITH COLON-IN-CONTINUITY

Shire-NPS Pharmaceuticals...

1. A method for treating an adult human patient with short bowel syndrome who is dependent on parenteral nutrition and who presents with colon-in-continuity with remnant small intestine, said method comprising administering to the patient [Gly2]hGLP-2 using a dosing regimen effective to reduce the dependency on parenteral nutrition by the patient.
US Pat. No. 10,111,931

TREATMENT OF SHORT BOWEL SYNDROME PATIENTS WITH COLON-IN-CONTINUITY

Shire-NPS Pharmaceuticals...

1. A method of treating an adult human patient having short bowel syndrome with at least 25% colon-in-continuity with remnant small intestine and who receives an amount of parenteral nutrition each week, said method comprising administering [Gly2]hGLP-2 to said patient using a dosing regimen effective to reduce or eliminate said weekly amount of parenteral nutrition received by said patient.
US Pat. No. 10,113,213

PROCESSING AND APPLICATION OF A PURIFICATION SYSTEM FOR A NEW ALTERNATIVE SOURCE OF ENERGY

University of Bisha, Bis...

1. A method of producing at least one metal from a gold ore and oil and/or ethanol from algae, the method comprising:(a) treating a first salt water stream having a first salt concentration X,
wherein the treating is carried out with at least one of electrodialysis reversal, reverse osmosis, and mechanical vapor compression in a first water purification system to form: (i) a first purified water stream having a second salt concentration Y lower than X, and (ii) a first saline water stream having a third salt concentration Z higher than X,
(b) treating the gold ore with the first purified water stream to separate gold from the gold ore and form a waste water comprising metal ions in a gold mining production system,
(c) treating the first saline water stream in a second water purification system connected to the first water purification system to form a second saline water stream and a second purified water stream,
wherein the second purified water stream has a fourth salt concentration A lower than Z, and the second saline water stream has a fifth salt concentration B higher than Z,
(d) feeding the second saline water stream to a bioreactor containing algae to form a first algae biomass in the saline water of the second saline water stream,
(e) feeding the first algae biomass to an algae growth and harvesting chamber to grow the first algae biomass and form a concentrated algae biomass,
(f) feeding the concentrated algae biomass to a waste water processing unit,
wherein the concentrated algae biomass forms a first algae mat in the waste water processing unit, wherein the first algae mat comprises 10-200 layers of algae and each layer of algae has a length and/or a width of 50-500 cm and a depth of 0.5-50 cm,
(g) feeding the waste water comprising the metal ions from the gold mining production system to the waste water processing unit,
wherein the first algae mat in the waste water processing unit filters the waste water to form (i) a third purified water stream and (ii) the first algae mat bound to the metal ions,
(h) removing the first algae mat bound to the metal ions from the waste water processing unit,
(i) extracting the metal ions bound to the first algae mat to produce the at least one metal, and
(j) extracting oil and/or ethanol from the first algae mat.
US Pat. No. 10,111,932

COAGONISTS OF GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AND NEUROPEPTIDE Y2 RECEPTOR

Syracuse University, Syr...

1. A composition for simultaneously treating obesity and insulin deficiency, comprising a peptide sequence selected from the group consisting of HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3), HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4), IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2 (SEQ ID NO: 15), HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2 (SEQ ID NO: 16), and HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY (SEQ ID NO: 17).
US Pat. No. 10,115,520

SYSTEMS AND METHOD FOR WIRELESS POWER TRANSFER

Mojo Mobility, Inc., San...

1. A base unit for wireless power transfer through a magnetic field, comprising:one or more components including a magnetic material or layer, that modify the magnitude and/or phase of the magnetic field and/or guide a corresponding magnetic flux generated by one or more coils in the base unit in one or multiple dimensions and/or to guide the magnetic flux in such a manner as to create a preferential path for returning flux flow in one or multiple dimensions,
wherein, when one or more power receivers each having one or more receiver coils or receivers associated therewith, is placed in proximity to a base unit, the one or more coils in the base unit are used to inductively generate a current in the one or more receiver coils or receivers associated with the one or more power receivers, and
further wherein the base unit and the one or more power receivers have a coupling coefficient therebetween of less than 0.5.
US Pat. No. 10,111,933

USE OF GROWTH HORMONE FRAGMENTS

METABOLIC PHARMACEUTICALS...

1. A method for treating osteoarthritis in a subject suffering from osteoarthritis, comprising administering to the subject in need of such treatment an effective amount of a peptide that is up to 50 amino acid residues in length and comprises amino acid residues 182-189 of human growth hormone or the corresponding region from any one of SEQ ID Nos: 1-41, which peptide does not include the domain of growth hormone responsible for IGF-1 production.
US Pat. No. 10,112,189

TRANS-METALLATED MOF CATALYST

King Fahd University of P...

1. A transmetallated metal organic framework catalyst, comprising:zinc (II) ions;
second metal ions selected from the group consisting of cobalt (II) ions, iron (II) ions, copper (II) ions and mixtures thereof; and
benzene-1,3,5-tricarboxylic acid ligands;
wherein the benzene-1,3,5-tricarboxylic acid ligands comprise carboxylate groups, each carboxylate group forming a coordinative bond to the zinc (II) ions or the second metal ions to form a coordination network in the form of porous polyhedral crystals that are isostructural to an HKUST-1 metal organic framework,
wherein the metal organic framework catalyst does not comprise a coordinated solvent and a ratio of the Zn (II) ions to the second metal ions is in the range of 1.0 to 3.0.
US Pat. No. 10,111,422

COMPOSITION AND METHOD FOR RETENTION OF SOLVATED COMPOUNDS AND IONS

ECO VERDE TECHNOLOGIES, I...

1. A method of controlled release of one or more compounds, the method comprisinga. forming a controlled release composition by reacting a reactive composition comprising
i. an ether adduct having the structure X—O—Y, wherein X is the residue of a polyhydroxylated aromatic compound free of methylol moieties, O is oxygen, and Y is a group comprising from about 10 to 1000 ethylene oxide and propylene oxide repeat units arranged in a block conformation; and
ii. a phenolic aldehyde prepolymer, an aldehyde, or a combination thereof;
b. curing the reactive composition to form a cured composition;
c. loading the composition with one or more compounds, and
d. placing the loaded composition in a release environment.
US Pat. No. 10,111,934

IGF-1 PROTEINS AND THERAPEUTIC USES THEREOF

THE TRUSTEES OF THE UNIVE...

1. A pharmaceutical composition comprising a pharmaceutically acceptable carrier and a mutant pro-IGF-I protein, wherein the mutant pro-IGF-I protein comprises an amino acid sequence set forth in SEQ ID NO: 5, wherein the amino acid sequence comprises a combination of mutation K68G, a mutation at amino acid residue R71, and a mutation at amino acid residue R77.
US Pat. No. 10,111,423

MICROBIAL PESTICIDE COMPOSITION OF DRIED BACILLUS

SDS BIOTECH K.K., Tokyo ...

1. A microbial pesticide composition, comprising: a bacterial cell dried product of a Bacillus sp. bacterium; and calcium chloride and/or magnesium sulfate, wherein the content of calcium chloride and/or magnesium sulfate in said composition is from 1 mass % to 5 mass %.
US Pat. No. 10,111,935

AGENT FOR CAPTURING TUMOR CELLS AND METHODS OF USE THEREOF

1. A method of manufacturing an agent for modulating metastatic tumor cell dissemination, the method comprising the steps of:preparing a suspended solution of a cryogenically ground ECM protein;
coating a polycarbonate polyurethane matrix by saturation within the solution of the cryogenically-ground ECM protein; and
drying the ECM protein within the polycarbonate polyurethane matrix to form the agent for modulating metastatic tumor cell dissemination.
US Pat. No. 10,113,218

CAST AL—SI—MG-BASED ALUMINUM ALLOY HAVING EXCELLENT SPECIFIC RIGIDITY, STRENGTH AND DUCTILITY, AND CAST MEMBER AND AUTOMOBILE ROAD WHEEL MADE THEREOF

HITACHI METALS, LTD., Mi...

1. A casting Al—Si—Mg-based aluminum alloy comprising by mass 12.0-14.0% of Si, 1.5-4.0% of Mg, 0.10% or less of Mn, and 0.10% or less of Cu, the balance being Al and inevitable impurities, and having excellent specific rigidity, strength and ductility.
US Pat. No. 10,111,937

METHOD OF REDUCING ACCUMULATION OF INTRACELLULAR TINGIBLE BODY MACROPHAGES

THE REGENTS OF THE UNIVER...

1. A method of reducing accumulation of intracellular tingible body macrophages comprising:contacting a macrophage having an accumulation of tingible bodies with a human lysosomal phospholipase A2 (LPLA2) derivative having LPLA2 enzymatic activity in an amount effective to reduce the accumulation of tingible body macrophages, wherein the derivative is selected from the group consisting of a LPLA2 of SEQ ID NO:1 comprising one or more mannose residues, a LPLA2 of SEQ ID NO:1 comprising one or more mannose 6-phosphate residues, a fragment of a LPLA2 of SEQ ID NO:1 comprising a length of 50-275 residues with the catalytic active site corresponding to amino acids 196-200 of SEQ ID NO:1, a fragment of a LPLA2 of SEQ ID NO:1 comprising a length of 50-275 residues with amino acid residues Cys65 and Cys89 of SEQ ID NO:1, a LPLA2 of SEQ ID NO:1 with polyethylene glycol, a LPLA2 of SEQ ID NO:1 with polylysine, a LPLA2 of SEQ ID NO:1 with a lipid, a LPLA2 of SEQ ID NO:1 with a steroid, a LPLA2 of SEQ ID NO:1 with a carbohydrate, a LPLA2 of SEQ ID NO:1 with an oligonucleotide and a LPLA2 of SEQ ID NO:1 with an antibody Fc domain.
US Pat. No. 10,112,963

SUBSTITUTED BISPHENYL BUTANOIC PHOSPHONIC ACID DERIVATIVES AS NEP INHIBITORS

Novartis AG, Basel (CH)

1. A compound selected from the group consisting of:(3-(((R)-1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-((S)-1-(((cyclohexyloxy)carbonyl)oxy)ethoxy)-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid;
(3-(((2R)-1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-(1-(((cyclohexyloxy)carbonyl)oxy)ethoxy)-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid; and
(R)-(3-((1-(5?-chloro-2?-fluoro-[1,1?-biphenyl]-4-yl)-4-ethoxy-4-oxobutan-2-yl)amino)-3-oxopropyl)phosphonic acid; or a pharmaceutically acceptable salt thereof.
US Pat. No. 10,113,219

NANO-PEARLITE RAIL AND PROCESS FOR MANUFACTURING SAME

Yanshan University, Qinh...

1. A nano-pearlite rail, which is a steel rail having an internal microstructure of 100% pearlite with an average interlamellar spacing of pearlite of 55-70 nm, and containing 0.83 to 0.93 of C, 0.05 to 0.10 of Mn, a certain content of Al and Si, 1.0 to 1.5 of Cr, 0.1 to 0.3 of Co, 0.35 to 0.55 of Zr, 0.02 to 0.06 of Mg, 0.01 to 0.05 of Cu, less than 0.025 of S, less than 0.025 of P, and reminder of Fe, wherein the content of Al is 8 to 12 times the content of Mn and the collective content of Al and Si is 1, wherein all the amounts are expressed in wt. %.
US Pat. No. 10,111,426

BIOCIDAL MATERIALS

SALVECO, Saint Die des V...

1. A biocidal composition comprising:a chelating agent, in an amount of 0.05-0.2 wt % of said composition, wherein said chelating agent is selected from the group consisting of succinic acid and sorbic acid;
a nonionic surfactant, in an amount of 0.03-0.12 wt % of said composition, wherein said nonionic surfactant contains a carbon-based chain of between 6 and 20 carbon atoms and is selected from the group consisting of alkyl polyglycoside, polyglycerol ester and sorbitan ester;
an anionic surfactant, in an amount of 0.02-0.08 wt % of said composition, wherein said anionic surfactant contains a carbon-based chain of between 6 and 20 carbon atoms and is an alkali or alkaline earth-metal carboxylic salt selected from a group consisting of alkyl polyethoxylates, propoxylates, polyols of polyglycoside, polyols of polyglycerol combined with a chemical so as to form alkyl carboxylate surfactants or alkyl sulfate surfactants;
lactic acid, in an amount of 0.025-0.1 wt % of said composition;
citric acid, in an amount of 0.025-0.1 wt % of said composition;
a natural fragrance, in an amount of 0.001-0.004 wt % of said composition, wherein the natural fragrance is selected from the group consisting of essential oils, plant essences and plant extracts; and
water, in an amount of 99.00 to 99.75 wt % of said composition;
wherein said composition has bactericidal activity after at least five minutes of contact at 20 degrees Celsius on a surface to which said composition is applied.
US Pat. No. 10,111,940

PROSTATE CANCER VACCINE

Wisconsin Alumni Research...

1. A method for inducing an immune reaction to androgen receptor in a mammal having prostate cancer, comprising administering to the mammal an effective amount of a polypeptide selected from the group consisting of (i) a mammalian androgen receptor (e.g., a human androgen receptor), (ii) a fragment of the androgen receptor that comprises the ligand-binding domain, (iii) a fragment of the ligand-binding domain defined by SEQ ID NO:9, (iv) a fragment of the ligand-binding domain defined by SEQ ID NO:10, (v) a fragment of the ligand-binding domain defined by SEQ ID NO:11, and (vi) a fragment of the ligand-binding domain defined by SEQ ID NO:12, whereby the mammal develops immune reaction against androgen receptor.
US Pat. No. 10,111,941

METHOD FOR TREATING STAGE IV MELANOMA

1. A method of treating Stage IV melanoma in a subject, the method includingadministering to the subject a composition lacking an adjuvant or carrier, the composition comprising a therapeutically effective amount of an allogeneic melanoma cell lysate and/or immunotherapeutic extract thereof, wherein the composition is administered in the absence of an adjuvant or carrier.
US Pat. No. 10,111,942

TARGETS OF ACINETOBACTER BAUMANNII

1. An immunogenic composition comprising:an isolated polypeptide encoded by a recombinant nucleic acid molecule comprising a polynucleotide having the nucleic acid sequence of:
SEQ ID NO: 3; and,
an immuno-effective amount of an adjuvant;
wherein the composition is effective in generating an immune response against Acinetobacter baumannii in a subject in need thereof.
US Pat. No. 10,111,431

APPLICATION OF BIOFILM FORMATION INHIBITING COMPOUNDS ENHANCES CONTROL OF CITRUS CANKER

University of Florida Res...

1. A method of reducing population of microbe on an object, the method comprising: applying to the object a biofilm reducing agent, or a metal antimicrobial agent and a biofilm reducing agent, in amount and for time sufficient to reduce the microbial population, wherein the microbial population comprises Xanthomonas citri subsp. citri and the biofilm reducing agent comprises D-leucine, D-Serine, or 3-idolylacetonitrile.
US Pat. No. 10,111,687

METHODS AND DEVICES FOR CONDUIT OCCLUSION

FEMASYS, INC., Suwanee, ...

1. A method for occluding at least one fallopian tube in a mammal, comprising,a) positioning at a uterine fundus of a mammal a closed tip of an introducer shaft of a delivery device of a delivery system that delivers an effective amount of an occlusive material composition, the delivery system comprising the delivery device comprising a handle, the introducer shaft having a proximal end operatively connected to the handle and the opposed closed tip, the introducer shaft defining a catheter channel along the interior length of the introducer shaft and defining at least one catheter channel opening spaced proximally from the closed tip of the introducer shaft, wherein the catheter channel is configured for providing at least one catheter; at least one catheter having a delivery end and an end structure, wherein the at least one catheter is configured to be received therein the catheter channel of the introducer shaft; and elements for providing an occlusive material composition into and through the catheter;
wherein the closed tip of the introducer shaft is positioned at the uterine fundus by inserting the introducer shaft therethrough a cervix of the mammal until the closed tip contacts a uterine fundus of the mammal, and the at least one catheter channel opening is directed toward a uterine cornua of the mammal;
b) moving the at least one catheter therethrough the catheter channel until the delivery end of the at least one catheter exits the at least one catheter channel opening and the delivery end of the catheter is located within the uterine cornua and the end structure is at or near a tubal ostium, wherein the end structure maintains the delivery end in the uterine cornua and aids in localized delivery of the occlusive material composition; and
c) delivering an effective amount of an occlusive material composition through and out the delivery end of the catheter so that a fallopian tube is occluded, wherein the occlusive material composition comprises a material that polymerizes after delivery of the occlusive material composition.
US Pat. No. 10,111,943

ALPHAVIRUS REPLICON PARTICLES MATCHED TO PROTEIN ANTIGENS AS IMMUNOLOGICAL ADJUVANTS

ALPHAVAX, INC., Research...

1. A vaccine composition comprising (a) purified protein and (b) alphavirus replicon particles expressing said protein, wherein the protein is an influenza virus hemagglutinin protein and wherein the alphavirus is Venezuelan Equine Encephalitis (VEE) Virus.
US Pat. No. 10,111,945

CMV VACCINES

Hookipa Biotech GmbH, Vi...

1. A pharmaceutical composition comprising a first infectious, replication-deficient arenavirus viral vector engineered to contain a genome with the ability to amplify and express its genetic information in infected cells but unable to produce further infectious progeny particles in normal, not genetically engineered cells, wherein one arenavirus open reading frame is removed and replaced by a first nucleotide sequence selected from the group consisting of:a) a nucleotide sequence encoding a cytomegalovirus glycoprotein B (gB) or an antigenic fragment thereof;
b) a nucleotide sequence encoding a cytomegalovirus tegument protein pp65 or an antigenic fragment thereof;
c) a nucleotide sequence encoding a cytomegalovirus glycoprotein H (gH) or an antigenic fragment thereof;
d) a nucleotide sequence encoding a cytomegalovirus glycoprotein L (gL) or an antigenic fragment thereof;
e) a nucleotide sequence encoding a cytomegalovirus UL128 protein or an antigenic fragment thereof;
f) a nucleotide sequence encoding a cytomegalovirus UL130 protein or an antigenic fragment thereof; and
g) a nucleotide sequence encoding a cytomegalovirus UL131A protein or an antigenic fragment thereof,and a second infectious, replication-deficient arenavirus viral vector engineered to contain a genome with the ability to amplify and express its genetic information in infected cells but unable to produce further infectious progeny particles in normal, not genetically engineered cells, wherein one arenavirus open reading frame is removed and replaced by a second nucleotide sequence selected from the group consisting of:a) a nucleotide sequence encoding a cytomegalovirus glycoprotein B (gB) or an antigenic fragment thereof;
b) a nucleotide sequence encoding a cytomegalovirus tegument protein pp65 or an antigenic fragment thereof;
c) a nucleotide sequence encoding a cytomegalovirus glycoprotein H (gH) or an antigenic fragment thereof;
d) a nucleotide sequence encoding a cytomegalovirus glycoprotein L (gL) or an antigenic fragment thereof;
e) a nucleotide sequence encoding a cytomegalovirus UL128 protein or an antigenic fragment thereof;
f) a nucleotide sequence encoding a cytomegalovirus UL130 protein or an antigenic fragment thereof; and
g) a nucleotide sequence encoding a cytomegalovirus UL131A protein or an antigenic fragment thereof wherein the first and second nucleotide sequences are different.
US Pat. No. 10,112,971

PROTEIN PURIFICATION IN THE PRESENCE OF NONIONIC ORGANIC POLYMERS AND ELECTROPOSITIVE SURFACES

AGENCY FOR SCIENCE, TECHN...

1. A method of purifying an antibody from a preparation comprising:(a) providing the preparation comprising an antibody;
(b) adding allantoin to the preparation to a supersaturating concentration, wherein after adding the allantoin, the preparation is supersaturated with allantoin;
(c) removing solids from the preparation;
(d) contacting the preparation with polyethylene glycol (PEG) having a molecular weight of 2,000 to 12,000 Daltons and a salt, wherein (i) a concentration of the PEG is sufficient to precipitate the antibody or cause its accretion on a first surface, or maintain it in a precipitated state or accreted on the first surface, and (ii) the salt concentration is sufficient to produce a conductivity between 50 mS/cm and 150 mS/cm; and
(e) contacting the preparation with at least one electropositive surface whereby the antibody does not adsorb to the at least one electropositive surface, wherein the contacting does not prevent adsorption of acidic contaminants to the at least one electropositive surface.
US Pat. No. 10,111,946

POXVIRAL VECTORS FOR LOW ANTIBODY RESPONSE AFTER A FIRST PRIMING IMMUNIZATION

1. An early/late hybrid promoter comprising (a) a late element driving late expression of an antigenic determinant and (b) at least two Pr7.5 early elements (Pr7.5E) driving early expression of the antigenic determinant, wherein the late element is linked to the at least two early elements, and wherein RNA levels from the late element in a recombinant modified vaccinia Ankara (MVA) virus are at least 1.5 fold greater than RNA levels produced by the SEQ ID NO: 11 promoter in a recombinant MVA virus in HeLa cells.
US Pat. No. 10,112,972

PROCESS FOR PRODUCTION OF FIBRINOGEN AND FIBRINOGEN PRODUCED THEREBY

OCTAPHARMA AG, Lachen (C...

1. A process for purifying fibrinogen from a fibrinogen containing source, the process comprising precipitating fibrinogen with a precipitating agent from the fibrinogen containing source in the presence of one or more chelating agent(s) to form a fibrinogen paste, removing the supernatant from the fibrinogen paste, extracting fibrinogen from the fibrinogen paste in an aqueous medium void of the chelating agent(s) for a suitable extraction time thereby forming a liquid fraction containing fibrinogen and an undissolved residue, and separating the undissolved residue from the liquid fraction containing fibrinogen, whereinaddition of one or more protease inhibitor(s) is omitted in all steps of the process,
the fibrinogen is precipitated in a temperature range of from 4.1° C. to 40° C., and
the one or more protease inhibitor(s) is selected from the group consisting of C1-protease inhibitors, trypsin inhibitors, thrombin inhibitors, antithrombin-III (AT-III), heparin-cofactor-II, aprotinin, pepstatin, leupeptin and epsilon-aminocaproic acid.
US Pat. No. 10,111,436

CONTROL OF AQUATIC WEEDS WITH ENDOTHALL AND ALS-INHIBITING AGENT

SePRO Corporation, Carme...

1. A method for controlling hydrilla in a body of fresh water, comprising:providing in the body of fresh water a synergistically effective amount of a herbicidal combination including an ALS-inhibiting herbicide and endothall, so as to control the hydrilla, wherein the ALS-inhibiting herbicide is penoxsulam, imazamox, or bispyribac sodium;
wherein said providing comprises adding the endothall to the body of fresh water prior to or simultaneously with adding the ALS-inhibiting herbicide to the body of fresh water;
wherein said providing comprises providing the endothall at a level of about 0.1 to about 3.5 ppm in the body of fresh water; and
with the further proviso that:
(i) where the ALS-inhibiting herbicide is penoxsulam, the penoxsulam is applied to the body of fresh water to provide a penoxsulam level of about 2.5 to 50 ppb in the body of fresh water;
(ii) where the ALS-inhibiting herbicide is imazamox, the imazamox is applied to the body of fresh water to provide an imazamox level of about 0.02 to about 0.15 ppm in the body of fresh water; and
(iii) where the ALS-inhibiting herbicide is bispyribac sodium, the bispyribac sodium is applied to the body of fresh water to provide a bispyribac sodium level of about 0.01 to about 0.25 ppm in the body of fresh water.
US Pat. No. 10,111,948

SYNTHETIC HAPTEN CARRIER COMPOSITIONS AND METHODS

TRIA BIOSCIENCE CORP., S...

1. A peptide monomer comprising an amphipathic ?-helical peptide comprising an amino acid sequence with at least 80% identity to SEQ ID NO:1, SEQ ID NO:2, or SEQ ID NO:3.
US Pat. No. 10,111,949

COMPOSITIONS AND METHODS FOR SELF-ADJUVANTING VACCINES AGAINST MICROBES AND TUMORS

The Regents of the Univer...

1. An isolated protein comprising a multimerizing domain from the N-terminal fragment of Latent Membrane Protein 1 (LMP1) operatively joined to a cytoplasmic signaling domain of a heterologous receptor such that the protein assembles into a complex of three or more protein moieties; wherein the LMP1 multimerizing domain is translated from nucleic acids that do not contain introns.
US Pat. No. 10,111,950

MODIFIED GLYCOLIPIDS AND METHODS OF MAKING AND USING THE SAME

Vaccinex, Inc., Rocheste...

1. A method of treating a disease in a subject, comprising administering to a subject in need of said treatment a modified glycolipid/protein complex comprising:a) a CD1d protein;
b) a ?2-microglobulin physically associated with said CD1d protein; and
c) a modified ?-glycosyl ceramide;
wherein the disease is a viral disease; wherein the modified ?-glycosyl ceramide is covalently linked to the CD1d protein via activation of a benzophenone group attached to the terminus of an acyl chain of the N-acyl lipophilic moiety of the modified ?-glycosyl ceramide, wherein the modified glycolipid/protein complex enhances the activity of natural killer T (NKT) cells, and wherein the modified glycolipid/protein complex is administered in an amount sufficient to alter the progression of the disease.
US Pat. No. 10,111,439

NON-AQUEOUS, NON-OIL BACILLUS AMYLOLIQUEFACIENS COMPOSITIONS

VALENT BIOSCIENCES LLC, ...

1. A non-aqueous, non-oil liquid composition comprising live Bacillus amyloliquefaciens, a liquid carrier selected from the group consisting of a polyethylene glycol, glycerol, ethylene glycol, dipropylene glycol, propylene carbonate and mixtures thereof, a vinylpyrrolidone polymer and a nonionic block copolymer.
US Pat. No. 10,112,977

PEPTIDE FOR INDUCING MULTINUCLEATION IN CELLS, AND USE THEREFOR

Toagosei Co., Ltd., Toky...

1. An artificially synthesized peptide having a multinucleation-inducing activity for at least one type of eukaryotic cell and comprising, in the peptide chain thereof, the following amino acid sequence (A) and amino acid sequence (B):(A) an amino acid sequence that constitutes a membrane-permeable peptide sequence; and
(B) an amino acid sequence given by either CPDGAKARC (SEQ ID NO: 1) or CSRRSKSKC (SEQ ID NO: 2) constituting multinucleation-inducing peptide sequences that have a multinucleation-inducing activity for at least one type of eukaryotic cell, or a modified amino acid sequence formed by conservative substitution of one, two or three amino acid residues in the amino acid sequence and that constitutes a multinucleation-inducing peptide sequence having a multinucleation-inducing activity for at least one type of eukaryotic cell.
US Pat. No. 10,111,440

NON-AQUEOUS, NON-OIL LIVE MICROBIAL COMPOSITIONS

VALENT BIOSCIENCES LLC, ...

1. A non-aqueous, non-oil liquid composition comprising live microbial organisms, a liquid carrier selected from the group consisting of a polyethylene glycol, glycerol, ethylene glycol, dipropylene glycol, propylene carbonate and mixtures thereof, a vinylpyrrolidone polymer and a nonionic block copolymer.
US Pat. No. 10,111,952

SILICON DIOXIDE NANOPARTICLES AND THE USE THEREOF FOR VACCINATION

MERCK PATENT GmbH, Darms...

1. A method for providing an adjuvant immune response, comprising administering nanoparticles of silicon dioxide to a patient in need thereof, wherein the nanoparticles have a size of at least 5 nm up to 150 nm.
US Pat. No. 10,112,208

GLASS ARTICLES WITH NANOPARTICLE REGIONS

1. A glass article, comprising:a glass substrate having a first surface, a second surface, and an edge;
a first nanoparticle region located within the substrate comprising first nanoparticles which are completely surrounded by the substrate; and
a second nanoparticle region located adjacent at least one of the first surface and the second surface, wherein the second nanoparticle region comprises second nanoparticles, wherein at least some of the second nanoparticles are completely surrounded by the substrate.
US Pat. No. 10,112,979

INFLUENZA VACCINATION

Seqirus UK Limited, Berk...

1. A method of immunizing a patient against an influenza virus comprising steps of:(a) selecting a patient that is immunologically naïve to the influenza virus; and
(b) administering an immunological composition comprising an antigen of the influenza virus to the patient; wherein
the immunological composition is delivered to the patient's Langerhans cells by microporation using microneedles made from at least one biocompatible polymer, which open pores in the patient's stratum corneum, wherein the microneedles ranges in length from 25 ?m to 1 mm. and wherein the influenza virus antigen is in the form of an inactivated virus or a virosome or wherein the influenza virus antigen is produced by a recombinant or synthetic system that does not involve growth of influenza viruses.
US Pat. No. 10,111,954

COMBINATION THERAPY FOR INDUCING IMMUNE RESPONSE TO DISEASE

IBC Pharmaceuticals, Inc....

1. A method of treating a Trop-2+ cancer comprising:a) administering to a human subject with a Trop-2+ cancer a trivalent T-cell redirecting complex comprising a bispecific antibody, wherein the bispecific antibody comprises (i) an anti-CD3 antibody moiety conjugated to an AD (anchoring domain) moiety from an AKAP protein, wherein the amino acid sequence of the AD moiety is SEQ ID NO:4 and (ii) an anti-Trop-2 antibody moiety conjugated to a DDD (dimerization and docking domain) moiety with an amino acid sequence of residues 1-44 of human protein kinase A (PKA) regulatory subunit RII?, wherein two copies of the DDD moiety form a dimer that binds to one copy of the AD moiety to form a complex; and
b) administering to the subject a checkpoint inhibitor antibody selected from the group consisting of pembrolizumab (MK-3475), nivolumab (BMS-936558), and pidilizumab (CT-011).
US Pat. No. 10,112,980

MUTATED IMMUNOGLOBULIN-BINDING POLYPEPTIDES

1. A separation matrix, comprising a plurality of polypeptides or multimers of the polypeptides coupled to a solid support, wherein the polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 6-10, 12, 13, or a combination thereof.
US Pat. No. 10,111,443

FILLED SNACK PRODUCT WITH SPACED FILLING LINES AND METHOD OF MAKING THE SAME

Kellogg Company, Battle ...

1. A method of producing a filled snack product comprising the steps of:disposing a plurality of filling lines on a first flat surface of a first sheet, each of the plurality of filling lines being spaced to define a void between each of the adjacent filling lines;
placing the second sheet over the first sheet to sandwich the plurality of filling lines between the first and second sheets and form a laminate;
docking the laminate after the second sheet is placed over the first sheet to create a plurality of docking holes which each extend through the first and the second sheets of the laminate for the release of steam or gas during heating;
pinning the first and second sheets at the voids between the plurality of spaced filling lines to secure the first and second sheets to each other; and
heating the laminate to form the filled snack product;
wherein the plurality of docking holes and the plurality of spaced filling lines allow for pinning of the first and second sheets at the voids disposed between the plurality of spaced filling lines to minimize puffing of the filled snack product during heating.
US Pat. No. 10,114,264

DEVICE FOR REGULATING THE PASSAGE OF ENERGY

Merck Patent GmbH, Darms...

1. A device for regulating the passage of light through a light-transmitting area, said device comprising:one or more glass layers and at least one switching layer which comprises a liquid-crystalline medium comprising at least one dichroic dye,
wherein said switching layer has a bright state ?v bright and a dark state ?v dark, and
wherein said switching layer has a degree of anisotropy R of at least 0.65 and a degree of light transmission in the bright state ?v bright in accordance with Standard EN410 of 40% to 90%,
wherein said device is a component of a window,
wherein said switching layer comprises three or more different dichroic dyes, and
wherein the liquid-crystalline medium has a clearing point in the temperature range from 70° C. to 170° C.
US Pat. No. 10,111,957

INHALATION COMPOSITIONS COMPRISING GLUCOSE ANHYDROUS

Arven Ilac Snayi ve Ticar...

1. A dry powder inhalation composition comprising,at least one corticosteroid or a pharmaceutically acceptable salt thereof,
fine particle lactose in an amount of 1-20% by weight of said composition and having d50 particle size in the range of 4-10 ?m and coarse particle anhydrous glucose in an amount of 80-99% by weight of said composition and having a d50 particle size in the range of 50-120 ?m.
US Pat. No. 10,112,983

NEUREGULIN VARIANTS AND METHODS OF SCREENING AND USING THEREOF

1. A polypeptide variant of neuregulin-1 ? comprising amino acid sequence shown in SEQ ID NO:1, wherein the polypeptide variant comprises a different amino acid than that in SEQ ID NO:1, wherein the polypeptide variant has an enhanced binding affinity to ErbB3 compared to polypeptide of SEQ ID NO:1, and whereinat residue 25 said different amino acid is A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y; or
at residue 35 said different amino acid is A, C, D, E, F, G, H, I, L, N, M, P, Q, R, S, T, V, W, or Y; or
at residue 46 said different amino acid is A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, or Y.
US Pat. No. 10,114,009

METHODS OF DETECTING T1R HETERO-OLIGOMERIC TASTE RECEPTOR EXPRESSION TO IDENTIFY CELLS THAT ARE POTENTIALLY SENSITIVE TO SWEET TASTANTS

Senomyx, Inc., San Diego...

1. An in vitro method of detecting a human or monkey cell that is potentially sensitive to sweet tastants, the method comprising: (a) detecting the expression of a T1R2 polypeptide at least 90% identical to the polypeptide of SEQ ID NO: 6 and (b) further detecting expression of a T1R3 polypeptide at least 90% identical to the polypeptide of SEQ ID NO: 7; and (c) based on the results of (a) and (b), identifying a cell that expresses said T1R2 and T1R3 polypeptides (“detected cell”) which, therefore, is potentially sensitive to sweet tastants (“detected cell”).
US Pat. No. 10,111,446

FATTY ACID VINYL ESTER COPOLYMERS WITH WAX QUALITIES

Wacker Chemie AG, Munich...

1. A method for preparing fatty acid vinyl ester copolymers by free-radical initiated polymerization ofa) one or more vinyl esters of carboxylic acids having 16 to 22 carbon atoms and
b) one or more vinyl esters of carboxylic acids having 2 to 15 carbon atoms,
wherein the one or more vinyl esters a) and the one or more vinyl esters b) are metered in during the polymerization, and
during the polymerization either a metered addition rate of vinyl ester a) or a metered addition rate of vinyl ester b) is reduced and the metered addition rate of the other of the two vinyl esters a) or b) is increased.
US Pat. No. 10,111,958

ANTI-CD40 ANTIBODY FORMULATION

Novartis AG, Basel (CH)

1. An aqueous pharmaceutical composition, wherein the composition has a pH of 6.0 and comprises(i) an anti-CD40 antibody wherein the antibody has a concentration of 150 mg/ml, and wherein said anti-CD40 antibody includes heavy chain CDR1, CDR2 and CDR3 of SEQ ID NOs 3, 4 and 5 respectively, and light chain CDR1, CDR2 and CDR3 of SEQ ID NOs: 6, 7 and 8,
(ii) 270 mM sucrose as a stabiliser,
(iii) 30 mM histidine as a buffering agent, and
(iv) 0.06% polysorbate 20 as a surfactant.
US Pat. No. 10,112,984

LIGHT-SENSITIVE CHIMERIC GPCR PROTEIN

Haagstreit Medtech AG, K...

1. A chimeric G-protein-coupled-receptor (GPCR) protein comprising an N-terminal domain, a C-terminal domain, transmembrane domains, extracellular loops and intracellular loops, wherein the chimeric GPCR protein includes domains from at least two different GPCR proteins and has the domains arranged to form a GPCR protein, and wherein:(a) a first portion of the chimeric GPCR protein comprises transmembrane domains contributed by a first member of the G-protein-coupled-receptor (GPCR) superfamily, wherein said first member is a bi-stable opsin, wherein said transmembrane domains mediate light activation and comprise an amino acid residue that forms a Schiff' base with a chromophore to covalently bind the chromophore to the GPCR protein; and
(b) a second portion of the chimeric GPCR protein comprises one or more intracellular domains of mGluR6 selected from the intracellular loops IL1, IL2, IL3 and the C-terminal domain (CT), said second portion of the chimeric GPCR protein binding a Galpha(o) protein of the signaling cascade of mGluR6, wherein said one or more selected intracellular loops are present in the chimeric GPCR in corresponding numerically defined positions as in the native mGluR6 structure, and wherein the second portion comprises intracellular loop 3 (IL3) of mGluR6.
US Pat. No. 10,114,266

ELECTROACTIVE OPTICAL DEVICE

PPG Industries Ohio, Inc....

1. An electroactive optical device comprising:(a) an optical substrate having two opposing surfaces;
(b) at least two electrodes spaced one from the other and disposed on the surface of the substrate;
(c) at least one electroactive material layer in contact with the at least two electrodes (b) and the surface of the substrate (a) wherein the electroactive material layer comprises at least one electrochromic-dichroic material which is a single compound which is both electrochromic and dichroic in response to an applied voltage, and
wherein the electroactive optical device has variable light transmittance in response to the magnitude of an applied electrical voltage.
US Pat. No. 10,111,959

ANTIMICROBIAL GELS

1. An antimicrobial dressing comprising an antimicrobial gel comprising at least two polysiloxanes, wherein the antimicrobial gel is formed by creating at least one covalent bond between at least one alkenyl and/or alkynyl moiety of a first polysiloxane and at least one Si—H moiety of a second polysiloxane, the antimicrobial gel further comprises at least one hydrosilylation catalyst, at least one silver salt, and at least one hydrophilic component, wherein the at least one hydrophilic component makes the antimicrobial gel swell at least 5% (wt/wt) after 24 hours in a water solution containing 8.298 g/L of sodium chloride and 0.368 g/L of calcium chloride dihydrate, as measured by the free swell absorption method, wherein the antimicrobial gel is on a substrate, wherein the substrate comprises a foam comprising polyurethane, wherein the antimicrobial gel is characterized in having an accumulated silver release of at least 0.3% of the total silver content in the initial antimicrobial composition after 24 hours.
US Pat. No. 10,114,011

ANTIGEN PRESENTING CELL ASSAY

1. A method, comprising:(i) contacting a first portion of a biological sample comprising antigen presenting cells (APCs) obtained from a subject in need of or having received an organ transplant from a donor, with a donor antigen from the donor in vitro under conditions sufficient to induce uptake of the donor antigen;
(ii) contacting a second portion of the biological sample comprising APCs obtained from the subject in need of or having received an organ transplant with a third-party antigen in vitro under conditions sufficient to induce uptake of the third-party antigen; and
(iii) measuring amount of uptake of the donor antigen in the first portion of the biological sample and measuring amount of uptake of the third-party antigen in the second portion of the biological sample, wherein the APCs are dendritic cells or macrophages, wherein the method determines the ratio of uptake of the donor antigen in the first sample and the uptake of the third party antigen by the APCs in the second sample.
US Pat. No. 10,111,448

FEED COMPOSITIONS COMPRISING RICINODENDRON HEUDELOTII AND METHODS OF PROCESSING AND USING THEREOF

Alcorn State University, ...

1. A method of reducing fat in an animal in need thereof, the method comprising:forming an oral feed composition comprising a delivery media and at least about percent by weight of Ricinodendron heudelotii (njangsa) seeds, and
feeding the animal an effective amount of the feed composition for a suitable period of time to reduce fat in the animal,
wherein the feed composition is metabolized by the animal and the body composition of the animal is improved such that fat is reduced by about 31%; and
wherein the njangsa seeds are obtained from mature njangsa tree fruit and the seeds are extracted from the seed shells by heating the seed kernels at a temperature above about 100° C.
US Pat. No. 10,112,986

ANTI-GLUCOSAMINIDASE PASSIVE IMMUNIZATION FOR STAPHYLOCOCCUS AUREUS INFECTIONS

University of Rochester, ...

1. A method of introducing an orthopedic implant into a patient comprising:administering to a patient in need of an orthopedic implant an effective amount of an antibody or an antigen-binding portion of an antibody that binds specifically to a Staphylococcus aureus glucosaminidase and comprises the complementarity determining region sequences of the VH domain of SEQ ID NO:2 and the VL domain of SEQ ID NO:3; and
introducing the orthopedic implant into the patient.
US Pat. No. 10,114,012

METHODS AND ASSAYS FOR DETECTING AND QUANTIFYING PURE SUBPOPULATIONS OF WHITE BLOOD CELLS IN IMMUNE SYSTEM DISORDERS

THE BOARD OF TRUSTEES OF ...

1. A method for determining a subject's susceptibility to an allergic reaction, the method comprising:(a) stimulating a whole blood sample from the subject with an allergen, wherein the whole blood sample comprises a basophil cell population;
(b) labeling the whole blood sample with anti-CD203c and a differential label for phosphatase and tensin homolog (PTEN); and
(c) measuring a level of expression of CD203c and PTEN using flow cytometry and comparing the level of expression to a control sample, wherein a higher level of expression of CD203c and PTEN in the basophil cell population compared to the control sample is indicative of increased susceptibility to an allergic reaction to the allergen in the subject.
US Pat. No. 10,111,449

PRODUCTION PROCEDURE FOR A FUNCTIONAL FEED BASED IN ELLAGIC ACID, CIMENOL AND ALLIIN FROM VEGETABLE EXTRACTS TO BE USED AS PRONUTRIENT IN ANIMAL FEED

BIOVET, S.A., Cambrils (...

1. An animal food product consisting essentially of an extract of Thymus vulgaris, an extract of Punica granatum and an extract of Allium sativum, wherein the Thymus vulgaris has a p-cimenol content of 15%-17% by weight, the Allium sativum has an allin content of 20%-26% and the Punica granatum has an ellagic acid from 2%-4%, wherein said animal food product was treated with methanolic hydrochloric acid and wherein said product has an inductor effect on the reproduction rate of RNA-protein in swine intestinal cells.
US Pat. No. 10,111,961

SELF-ASSOCIATING MICROPARTICLES AND NANOPARTICLES CONSISTING OF PROTEINS

CENTRE NATIONAL DE LA REC...

1. An inclusion complex formed by the interaction betweenat least one protein selected from the group consisting of elastin, collagen, gliadin, gelatin, keratin, legumin, vicilin, casein, fibrinonectin and fibrillin, said protein substituted by hydrophobic groups covalently bound to said protein, and
at least one ?-cyclodextrin (CD) in the form of a monomer,the protein and the cyclodextrin being non-covalently bound, wherein the hydrophobic groups by which said protein is substituted are alkyl groups, linear or branched.
US Pat. No. 10,112,987

BLOOD-BRAIN BARRIER PERMEABLE PEPTIDE COMPOSITIONS COMPRISING A VAB DOMAIN OF A CAMELID SINGLE DOMAIN HEAVY CHAIN ANTIBODY AGAINST AN AMYLOID-BETA PEPTIDE

ICB INTERNATIONAL, INC., ...

1. A composition comprising:a polypeptide comprising the formula Vab1-L1-X-R3-Y-L2-Vab2,
wherein the Vab1 and Vab2 each independently comprises a variable antigen-binding domain from a camelid single-domain heavy chain antibody, wherein at least one of the variable antigen-binding domains comprises amino acids 1-127 of the amino acid sequence of SEQ ID NO:11 and is capable of binding to an amyloid-beta peptide;
wherein L1 and L2 each comprise a hinge region from a camelid single-domain heavy-chain only antibody;
wherein a nanoparticle comprising polybutylcyanoacrylate and dextran is covalently linked to at least one of L1 and L2; and
wherein X and Y are bifunctional linkers, selected from a maleimido-thiol conjugate and polyethylene glycol;
wherein R3 comprises at least one constant domain of human IgG CH2 or CH3 domain.
US Pat. No. 10,114,013

METHOD FOR DETECTION OF COENZYME Q10

Berg, LLC, Framingham, M...

1. A method for determining the amount of coenzyme Q10 (CoQ10) or reduced form of coenzyme Q10 (CoQ10H2) in a sample, the method comprising analyzing the sample using LC/MS/MS using oxidized deuterated coenzyme Q10 (CoQ10-d6) and/or reduced deuterated coenzyme Q10 (CoQ10H2-d6) as an internal standard, wherein the method comprises the steps of:a1) adding a known amount of deuterated coenzyme Q10 (CoQ10-d6) to the sample,
b1) detecting CoQ10 and CoQ10-d6 by mass spectrometry, and
c1) determining the amount of detected CoQ10 by comparing it to the known amount of detected CoQ10-d6; or
a2) adding a known amount of reduced deuterated coenzyme Q10 (CoQ10H2-d6) to the sample,
b2) detecting CoQ10H2 and CoQ10H2-d6 by mass spectrometry, and
c2) determining the amount of detected CoQ10H2 by comparing it to the known amount of detected CoQ10H2-d6; or
a3) adding a known amount of CoQ10-d6 and CoQ10H2d6 to the sample,
b3) detecting CoQ10, CoQ10H2, CoQ10-d6 and CoQ10H2-d6 by mass spectrometry,
c3) determining the amount of detected CoQ10 by comparing it to the known amount of detected CoQ10H2-d6, and
d3) determining the amount of detected CoQ10H2 by comparing it to the known amount of detected CoQ10H2-d6.
US Pat. No. 10,111,450

PROCESS FOR MAKING A MULTIPHASE JELLIFIED BEVERAGE COMPOSITION

Nestec S.A., Vevey (CH)

1. A process comprising the steps of, in order:providing a water, juice, and/or milk-based jellified product comprising at least two separate homogeneous gel masses, each of the separate homogeneous gel masses comprising carrageenan and galactomannan, wherein adjacent separate gel masses have different gel strengths between 10 and 400 g; and
manually shaking the product for a period of time sufficient to break the weakest gel mass into particles to form a jellified ready-to-drink beverage.
US Pat. No. 10,112,988

METHODS OF ASSESSING AMYLOID-BETA PEPTIDES IN THE CENTRAL NERVOUS SYSTEM BY BLOOD-BRAIN BARRIER PERMEABLE PEPTIDE COMPOSITIONS COMPRISING A VAB DOMAIN OF A CAMELID SINGLE DOMAIN HEAVY CHAIN ANTIBODY AGAINST AN ANTI-AMYLOID-BETA PEPTIDE

ICB INTERNATIONAL, INC., ...

1. A method for assessing an amyloid-beta peptide in the central nervous system of a subject, the method comprising:(i) administering to the subject a polypeptide comprising the formula:
Vab1-L1-X-R3-Y-L2-Vab2,
wherein Vab1 and Vab2 each independently comprises a variable antigen-binding (Vab) domain that is derived from a camelid single domain heavy chain antibody, and at least one of the variable antigen binding domains comprises amino acids 1-127 of the amino acid sequence of SEQ ID NO: 11 and is capable of binding to an amyloid-beta peptide;
wherein L1 and L2 each comprise a hinge region from a camelid single domain heavy chain antibody; and
wherein the L1, L2, or both further comprise a covalently-attached-detectable label,
wherein the detectable label comprises a nanoparticle that comprises polybutylcyanoacrylate and dextran;
wherein X and Y are bifunctional linkers, wherein X and Y are selected from the group consisting of —NHCO—(CH2CH2O)n— and wherein n=2-100, —CH(CH2SH)—NHCO, —(C4H3NO2)—S—(CH2)3-imidate-, and —NHCO—(CH2CH2O)n—(C4H3NO2)—S—(CH2)3-imidate- and wherein n=2-100;
wherein R3 comprises at least one constant domain of human IgG CH2 or CH 3 domain, and
wherein the polypeptide is capable of specifically binding to an amyloid-beta peptide within the central nervous system (CNS) of the subject;
(ii) waiting for a time sufficient for the polypeptide to permeate the blood-brain-barrier of the subject and bind to the amyloid-beta peptide; and
(iii) detecting the presence or amount of the detectable label within the CNS of the subject.
US Pat. No. 10,111,451

FOOD, BEVERAGE OR PHARMACEUTICAL COMPOSITION CONTAINING FERMENTED EASTERN PRICKLY PEAR AND A PREPARATION METHOD THEREFOR

1. A method of treating acne or atopic dermatitis in a human in need thereof consisting essentially of administering to the human in need thereof a therapeutically effective amount of Eastern Prickly Pear which has been fermented with nuruk or Aspergillis oryzae to effectively treat the acne or atopic dermatitis in the human in need thereof.
US Pat. No. 10,112,989

POLYPEPTIDES AND POLYPEPTIDE CONSTRUCTS COMPRISING SINGLE DOMAIN ANTIBODIES DIRECTED AGAINST VON WILLEBRAND FACTOR

Ablynx, N.V., Ghent-Zwij...

1. A method for the treatment and/or alleviation of disorders relating to platelet-mediated aggregation, comprising administering to a subject in need of such treatment an effective amount of a polypeptide construct comprising at least one single domain antibody that specifically binds vWF,wherein the at least one single domain antibody has complementarity determining regions (CDRs) and framework regions (FRs), and,
wherein the at least one single domain antibody comprises:
a sequence represented by any one of SEQ ID NOs: 1 to 7, 23 to 31, and 62 to 65, or
an homologous sequence of any one of SEQ ID NOs: 1 to 7, 23 to 31, and 62 to 65, wherein the FRs have a sequence identity of more than 85% with the FRs of the parent sequence; or
an homologous sequence of any one of SEQ ID NOs: 1 to 7, 23 to 31, and 62 to 65, wherein the FRs have up to 10 amino acid substitutions compared to the FRs of the parent sequence, and,
wherein said polypeptide or polypeptide construct is able to inhibit at least 50% of platelet aggregation at high shear (1600 s?1) at a concentration of between 0.08 and 0.3 ?g/ml.
US Pat. No. 10,111,965

CELL PENETRATING PEPTIDES FOR INTRACELLULAR DELIVERY OF MOLECULES

Aadigen, LLC, Pacific Pa...

1. A complex comprising:a) a cell-penetrating peptide characterized in that it comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-4; and
b) a cargo selected from the group consisting of peptides, proteins, peptide analogs, uncharged oligonucleotides, PNAs and small hydrophobic molecules.
US Pat. No. 10,112,991

HUMANIZED ANTIBODIES SPECIFIC TO THE PROTOFIBRILLAR FORM OF THE BETA-AMYLOID PEPTIDE

SANOFI, Paris (FR)

1. A polynucleotide encoding for a polypeptide having at least 95% identity with SEQ ID NO: 26; ora polynucleotide encoding for a polypeptide having at least 90% identity with SEQ ID NO: 28; or
a polynucleotide comprising at least 99% identity with SEQ ID NO: 3; or
a polynucleotide comprising at least 95% identity with SEQ ID NO: 5 or 27; or
a polynucleotide comprising at least 90% identity with SEQ ID NO: 25.
US Pat. No. 10,111,454

RANGE OF ASEPTICALLY PRODUCED INFANT FOODS HAVING LOW CONCENTRATIONS OF UNDESIRED BY-PRODUCTS AND METHODS FOR MAKING SAME

Nestec, S.A., Vevey (CH)...

1. A method of producing a heat processed, aseptically packaged infant food product from a plurality of ingredients, the method comprising the steps of:precooking the plurality of ingredients separately;
mixing the precooked ingredients;
subjecting the mixed, precooked ingredients to ultra-high-temperature (UHT) sterilization;
aseptically packaging the UHT-treated infant food product within a packaging container following UHT sterilization; and
wherein the heat processed, aseptically packaged infant food product has reduced levels of furan produced during processing when compared to similar products processed using conventional retorting under sterilization conditions, as indicated by less than about 5 micrograms furan per kg food product.
US Pat. No. 10,112,992

ANTIGENS ASSOCIATED WITH ENDOMETRIOSIS, PSORIATIC ARTHRITIS AND PSORIASIS

Philogen S.P.A., Siena (...

1. A method of delivering a molecule to the neovasculature of endometriotic tissue in a human or animal, said molecule being conjugated to a specific binding member which binds the ED-A isoform of fibronectin to form a conjugate and the method comprises administering the conjugate to the human or animal, wherein the specific binding member is an anti-EDA antibody or antigen binding fragment thereof comprising a heavy chain variable (VH) domain and a light chain variable (VL) domain, wherein(i) the heavy chain variable (VH) domain comprises heavy chain CDR1, CDR2 and CDR3 amino acid sequences in SEQ ID NO: 16; and
(ii) the light chain variable (VL) domain comprises the light chain CDR1, CDR2 and CDR3 amino acid sequences in SEQ ID NO: 78.
US Pat. No. 10,114,018

IL-2 PEPTIDE DERIVATIVES, AND USES THEREOF FOR THE DIAGNOSIS AND TREATMENT OF AN AUTOIMMUNE DISEASE


US Pat. No. 10,111,967

COMPLEXES OF RNA AND CATIONIC PEPTIDES FOR TRANSFECTION AND FOR IMMUNOSTIMULATION

1. A method of inducing or enhancing an innate immune response in a subject in need thereof, comprising administering to the subject a complexed ribonucleic acid (RNA) comprising at least one RNA molecule complexed with one or more oligopeptides, wherein the at least one RNA molecule is not covalently bound to the one or more oligopeptides, wherein the nitrogen/phosphate ratio (N/P-ratio) of the RNA to the one or more oligopeptides is in the range of 0.75-25, and wherein the oligopeptide is 8 to 15 amino acids in length and comprises the following formula:(Arg)l;(Lys)m;(His )n;(Orn)o;(Xaa)x  (formula I)whereinl+m+n+o+x=8-15, and
l, m, n or o independently of each other is any number selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15, provided that the overall content of Arg, Lys, His and Orn represents at least 50% of all amino acids of the oligopeptide; and
Xaa is any amino acid selected from native or non-native amino acids except Arg, Lys, His or Orn; and
x is any number selected from 0, 1, 2, 3, 4, 5, 6, 7, or 8, provided, that the overall content of Xaa does not exceed 50% of all amino acids of the oligopeptide.
US Pat. No. 10,112,993

FACTOR H POTENTIATING ANTIBODIES AND USES THEREOF

STICHTING SANQUIN BLOEDVO...

1. An isolated, synthetic or recombinant antibody or fragment thereof that specifically binds to complement control protein domain 18 (CCP18) of factor H (FH), the antibody or fragment comprising:(a) a heavy chain CDR1 having the sequence of SEQ ID NO:5, a heavy chain CDR2 having the sequence of SEQ ID NO:6 and a heavy chain CDR3 sequence having the sequence of SEQ ID NO:7, or
(b) a light chain CDR1 sequence having the sequence of SEQ ID NO:1, a light chain CDR2 sequence having the sequence of SEQ ID NO:2 and a light chain CDR3 having the sequence of SEQ ID NO:3.
US Pat. No. 10,114,019

BACTERIAL CHALLENGE MODEL IN CATTLE USING A TRANS- AND INTRA-DERMAL ROUTE TO INFECT PERIPHERAL LYMPH NODES

TEXAS TECH UNIVERSITY SYS...

1. A method of observing and evaluating bacterial infections within the lymph nodes of animals presented for harvest comprising:inoculating intradermally with a device capable of inoculating concurrently at multiple sites an animal with a known amount of a bacterial pathogen, wherein the multiple inoculation sites comprise lymph node drainage areas, wherein the bacterial pathogen that is a live bacterial pathogen selected from Salmonella, Listeria, Shigella, Fransicella, Clostridum, Staphylococcus, Streptococcus, or Bacillus; and
at one or more time points obtaining one or more lymph node biopsies are aseptically harvested to determine the extent of the bacterial pathogen in the lymph nodes.
US Pat. No. 10,111,968

NUCLEIC ACID COMPRISING OR CODING FOR A HISTONE STEM-LOOP AND A POLY(A) SEQUENCE OR A POLYADENYLATION SIGNAL FOR INCREASING THE EXPRESSION OF AN ENCODED THERAPEUTIC PROTEIN

1. A method of expressing a therapeutic protein in a mammalian subject comprising administering to the subject an effective amount of mRNA comprising:a) a polypeptide coding region, encoding said therapeutic protein;
b) at least one histone stem-loop, and
c) a poly(A) sequence,wherein said mRNA does not include a histone downstream element (HDE) and the mRNA increases the expression of the therapeutic protein in said subject.
US Pat. No. 10,111,458

PROCESS FOR INHIBITING FORMATION OF NITROSAMINES

R.J. Reynolds Tobacco Com...

1. A process for inhibiting formation of nitrosamines by bacteria in and/or on planted tobacco, the process comprisingtreating the planted tobacco with a substance comprising a plurality of bacteriophages capable of lysing nitrate-reducing bacteria that form nitrosamines,
wherein the substance comprising the plurality of bacteriophages includes one or more bacteriophages from order or family Caudovirales, Myoviridae, Siphoviridae, Podoviridae, Microviridae, Corticoviridae, Tectiviridae, Leviviridae, Cystoviridae, Inoviridae or Plasmaviridae,
wherein the treating comprises administering to the tobacco plant the substance comprising the plurality of bacteriophages,
wherein the nitrate-reducing bacteria are free from transduction of non-viral DNA; and
slowing the rate of conversion of nitrate to nitrite on the planted tobacco by lysing at least a portion of the nitrate-reducing bacteria.
US Pat. No. 10,111,970

CONTRAST AGENTS FOR MAGNETIC RESONANCE IMAGING

Duke University, Durham,...

1. A method of enhancing a magnetic resonance imaging (MRI) image of a body or body region such as an organ or organ region in a subject, comprising:parenterally administering a composition consisting essentially of sodium ascorbate, meglumine ascorbate, or a mixture thereof to said subject in an MRI image-enhancing amount,
wherein said sodium ascorbate, meglumine ascorbate, or mixture thereof is administered in an amount of from 0.02 grams per kilogram subject body weight, up 40 grams per kilogram subject body weight; and then
generating, by MRI of the subject, an image of said body or body region,
whereby said composition enhances the MRI image.
US Pat. No. 10,112,996

FUNCTION MODIFYING NAV1.7 ANTIBODIES

UCB Biopharma SPRL, Brus...

1. An anti-Nav1.7 antibody or binding fragment thereof which after binding the Nav1.7 ion channel is functionally modifying thereto, such that the activity of the ion channel is reduced, wherein the antibody or fragment thereof binds to an E1 or E3 extracellular region of the Nav1.7 ion channel.
US Pat. No. 10,112,997

TIGHT-BINDING AGENTS AND USES THEREOF

ONCOMED PHARMACEUTICALS, ...

1. An isolated antibody that specifically binds the extracellular domain of TIGIT, which comprises:(a) a heavy chain CDR1 comprising GSSLSSSYMS (SEQ II) NO:7), a heavy chain CDR2 comprising IIGSNGNTYYANWAKG (SEQ ID NO:8), and a heavy chain CDR3 comprising GGYRTSGMDP (SEQ ID NO:9), and a light chain CDR1 comprising QASQSISSYLNW (SEQ ID NO:10), a light chain CDR2 comprising DALKLAS (SEQ ID NO:11), and a light chain CDR3 comprising QQEHSVGNVDN (SEQ ID NO:12);
(b) a heavy chain CDR1 comprising GFSLSSSYMS (SEQ ID NO:13), a heavy chain CDR2 comprising IIGSNGNTYYANWAKG (SEQ ID NO:8), and a heavy chain CDR3 comprising GGYRTSGMDP (SEQ NO:9); and a light chain CDR1 comprising QASQNIYSDLAW (SEQ ID NO:81), a light chain CDR2 comprising RASTLAS (SEQ ID NO:15), and a light chain CDR3 comprising QQEHLVAWIYN (SEQ ID NO:16); or
(c) a heavy chain CDR1 comprising TSDYAWN (SEQ ID NO:57), a heavy chain CDR2 comprising YISYSGSTSYNPSLRS (SEQ ID NO:58), and a heavy chain CDR3 comprising ARRQVGLGFAY (SEQ ID NO:59), and a light chain CDR1 comprising KASQDVSTAVA (SEQ ID NO:60), a light chain CDR2 comprising SASYRYT (SEQ ID NO:61), and a light chain CDR3 comprising QQHYSTP (SEQ ID NO:62).
US Pat. No. 10,112,998

INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR-SPECIFIC ANTIBODIES AND USES THEREOF

National Research Council...

1. An isolated or purified single domain antibody or antigen-binding fragment thereof, comprisinga complementarity determining region (CDR) 1 sequence of GGTVSPTA (SEQ ID NO:1);
a CDR2 sequence of ITWSRGTT (SEQ ID NO:2); and
a CDR3 sequence of AASTFLRILPEESAYTY (SEQ ID NO:3),wherein the single domain antibody or antigen-binding fragment thereof is specific for Insulin-Like Growth Factor 1 Receptor (IGF1R).
US Pat. No. 10,114,025

MEANS AND METHODS FOR PRODUCING ANTI-PROTEOME ANTIBODIES AND IDENTIFYING CONSERVED UNIQUE OR DIFFERENTIALLY EXPRESSING MOLECULES OF ORGANISMS

Pathovacs, Incorporated, ...

1. A method for identifying epitopes comprising one or more amino acid molecules of at least two proteomes of an organism that are conserved or unique, the method comprising,a) generating at least one first cDNA expression library of a first recombinant proteome of a first organism by preparing fragments of the genome of said first organism of 0.3 to 1.5 kbp, size-fractionating said fragments into up to five fractions, and cloning said fragments into vectors;
b) generating at least one second cDNA expression library of at least one second recombinant proteome that is a different biotype from said first organism or is a different organism from said first organism by preparing fragments of the genome of said first organism of 0.3 to 1.5 kbp, size-fractionating said fragments into up to five fractions, and cloning said fragments into vectors;
c) expressing said at least one first expression library and said at least one second expression library en masse in a host to produce said first and said at least one second recombinant proteome;
d) harvesting said first and said at least one second recombinant proteome expressed by said first and said at least one second libraries;
e) generating enhanced anti-proteome antibodies which selectively bind to the proteins of said first recombinant proteome; and
f) binding said at least one second recombinant proteome to said anti-proteome antibodies to identify amino acid molecules comprising epitopes by (i) detecting any of said amino acid molecules conserved between said first and said at least one second recombinant proteomes, or (ii) detecting any of said amino acid molecules unique to at least one of said recombinant proteomes to identify said amino acid molecules.
US Pat. No. 10,113,000

COMBINATION THERAPIES FOR B-CELL LYMPHOMAS COMPRISING ADMINISTRATION OF ANTI-CD20 ANTIBODY

Biogen Inc., Cambridge, ...

1. A method for treating low grade or follicular non-Hodgkin's lymphoma (NHL) comprising administering to a patient 375 mg/m2 of rituximab during a cyclophosphamide, doxorubicin, vincristine, and prednisone (CHOP) chemotherapeutic regimen, wherein the CHOP chemotherapy and rituximab are administered to the patient on Day 1 of each CHOP chemotherapy cycle.
US Pat. No. 10,113,001

FC VARIANTS WITH INCREASED AFFINITY FOR FCYRIIC

Xencor, Inc., Monrovia, ...

1. A nucleic acid encoding a protein, wherein said protein comprises an Fc variant of a parent IgG Fc polypeptide, said Fc variant comprising an amino acid substitution at position 243 in the Fc region of said parent IgG Fc polypeptide, wherein numbering is according to the EU index.
US Pat. No. 10,114,028

BIOMARKERS FOR PNEUMONIA AND ACUTE DECOMPENSATED HEART FAILURE

Upstream Medical Technolo...

1. A method of monitoring a subject having both pneumonia and acute decompensated heart failure, comprising(a) performing an immunoassay to determine a level of a ghrelin signal peptide (GHRsp) fragment by contacting a body fluid sample obtained from the subject with an antibody or antigen-binding antibody fragment thereof that binds a ghrelin signal peptide fragment that is (a) GHRsp (1-9) (SEQ ID NO:3); or (b) GHRsp (1-10) (SEQ ID NO:4) and detecting ghrelin signal peptide fragment bound to the antibody or antigen-binding antibody fragment thereof;
(b) comparing the level of the ghrelin signal peptide fragment determined by the immunoassay with a level of the ghrelin signal peptide fragment in a reference body fluid sample obtained from the same subject at an earlier time, which reference body fluid sample contained a level of ghrelin signal peptide fragment that was above a threshold level of the ghrelin signal peptide fragment that distinguishes a population of subjects having both pneumonia and acute decompensated heart failure from a population of subjects not having both pneumonia and acute decompensated heart failure, wherein a level of ghrelin signal peptide fragment that is above the threshold level indicates the subject has both pneumonia and acute decompensated heart failure; and,
(c) setting a treatment regimen or adjusting a treatment regimen for the subject based upon said comparing of the level of the ghrelin signal peptide fragment in the body fluid sample with the reference body fluid sample.
US Pat. No. 10,113,003

MULTISPECIFIC NK ENGAGER PROTEINS

INNATE PHARMA, Marseille...

1. A method of promoting the specific lysis of cancer cells expressing an antigen of interest which is specifically bound by a therapeutic anti-cancer antibody or therapeutic anti-cancer antigen-binding antibody fragment in a subject in need thereof comprising contacting said cancer cells with an amount of a multispecific antigen binding protein sufficient to promote the specific lysis of said cancer cells expressing said antigen of interest, wherein said multispecific antigen binding protein comprises:(i) a first antigen binding domain (ABD) which monovalently binds to a human NKp46 polypeptide having the amino acid sequence set forth in SEQ ID NO:1,
(ii) a second ABD which comprises a therapeutic anti-cancer antibody or a therapeutic anti-cancer antigen-binding antibody fragment which binds to said antigen of interest-expressed by said cancer cells, and
(iii) a CD16A binding polypeptide,wherein:(1) said NKp46-binding ABD comprises a Fab or comprises a variable heavy (VH) domain and a variable light (VL) domain separated by a linker (“scFv”);
(2) said cancer-antigen-binding ABD, which comprises said therapeutic anti-cancer antibody or therapeutic anti-cancer antigen-binding antibody fragment, is monovalent or bivalent;
(3) said CD16A binding polypeptide comprises a dimeric human Fc domain polypeptide which binds CD16A;
(4) said multispecific antigen binding protein binds to the NKp46 polypeptide monovalently;
(5) said multispecific antigen binding protein directs NKp46-expressing natural killer (NK) cells and CD16A-expressing NK cells to lyse cancer cells expressing the cancer antigen of interest by a combination of NKp46-mediated signaling and CD16A-mediated antibody-dependent cell-mediated cytotoxicity (“ADCC”);
(6) said dimeric Fc domain interposes said first ABD and said second ABD;
(7) said first and second ABD are each connected to said dimeric Fc domain, and one or both of said first and second ABD are connected to the dimeric Fc domain via a flexible polypeptide linker.
US Pat. No. 10,111,979

WOUND DRESSINGS, METHODS AND APPARATUS FOR MAKING SAME AND STORAGE AND USE THEREOF

RedDress Ltd., Pardes Ha...

1. A method of dressing a wound of a subject, the method comprising:withdrawing a volume of whole blood by sterile withdrawal of venous blood from a subject;
mixing the volume of whole blood with a coagulation initiator;
allowing said whole blood to clot at a location physically separated from the wound to obtain a sterile whole-blood clot;
combining said whole-blood clot with a support matrix to form a sterile wound dressing comprising clotted whole blood and the support matrix; and
applying said sterile wound dressing onto the wound, and leaving said sterile wound dressing in place for at least two days.
US Pat. No. 10,113,005

METHOD FOR PRODUCING DEWATERED MICROFIBRILLATED CELLULOSE

Kemira Oyj, Helsinki (FI...

1. A method for producing dewatered microfibrillated cellulose (MFC) comprising:i) providing an aqueous MFC slurry,
ii) optionally dewatering said MFC slurry by mechanical means to provide a partly dewatered MFC slurry, and
iii) subjecting the MFC slurry or the partly dewatered MFC slurry to one or more drying operations by contacting the MFC slurry or the partly dewatered MFC slurry with one or more absorbing materials comprising superabsorbent polymer to produce dewatered MFC,wherein the one or more drying operations is done at ambient temperature and pressure and wherein the one or more drying operations prevents agglomeration of the MFC to obtain the dewatered MFC which is redispersible.
US Pat. No. 10,111,980

DRY COMPOSITION COMPRISING AN EXTRUSION ENHANCER

1. A method of preparing a dry composition suitable for use in haemostasis and wound healing comprising sequentiallya) providing a cross-linked biocompatible polymer in powder form, one or more polyols, an extrusion enhancer selected from albumin, phosphatidylcholine, phosphatidylserine, lecithin or soy bean oil, and an aqueous medium,
b) mixing the biocompatible polymer, the one or more polyols, the extrusion enhancer and the aqueous medium to obtain a paste, and
c) freeze-drying the paste,
wherein the dry composition comprises from about 10% w/w to about 60% w/w of one or more polyols selected from sugar alcohols and sugars, and
wherein upon addition of an aqueous medium, the dry composition reconstitutes to form a paste without mechanical mixing.
US Pat. No. 10,113,007

ADVANCED COOK TECHNOLOGY

ICM, Inc., Colwich, KS (...

1. A method used in an alcohol production facility, the method comprising:separating a first suspended-solids stream from a first liquid stream containing fine-suspended solids of a process stream by using a first separation device in a counter-flow wash process;
sending the first liquid stream containing fine-suspended solids to a first tank;
milling a portion of the first suspended-solids stream by using a mechanical milling device;
adding water to the milled particles stream to create a lower-solids stream in a second tank;
heating the lower-solids stream in the second tank at a temperature less than about 95° C.; and
further separating a second suspended-solids stream from a second liquid stream containing fine-suspended solids of the lower-solids stream by using a second separation device in the counter-flow wash process; and
combining the second suspended-solids stream with the first liquid stream containing fine-suspended solids and mixing to homogenize;
wherein the method is performed downstream of slurry and upstream of fermentation.
US Pat. No. 10,114,290

METHOD FOR ACQUIRING PARAMETER FOR DOSE CORRECTION OF CHARGED PARTICLE BEAM, CHARGED PARTICLE BEAM WRITING METHOD, AND CHARGED PARTICLE BEAM WRITING APPARATUS

NuFlare Technology, Inc.,...

1. A method for acquiring a parameter for correcting a dose of a charged particle beam comprising:writing, using a charged particle beam, a plurality of evaluation patterns on a substrate coated with resist;
writing, under each writing condition while varying writing condition for each of the plurality of evaluation patterns, a peripheral pattern according to a corresponding writing condition on a periphery of any different one of the plurality of evaluation patterns by using a plurality of shots of the charged particle beam, after time that can be disregarded with respect to influence of temperature increase of the resist due to writing of an evaluation pattern concerned of the plurality of evaluation patterns has passed;
measuring, under the each writing condition, a width dimension of the evaluation pattern concerned, on whose periphery the peripheral pattern has been written;
calculating, under the each writing condition, a backscatter dose reaching the evaluation pattern concerned from each shot of the plurality of shots;
calculating, under the each writing condition, a temperature increase amount of the evaluation pattern concerned, which is increased due to heat transferred from at least one shot previous to a shot concerned in the plurality of shots, at each shot time of the plurality of shots; and
calculating a correlation parameter for defining a correlation among a width dimension change amount of the evaluation pattern concerned, the temperature increase amount of the evaluation pattern concerned, and the backscatter dose reaching to the evaluation pattern concerned, by using a width dimension of the evaluation pattern concerned under the each writing condition, the temperature increase amount of the evaluation pattern concerned at the each shot time under the each writing condition, and the backscatter dose reaching the evaluation pattern concerned from the each shot under the each writing condition, and outputting the correlation parameter.