US Pat. No. 9,102,331

MULTI-FUNCTIONAL ELECTRIC MODULE FOR A VEHICLE

GM Global Technology Oper...

1. A multi-functional electric module (eModule) for use with a vehicle having a chassis, a master controller, and a drive
wheel having a propulsion-braking module, the eModule comprising:
a steering control assembly having a steering motor and at least one steering controller, wherein each of the at least one
steering controller includes a first printed circuit board assembly (PCBA) operable to control the steering motor in response
to control signals from the master controller;

a mounting bracket positioned with respect to the steering control assembly, and having a mounting feature that is engageable
with the chassis;

a propulsion control assembly having a propulsion controller including a second PCBA that is in communication with the propulsion-braking
module;

a brake controller in communication with the propulsion-braking module, wherein the brake controller includes a third PCBA;
a housing that rotates with respect to the mounting bracket, wherein the housing includes an upper portion positioned adjacent
to the mounting bracket and containing the propulsion control assembly, and a lower portion which contains the brake controller;
and

a lower control arm connected to the lower portion of the housing, wherein the control arm contains a suspension system, and
wherein the lower control arm is connectable to the drive wheel via a wheel input/output block;

wherein the pair of steering controllers, the propulsion controller, and the brake controller are in communication with each
other and with the master controller, and are responsive to commands from the master controller to thereby control a respective
steering, propulsion, and braking function of the eModule.

US Pat. No. 9,228,002

LEISHMANIA VACCINE USING SAND FLY SALIVARY IMMUNOGEN

MERIAL, INC., Duluth, GA...

1. A composition comprising an expression vector, wherein the vector comprises a polynucleotide encoding one or more polypeptides
encoding one or more LJM17 polypeptides having at least 80% sequence identity to a polypeptide having the sequence as set
forth in SEQ ID NO: 5, 7, 15, or 17, and wherein the expression vector is selected from the group consisting of pVR2001-TOPO,
pVR2001-TOPA and ALVAC.
US Pat. No. 9,260,573

DYNAMIC MECHANICAL POLYMER NANOCOMPOSITES

CASE WESTERN RESERVE UNIV...

1. A polymer nanocomposite, comprising:
a nanoparticle network incorporated into a host matrix polymer, wherein the nanoparticle network is a formation of a substantially
three-dimensional network of substantially dispersed nanoparticles, wherein in a first switched state, the nanocomposite has
a first modulus, and wherein in a second unswitched state, the nanocomposite has a second modulus, wherein the first modulus
is greater than the second modulus by a factor greater than 2.5, wherein the switchable modulus function is inducable by a
chemical stimulus, or an electrical stimulus or an optical stimulus or a combination thereof.

US Pat. No. 9,254,588

PROTECTIVE LAYERING PROCESS FOR CIRCUIT BOARDS

The United States of Amer...

1. A method for encapsulating a populated circuit board assembly having an imprecise three-dimensional geometry, with at least
one protective layer that is tightly fit to the imprecise geometry of the populated circuit board assembly, the method comprising:
making a mold of the populated circuit board assembly;
using the mold to encapsulate the populated circuit board assembly with said at least one protective layer;
wherein making the mold includes:
scanning the populated circuit board assembly to create a surface file of the populated circuit board assembly;
enlarging the surface file to accommodate for variations of the mold and said at least one protective layer;
using the enlarged surface file to create a positive mold;
wherein encapsulating the populated circuit board assembly with said at least one protective layer includes:
using the positive mold to create a multi-layer compliant mold;
heating a first protective layer of said at least one protective layer;
drawing the heated first protective layer within the compliant mold, in order to pre-form an envelope with a substantially
precise representation of the populated circuit board assembly;

pressing the positive mold against the pre-formed envelope within the compliant mold to form the envelope;
releasing the formed envelope from the positive mold and the compliant mold; and
placing the formed envelope onto the populated circuit board assembly to be encapsulated.

US Pat. No. 9,091,463

PULSE TUBE REFRIGERATOR WITH TUNABLE INERTANCE TUBE

The United States of Amer...

1. A tunable pulse tube refrigerator for cryogenic cooling, comprising:
a pulse tube having a cold end and a hot end, for containing a working fluid;
a cold heat exchanger for accepting heat from an external heat source, being in fluid communication with the cold end;
a hot heat exchanger for rejecting heat from the pulse tube refrigerator, being in fluid communication with the hot end;
a pressure wave generator for generating pressure waves in the working fluid;
an inertance tube and a fluid reservoir for causing a phase shift between pressure waves and mass flow in the working fluid,
with the inertance tube having a proximal end for fluidly communicating with the hot heat exchanger and including an aperture
being in a state comprised of either a closed state or an open state, with the open state being for fluidly communicating
the inertance tube with the fluid reservoir;

the inertance tube being coiled in a spiral around an axis; and
a bypass mechanism comprised of a plurality of elongated curved tubes, which are also wound around the axis and are rotatable
about the axis, for sliding over different sections of the inertance tube, respectively, when the curved tubes are rotated
about the axis relative to the inertance tube, for changing the state of the aperture, whereby

the inertance tube has an effective length which can be changed, to thereby change an inertance value which is a function
of the effective length.

US Pat. No. 9,457,009

METHODS AND COMPOSITIONS FOR PREVENTING AND TREATING AUDITORY DYSFUNCTIONS

THE UNITED STATES OF AMER...

1. A method of treating an auditory impairment associated with cochlear outer hair cell damage, dysfunction or loss in a subject
comprising administering to said subject an effective amount of a composition comprising, as an active agent, one or more
of a carboxy alkyl ester selected from the group consisting of:
(a) 3,4-O-dicaffeoylquinic acid,
(b) 3,5-O-dicaffeoylquinic acid,
(c) 1,3-O-dicaffeoylquinic acid,
(d) 4,5-O-dicaffeoylquinic acid,
(e) 1,5-O-dicaffeoylquinic acid,
(f) 3-O-feruloylquinic acid,
(g) 4-O-feruloylquinic acid,
(h) 5-O-feruloylquinic acid,
(i) 1-O-caffeoylquinic acid,
(j) 3-O-caffeoylquinic acid,
(k) 4-O-caffeoylquinic acid,
(l) 5-O-caffeoylquinic acid,
(m) (1S,3R,4R,5R)-3-[3-(3,4-dihydroxyphenyl)-3R-hydroxypropanoyl]-1,4,5-trihydroxycyclohexanecarboxylic acid,
(n) (1S,3R,4R,5R)-3-[3-(3,4-dihydroxyphenyl)-3S-hydroxypropanoyl]-1,4,5-trihydroxycyclohexanecarboxylic acid,
(o) (1S,3R,4R,5R)-5-[3-(3,4-dihydroxyphenyl)-3R-hydroxypropanoyl]-1,3,4-trihydroxycyclohexanecarboxylic acid,
(p) (1S,3R,4R,5R)-5-[3-(3,4-dihydroxyphenyl)-3S-hydroxypropanoyl]-1,3,4-trihydroxycyclohexanecarboxylic acid,
(q) (1S,3R,4R,5R)-4-[3-(3,4-dihydroxyphenyl)-3R-hydroxypropanoyl]-1,3,5-trihydroxycyclohexanecarboxylic acid,
(r) (1S,3R,4R,5R)-4-[3-(3,4-dihydroxyphenyl)-3S-hydroxypropanoyl]-1,3,5-trihydroxycyclohexanecarboxylic acid,
(s) cis-5-O-caffeoylquinic acid,
(t) 3-O-caffeoylquinic acid lactone,
(u) 3-O-caffeoyl-4-O-feruloylquinic acid, and
(v) a pharmaceutically acceptable salt thereof, so as to restore cochlear outer hair cell function, thereby treating the auditory
impairment associated with cochlear outer hair cell damage, dysfunction or loss in the subject.

US Pat. No. 9,055,877

SYSTEM AND METHOD FOR RECONSTRUCTING CARDIAC ACTIVATION INFORMATION

The Regents of the Univer...

1. A method of processing cardiac activation information, the method comprising:
accessing a first cardiac signal and a second cardiac signal obtained from a patient;
processing the first cardiac signal and the second cardiac signal to identify a point of change in the first cardiac signal
at which a derivative of the first cardiac signal diverges with respect to a derivative of the second cardiac signal; and

assigning an activation onset time in the first cardiac signal at the point of change to define a cardiac activation.

US Pat. No. 9,524,358

CORE-MODULAR INTEROPERABILITY ARCHITECTURE FOR MODELING AND SIMULATION

The United States of Amer...

1. A method for designing and executing an interoperability architecture for computer modeling, the method comprising:
establishing tasks;
formulating use cases corresponding to said tasks;
based on said use cases, identifying requirements;
based on said requirements, constructing an interoperability architecture characterized by both physical interoperability
and functional interoperability, said interoperability architecture having a core, plural modules, and an interface between
said core and said modules, each said module representing a different computer model, wherein said constructing of said interoperability
architecture includes determining said modules, determining plural functionalities, and assigning each said functionality
to either said core or each of at least one said module, wherein:

said core contains a fixed set of shared data;
said core includes at least four core components;
a first said core component is a geometry component;
a second said core component is a communications component;
a third said core component is a sensor fusion component;
a fourth said core component is a decision-making component;
said fixed set of said shared data is categorized according to said geometry component, said communications component, said
sensor fusion component, and said decision-making component; and

effecting interoperability of said modules with respect to each other, said effecting of said interoperability including implementing
a computer, wherein said interoperability includes a cyclical process having at least three phases, said at least three phases
including an initiation phase, a simulation phase, and an interrogation phase, said cyclical process maintaining consistency
of said shared data contained in said core, wherein:

during said initiation phase, said modules have write-access, via said interface, to said shared data contained in said core,
each said module being capable of adding to or deleting from or modifying said shared data contained in said core, said modules
not having read-access to said shared data contained in said core;

during said simulation phase, said core performs at least one calculation with respect to said shared data, said modules having
neither write-access nor read-access to said shared data contained in said core;

during said interrogation phase, said modules have read-access, via said interface, to said shared data contained in said
core, each said module being capable of reading said shared data contained in said core, said modules not having write-access
to said shared data contained in said core.

US Pat. No. 9,434,486

SYSTEM AND APPARATUS FOR DEPLOYING A SATELLITE

The United States of Amer...

1. An apparatus for use with a satellite to be deployed in space, the apparatus comprising:
a satellite to be deployed in space;
at least one clamp bar configured to restrain the satellite to be deployed in space within the apparatus in an axial direction;
and

a plurality of pins configured to restrain the satellite within the apparatus in a lateral direction, wherein the plurality
of pins comprises a set of upper satellite pins configured to protrude through a shear plate, the shear plate being connected
to a door of the apparatus, the shear plate configured to connect the satellite to the apparatus, and a set of lower satellite
pins configured to protrude through a lower plate of the apparatus to connect the apparatus with the satellite.

US Pat. No. 9,468,922

CARBON MONOLITH SUPPORTED NANOPARTICLE CATALYSTS

The United States of Amer...

1. A catalyst comprising a support scaffold of pyrolyzed osseous tissue having a high carbon surface area and a plurality
of catalyzing nanoparticles deposited thereon; wherein said pyrolyzed osseous tissue comprises a section of bone.

US Pat. No. 9,242,874

MICROWAVE-BASED WATER DECONTAMINATION SYSTEM

The United States of Amer...

1. A system for decontaminating water, comprising:
a tubing having water disposed therein, wherein the tubing is made of polypropylene, polyethylene, polyurethane, neoprene,
or any combination thereof and wherein the water includes one or more contaminants selected from the group consisting of bacteria,
fungi, parasites, viruses, and combinations thereof;

a pump coupled to the tubing and adapted to cause the water to flow within the tubing at a rate from about 0.1 cm3/s to about 20 cm3/s; and

a microwave energy radiation device positioned proximate the tubing, wherein the microwave energy radiation device is adapted
to generate a signal having a frequency from about 20 GHz to about 100 GHz wherein the microwave energy radiation device is
comprised of a signal-emitting surface, wherein the signal-emitting surface has a first area from about 0.5 cm2 to about 10 cm2, wherein a temperature of the water prior to being exposed to the signal is from about 0° C. to about 30° C., and wherein
the signal is adapted to kill at least 90% of the contaminants disposed within the water while increasing the temperature
of the water by less than about 10° C.

US Pat. No. 9,117,948

SELENIUM INTERLAYER FOR HIGH-EFFICIENCY MULTIJUNCTION SOLAR CELL

The United States of Amer...

1. A multi-junction solar cell comprising:
a plurality of semiconducting layers; and
an interface layer consisting of selenium disposed between the plurality of semiconducting layers, wherein the interface layer
has a refractive index such that a ratio of a refractive index of each of the plurality of semiconducting layers to the refractive
index of the selenium interface layer is less than or equal to 1.5.

US Pat. No. 9,296,157

HYBRID GEAR

The United States of Amer...

1. A hybrid gear, comprising:
a metal gear rim portion with a plurality of gear teeth projecting outward or inward from the gear rim portion;
a gear hub portion disposed within the gear rim portion; and
a web of a rigid composite material joining the gear rim portion to the gear hub portion; a first layer of composite material
disposed upon a first side of an assembly of the web

a second layer of composite material disposed upon a second side of an assembly of the web and gear rim portion and the gear
hub portion, wherein the second layer is separate from the first layer;

wherein the gear rim portion has an internal mechanical locking feature with a first shape; the gear hub portion has an external
mechanical locking feature with a second shape; and the web has an external mechanical locking feature with a third shape
corresponding to the internal mechanical locking feature of the gear rim portion and an internal shape with a fourth shape
corresponding to the external shape of the gear hub portion;

wherein the first and second layers of composite material each have an internal mechanical locking feature having a fifth
shape corresponding to the second shape of the gear hub portion; and an external circular shape having a radius less than
a radius of the gear teeth roots;

wherein the web and the first and the second layers of composite material are bonded or co-cured together.

US Pat. No. 9,266,518

COMPONENT CONTROL SYSTEM FOR A VEHICLE

GM Global Technology Oper...

1. A central operating system comprising:
a first component control system configured for controlling a first electric steering, propulsion, braking, and suspension
subsystem component (eModule);

a second component control system configured for controlling a second eModule;
a third component control system configured for controlling a third eModule; and
a fourth component control system configured for controlling a fourth eModule;
a primary master controller in operative communication with each of the first, second, third, and fourth component control
systems; and

a secondary master controller in operative communication with each of the first, second, third, and fourth component control
systems;

wherein each of the first, second, third, and fourth component control systems includes at least one of:
a steering module configured for directing steering of the respective modular component, wherein the steering module includes:
a first and second steering controller; and
a first and second steering sensor;
a propulsion module configured for directing propulsion of the respective modular component, wherein the propulsion module
includes:

a propulsion controller; and
a first and second propulsion sensor;
a braking module configured for directing braking of the respective modular component, wherein the braking module includes
a braking controller; and

a communications module operatively connected to each of the steering module, the propulsion module, and the braking module,
wherein the communications module is configured for communicating with the primary and secondary controller;

wherein the primary master controller and the secondary master controller are configured to simultaneously transmit commands
to at least one of the first, second, third, and fourth component control systems; and

wherein the first, second, third, and fourth component control systems are each configured to accept commands from the secondary
master controller only when a fault occurs in the primary master controller.

US Pat. No. 9,055,876

SYSTEM AND METHOD FOR RECONSTRUCTING CARDIAC ACTIVATION INFORMATION

The Regents of the Univer...

1. A method of processing cardiac activation information, the method comprising:
accessing a first cardiac signal and a second cardiac signal obtained from a patient;
processing the first cardiac signal and the second cardiac signal to determine whether there is a point of change in the first
cardiac signal at which a derivative of the first cardiac signal diverges with respect to a derivative of the second cardiac
signal above a threshold; and

assigning an activation onset time in the first cardiac signal at the point of change to define a cardiac activation if the
point of change is in the first cardiac signal.

US Pat. No. 9,055,878

SYSTEM AND METHOD FOR RECONSTRUCTING CARDIAC ACTIVATION INFORMATION

The Regents of the Univer...

1. A method of reconstructing cardiac activation information, the method comprising:
accessing pairs of cardiac signals out of a plurality of cardiac signals obtained from a patient, the pairs having a first
cardiac signal that is common among the pairs and second cardiac signals that are different among the pairs;

processing the first cardiac signal and the second cardiac signals of the pairs to determine whether there are points of change
in the first cardiac signal at which a derivative of the first cardiac signal diverges with respect to derivatives of the
second cardiac signals above a threshold; and

assigning an activation onset time at a point in the first cardiac signal based on correspondence of the points of change
to define a cardiac activation indicating a beat if the points of change are in the first signal.

US Pat. No. 9,222,142

ADENOVIRUSES AND THEIR USE

The Regents of the Univer...

1. A method of detecting a baboon adenovirus type 3 (BaAdV-3) or a baboon adenovirus type 2/4 (BaAdV-2/4) infection in a subject,
the method comprising the steps of:
(a) obtaining a sample from a subject suspected of having an infection caused by BaAdV-3or BaAdV-2/4, wherein the sample comprises
antibodies from the subject;

(b) contacting the sample of step (a) with a full-length BaAdV-3 or BaAdV-2/4 polypeptide(s) encoded by SEQ ID NO 1 , SEQ
ID NO: 2 or SEQ ID NO: 3,

(c) screening for antibodies bound to a full length polypeptide;
wherein antibody binding confirms the BaAdV-3 or the BaAdV-2/4 infection.

US Pat. No. 9,194,334

PROPELLANT FEED SYSTEM FOR SWIRL-COAXIAL INJECTION

The United States of Amer...

1. A propellant feed system for swirl-coaxial injection of a liquid propellant, comprising:
a reservoir having a bottom plate;
at least one tube originating in said bottom plate and extending therefrom, said tube having a plurality of rectangular slits
defined in and distributed tangentially and evenly about a portion of said tube disposed in said bottom plate;

a plurality of drain holes in said bottom plate; and
a plurality of tunnels defined in said bottom plate, each of said tunnels fluidly coupling one of said drain holes to a corresponding
one of said rectangular slits, each of said tunnels including (i) a bend of at least 90°, and (ii) a straight portion leading
to said corresponding one of said rectangular slits wherein said straight portion is at least five times as long as a hydraulic
diameter of said corresponding one of said rectangular slits.

US Pat. No. 9,056,679

SYSTEM AND METHOD FOR AIRBORNE DEPLOYMENT OF OBJECT DESIGNED FOR WATERBORNE TASK

The United States of Amer...

1. An airborne deployment system, comprising:
a payload; and
an unmanned aerial vehicle (UAV) having
a controllable-throttle engine,
at least one control surface having a control surface actuator,
at least one clamp coupled to said payload and configured to hold said payload,
a clamp actuator coupled to each said at least one clamp,
a control system coupled to said engine, said at least one control surface actuator, and each said clamp actuator,
a radio receiver coupled to said control system and tuned to receive radio signals from a remote location, said radio signals
being indicative of instructions for implementation by said control system,

a global positioning system (GPS) receiver coupled to said control system;
at least one sensor coupled to said control system, said at least one sensor selected from the group consisting of an optical
sensor, a magnetic sensor, and a laser seeker; and

a submersion sensor coupled to said control system and exposed to an ambient environment external to said UAV;
wherein said control system comprises a memory device and computer processor programmed to
receive and store data indicative of an initial global position of an at-sea location,
receive said instructions from said radio receiver and responsively relay control signals derived from said instructions to
said engine, said at least one control surface actuator, and each said clamp actuator,

receive GPS data from said GPS receiver and responsively actuate said engine and said at least one control surface actuator
to pilot said UAV toward said initial global position when said instructions are not being received from said radio receiver,

receive data indicative of a target position from said at least one sensor when said UAV is within a predetermined distance
to said initial global position and responsively actuate said engine and said at least one control surface actuator to pilot
said UAV toward said target position when said instructions are not being received from said radio receiver, and

actuate each said clamp actuator to release its associated clamp in accordance with a hierarchy defined firstly by said instructions,
secondly by data collected by said at least one sensor, thirdly by said GPS data, and fourthly by data collected by said submersion
sensor that is indicative of water submersion.

US Pat. No. 9,352,032

LIVE ATTENUATED ANTIGENICALLY MARKED CLASSICAL SWINE FEVER VACCINE

The United States of Amer...

1. A recombinant classical swine fever virus (CSFV) mutant, FlagT4-mFT-Gv, comprising a cDNA sequence as set forth by SEQ
ID NO: 1, wherein said recombinant CSFV mutant, FlagT4-mFT-Gv is a live attenuated CSFV capable of being recognized by monoclonal
antibodies specifically binding to the FLAG™ epitope, which serves as a positive marker for said attenuated CSFV mutant, wherein
said epitope is the eight amino acid peptide DYKDDDDK as set forth in positions 688-705 of SEQ ID NO: 2 and the nucleotide
positions 2435-2488 Of SEQ ID NO: 1.

US Pat. No. 9,046,418

LINEAR FRESNEL SPECTROMETER CHIP WITH GRADIENT LINE GRATING

The United States of Amer...

1. A solid state spectrometer, the solid state spectrometer comprising:
a single differential linear Fresnel grating defining one of an optical axis and an optical axis plane, wherein the grating
receives incident light and causes Fresnel diffraction that disperses the incident light according to the wavelength of the
incident light onto the optical axis or the optical axis plane;

a detector having a dispersion area and a sensing area coinciding with the optical axis or the optical axis plane, the detector
detecting a distribution of dispersed light on the sensing area and measuring at least a selected one of light intensity and
light wavelength of the dispersed light;

the detector is configured to measure the wavelength or intensity of one or more distinct wavelengths without having any moving
parts; and

the single differential linear Fresnel grating element is in a perpendicular configuration with the detector; wherein the
single differential linear Fresnel grating is configured to provide the dispersion area of the detector with a minimal optical
path volume for the dispersed light, such that the dispersion area defines the smallest area capable of detecting all dispersions
for a wavelength range.

US Pat. No. 9,510,437

SYSTEM AND METHOD FOR CREATING A PREDETERMINED MAGNETIC POTENTIAL

THE UNITED STATES OF AMER...

1. An atom chip device comprising:
a plurality of wires configured to control a potential in a first direction;
a waveguide configured to control the potential in a second direction; and
wherein the plurality wires are spaced a predetermined spacing distance apart from each other so that by adjusting currents
in the plurality of wires the potential in the first and second directions can be tuned to produce a double well trap.

US Pat. No. 9,055,368

SOUND IDENTIFICATION AND DISCERNMENT DEVICE

The United States of Amer...

1. A sound identification and discernment apparatus, that functions as part of and in conjunction with a SONAR system, that
provides binaural listening for a SONAR operator, comprising:
a first transducer, made of noise isolating material, having a microphone capable of detecting ambient sound in the immediate
environment surrounding the SONAR operator and having an earphone speaker for broadcasting sound into the SONAR operator's
ear, wherein the first transducer remains stationary covering an ear of the operator;

a second transducer, electrically joined to the first transducer through a headband having interaural connections for control,
signal and power, said second transducer being made of noise isolating material having a microphone capable of detecting ambient
sound in the immediate environment surrounding the SONAR operator and having an earphone speaker for broadcasting sound into
the SONAR operator's ear, wherein the second transducer remains stationary covering the other ear of the SONAR operator not
covered by the first transducer;

a processor electrically joined to said first transducer and said second transducer receiving a plurality of electrical signals
wherein a first signal is representative of the audio signals of said SONAR system in an adjustable ratio with a second signal
representative of the ambient sound in the immediate environment surrounding the SONAR operator as detected by the microphones
in the first and second transducers, said processor providing an output signal representative of the audio signals of said
SONAR system and the ambient sound in the immediate environment surrounding the SONAR operator, said processor output signal
being routed to each of said first transducers and said second transducers which in turn generate sound through the earphone
speakers; and

wherein said first signal received by said processor is provided by a switching means of said system, so as to be selectable
from the group of signals representative of: (1) wired SONAR system audio input; and (2) wireless SONAR system audio input
through a Bluetooth antenna signal.

US Pat. No. 9,079,936

DERIVATIVES OF APF AND METHODS OF USE

University of Maryland, B...

1. A composition comprising two sugars and a peptide that comprises SEQ ID NO:11, wherein the sugars are ?-galactose and N-acetyl
galactosamine that are linked to each other, wherein the N-acetyl galactosamine is linked to the peptide in the alpha configuration.
US Pat. No. 9,068,165

THERAPEUTIC APPLICATIONS OF P53 ISOFORMS IN REGENERATIVE MEDICINE, AGING AND CANCER

The United States of Amer...

1. A method of extending the replicative lifespan of a cell that has a finite number of cell divisions by inhibiting cell
senescence, the method comprising the step of contacting the cell with an agent that activates the function or expression
of ?133p53, thereby inhibiting cell senescence and extending the replicative lifespan of the cell, wherein the agent comprises
a polynucleotide sequence encoding ?133p53 or an expression cassette comprising a polynucleotide sequence encoding ?133p53.

US Pat. No. 9,326,384

PROCESS TO PRODUCE CONFORMAL NANO-COMPOSITE COATING FOR MITITGATION OF MANUFACTURING DEFECTS USING CHEMICAL VAPOR DEPOSITION AND NANO-STRUCTURES

The United States of Amer...

1. A method of manufacturing a composite conformal coating comprising the steps:
providing an electrical component;
providing a first structure source, wherein the first structure source is adapted to produce one or more first structures
having a modulus of elasticity higher than a manufacturing defect of the electrical component, said manufacturing defect comprising
one or more crystalline metallurgical phenomenon involving a conductive spontaneous growth structure;

providing a chemical source that is adapted to produce a chemical vapor; and
depositing the chemical vapor and the one or more first structures in a layering process on the electrical component such
that the composite conformal coating is created, wherein the composite conformal coating forms a composite non-conductive
mechanical barrier to extrusion or emergence of said manufacturing defect from the electrical component;

wherein the one or more first structures comprise at least one nano-material selected from the group consisting of nano-fibers,
nano-capsules, and nano-particles;

wherein said at least one nano-material further comprises a material that exhibits an observable indication of physical interaction
with said manufacturing defect, said material exhibiting the observable indication of physical interaction comprising a dye
or structure which alters color or electromagnetic spectrum reflectivity or refraction when physically stressed.

US Pat. No. 9,087,944

NANOPLASMONIC CAVITIES FOR PHOTOVOLTAIC APPLICATIONS

The United States of Amer...

1. A stacked photovoltaic device, comprising:
a first solar cell bonded to a first flexible transparent conductive substrate, wherein said first flexible transparent conductive
substrate is electrically-connected to an electrical busbar;

a second solar cell bonded to said first flexible transparent conductive substrate, wherein said first solar cell and said
second solar cell are positioned diametrically-opposed from each other, wherein said first solar cell and said second solar
cell are electrically-connected to each other;

a third solar cell bonded to a second flexible transparent conductive substrate, said second flexible transparent conductive
substrate is electrically-connected to said electrical busbar;

a fourth solar cell bonded to said second flexible transparent conductive substrate, wherein said third solar cell and said
fourth solar cell are positioned diametrically-opposed from each other, wherein said third solar cell and said fourth solar
cell are electrically-connected to each other;

wherein each of said solar cells, comprises:
a first electrically-conductive nanostructure layer;
at least one photoabsorber layer associated with said first electrically conductive nanostructure layer;
at least one electron transfer layer associated with said at least one photoabsorber layer;
a second electrically-conductive nanostructure layer associated with said at least one electron transfer layer; and
wherein said electrical busbar is electrically connected to at least one power storage device;
wherein said first electrically-conductive nanostructure layer and said second electrically-conductive nanostructure layer
are 28 nm thick of silver, said at least one photoabsorber layer is 25 nm thick of polythiophene, and said at least one electron
transfer layer is 25 nm thick layer of titanium dioxide.

US Pat. No. 9,254,866

METHOD OF CONTROLLING STEERING OF A GROUND VEHICLE

GM Global Technology Oper...

1. A method of controlling steering of a vehicle through setting wheel angles of a plurality of modular electronic corner
assemblies (eModules), the method comprising:
receiving a driving mode selected from a mode selection menu;
determining, in a master controller, a position of a steering input device;
determining, in the master controller, a velocity of the vehicle when the determined position of the steering input device
is near center;

transmitting a drive mode request corresponding to the driving mode to a plurality of steering controllers when the steering
wheel is near center and the velocity of the vehicle is below a maximum velocity;

determining, in the master controller, a required steering angle of each of the plurality of eModules as a function of the
determined position of the steering input device, the determined velocity of the vehicle, and the driving mode; setting each
of the eModules to an angle of 0 degrees and recording the angle setting of each of the eModules to a memory in the master
controller, when the determined position of the steering input device is near 0 degrees; and

setting the eModules to the respective determined steering angles.

US Pat. No. 9,064,315

SYSTEM AND PROCESSOR IMPLEMENTED METHOD FOR IMPROVED IMAGE QUALITY AND ENHANCEMENT

The United States of Amer...

1. A processor implemented method for image improvement comprising the following steps not necessarily in sequential order:
providing a plurality of frames of a region of interest;
determining the value of each pixel at each location within each frame to form a first array of pixel values for each frame;
selecting less than all of the pixel locations within each frame within the plurality of frames;
summing the intensity values for the selected pixel locations within each frame;
multiplying the pixels in the first array of pixel values by the summation of intensity values for the selected pixel locations
to produce a first product array for each frame;

summing the first product arrays;
determining the average of first product arrays by dividing the sum of first product arrays by the number of frames in the
plurality of frames;

determining the average value of each pixel at each pixel location for the plurality of frames to form a second array of averaged
pixel values for the plurality of frames;

determining the average of the summation of intensity values for the selected pixel locations for the plurality of frames;
multiplying the array of average pixel values and the average of the summation of intensity values for the selected pixel
locations for the plurality of frames to form a second product array; and

subtracting the second product array from the average of first product arrays to provide an improved image of the region of
interest.

US Pat. No. 9,273,211

ENHANCED BIOMIMETIC COATINGS FOR ON-DEMAND ADHESION OF A CONDUCTIVE POLYMER APPLIQUE COATING

The United States of Amer...

1. A method for making a conductive polymer coating or film, comprising:
preparing conductive polymer appliqué nanotube arrays having ends and pretreating a polyanionic coating or film by hydrolysis
producing a polyanionic coating or film having at least one anionic group;

testing said pretreated polyanionic coating or film in its neutral form to determine whether there is an extended conformation
with COOH groups on a surface of said coating or film which is available for subsequent neutralization to said anionic group;

further preparing said conductive polymer appliqué nanotube arrays by electropolymerizing of said pretreated polyanionic coating
or film having the anionic group with aniline, pyrrole, and/or thiophene monomers in at least one conductive medium using
an anodic aluminum oxide (AAO) membrane or polycarbonate to improve flexibility;

purifying said fabricated arrays; and
attaching FeO nanoparticles to said purified conductive polymer appliqué nanotube arrays via a liquid-phase reaction utilizing
sodium borohydride (NaBH4) as a reducing agent producing an iron oxide thin film or coating on a surface of said nanoparticles to provide sites for
ionic bonding between an iron oxide surface and said anionic group(s) on said purified arrays, wherein said purified arrays
having FeO at said ends of aligned said nanotubes array to achieve direct attachment to said pretreated polyanionic coating
or film after oxidation to Fe+2 to produce appliqués that can undergo redox chemistry with strong ionic bonds.

US Pat. No. 9,396,294

METHOD OF MODELING AND SIMULATION OF SHAPED EXTERNAL OCCULTERS

The United States of Amer...

1. A method of modeling an external occulter, the method comprising:
providing at least one processor executing program code to implement a simulation system, said program code including the
steps of:

providing an external occulter having a plurality of petals, said occulter being coupled to a telescope; and
propagating light from said occulter to a telescope aperture of said telescope by scalar Fresnel propagation, by:
obtaining an incident field strength at a predetermined wavelength at an occulter surface;
obtaining a field propagation from said occulter to said telescope aperture using a Fresnel integral;
modeling a celestial object at differing field angles by shifting a location of a shadow cast by said occulter on said telescope
aperture;

calculating an intensity of said occulter shadow on said telescope aperture; and
applying a telescope aperture mask to a field of said occulter shadow, and propagating said light to a focal plane of said
telescope via fast Fourier transform (FFT) techniques;

separating a focal plane of said telescope into a plurality of channels, using beamsplitters;
acquiring one or more beam spots from said laser beacons using a coarse acquisition channel of one of said plurality of channels;
sensing a lateral location of said occulter using a pupil imaging channel of another of said plurality of channels; and
using a fine acquisition channel of another of said plurality of channels, to fine sense said location of said occulter.
US Pat. No. 9,107,866

ADHESIN-ENTEROTOXIN CHIMERA BASED IMMUNONGENIC COMPOSITION AGAINST ENTEROTOXIGENIC ESCHERICHIA COLI

The United States of Amer...

1. An immunogenic composition comprising a purified fusion protein, the fusion protein containing an E. coli minor fimbrial adhesin polypeptide or monomer, wherein the fimbrial adhesin polypeptide or monomer is derived from Class 5
fimbriae or CS3 fimbriae and is operatively connected, directly or via a linker and donor strand polypeptide, to a toxin A
subunit polypeptide.

US Pat. No. 9,272,743

SPHERICAL MODULAR AUTONOMOUS ROBOTIC TRAVELER

The United States of Amer...

1. A spherical modular autonomous robotic traveler (SMART) for delivering a payload along a surface from a first position
to a second position, said SMART comprising:
an outer spherical shell for rolling along the surface;
an inner spherical chamber disposed within said outer shell to carry the payload, said chamber maintaining its orientation
relative to the surface;

a plurality of weight-shifters arranged within said inner chamber, each weight-shifter including a mass disposed in a default
position, and locatable to an active position in response to activation; and

a controller within said inner chamber for selectively activating a weight-shifter among said plurality to shift said mass
from said default position to said active position, wherein said outer shell rolls in a direction that corresponds to said
weight-shifter activated by said controller.

US Pat. No. 9,440,934

SYNTHESIS OF COPPER(I) 5-NITROTETRAZOLATE

The United States of Amer...

1. A method of manufacture of copper(I) 5-nitrotetrazolate (DBX-1) comprising:
a) mixing an effective quantity of 5-aminotetrazole (5-AT) with an effective quantity of sulfuric acid (H2SO4), a first copper source, water (H2O), and a nitrite source to react and form a Complex 1 precipitate, which is the acid salt of 5-NT (Cu(H—NT)(NT)2(OH2)4);

b) mixing an effective quantity of the Complex 1 with an effective quantity of sodium hydroxide solution to react and form
a solution containing sodium 5-nitrotetrazolate (NaNT), which is filtered to remove insoluble solids, leaving a solution containing
NaNT, but that is substantially free of any 5-AT; and

c) mixing an effective quantity of this NaNT solution that has not been purified other than to remove insoluble solids with
an effective quantity of a second copper source and an effective quantity of a reducing agent to react and form the desired
DBX-1.

US Pat. No. 9,236,939

ATMOSPHERIC TRANSMISSOMETER USING A MODULATED OPTICAL SOURCE

THE UNITED STATES OF AMER...

1. A method comprising the steps of:
detecting a modulated optical signal from an atmospheric propagation channel, wherein the modulated optical signal comprises
an optical signal from an optical source modulated with a periodic signal at a modulation frequency greater than the bandwidth
of turbulence within the atmospheric propagation channel;

converting the detected modulated optical signal into a digitized electrical signal;
determining the power spectral density (PSD) of the digitized electrical signal;
extracting, from the PSD, the magnitude of the peak component at the modulation frequency f0, referred to as Satmos(f0); and

determining the effective optical depth ?eff of the atmospheric propagation channel using the magnitude of the peak component at the modulation frequency.

US Pat. No. 9,439,295

ELECTRICALLY INSULATING ELEMENTS AND ELECTRICALLY CONDUCTIVE ELEMENTS FORMED FROM ELEMENTS HAVING DIFFERENT OXIDATION BEHAVIORS

The United States of Amer...

1. A method of forming an electro-mechanical device using an oxidation process, the method comprising:
forming a metallic element which is to become an electrically insulating or resistive element;
forming an electrically conductive element, wherein the metallic element and the electrically conductive element have different
oxidation behavior when subjected to the oxidation process; and

subjecting the elements forming the electrically insulating or resistive element and the electrically conductive element to
the oxidation process,

whereby, in the electro-mechanical device formed using the oxidation process, one or both of the electrically insulating or
resistive element and the electrically conductive element suspend an element of the electro-mechanical device, at least partially,
above and spaced apart from a substrate or at least one other element of the electro-mechanical device,

wherein the electrically conductive element provides an electrical pathway to the suspended element, and the electrically
insulating or resistive element does not.

US Pat. No. 9,310,366

ANTHRAX CARBOHYDRATES, SYNTHESIS AND USES THEREOF

University of Georgia Res...

1. An isolated trisaccharide having the formula

wherein R1=H and R2=

or
wherein R1=Me and R2=

or
wherein R1=Me and R2=


US Pat. No. 9,242,861

AMORPHOUS CARBON-BORON NITRIDE NANOTUBE HYBRIDS

The United States of Amer...

1. A method for joining boron nitride nanotubes, comprising: providing a plurality of BNNTs; precisely aligning the BNNTs
to form a contact area and depositing amorphous carbon on the surface of the BNNTs at the contact area to form bonded hybrid
a-C/BNNT structures in which load is transferred between the BNNTs by amorphous carbon disposed between the BNNTs.

US Pat. No. 9,095,043

ELECTROMAGNETIC CLOAK USING METAL LENS

The United States of Amer...

1. An electromagnetic cloak to conceal an object in an electromagnetic field, said cloak comprising:
a first waveguide enclosing the object, said first waveguide including first and second metal plates separated from each other
by a first gap of a first distance with dielectric material to form a first path around the object, said second metal plate
having a first larger curvature radius than said first metal plate; and

a second waveguide enclosing the object, said second waveguide including third and fourth metal plates separated from each
other by a second gap of a second distance with said dielectric material to form a second path around the object, said third
metal plate having a second larger curvature radius than said fourth metal plate, wherein said first and third plates are
joined at opposite ends to enclose the object, said first and second paths diverting electromagnetic energy away from the
object in the electromagnetic field.

US Pat. No. 9,273,369

THERMOMECHANICAL METHODOLOGY FOR STABILIZING SHAPE MEMORY ALLOY (SMA) RESPONSE

The United States of Amer...

1. An apparatus configured to stabilize a strain-temperature response for a shape memory alloy, comprising:
a multi-axial deformation unit configured to simultaneously apply shear and normal stresses to a shape memory alloy; and
a temperature unit selected from the group consisting of an induction heater, a resistance heater furnace, a tape heater and
a resistance joule heater, configured to supply a stable temperature or cycle a temperature from a minimum temperature to
a maximum temperature;

a gauge to measure the corresponding shear and normal deformations or strains when applying an isobaric treatment at constant
pressure to a first sample of said shape memory alloy, the multi-axial deformation unit is configured to apply a constant
stress to the first sample and the temperature unit is configured to cycle temperature from a minimum temperature to a maximum
temperature until the strain or the deformation within the first sample stabilizes to provide a stabilized strain value at
the constant pressure;

one of a determining unit or a controller configured to compare and determine whether the strains have stabilized, and
when applying an isothermal treatment to a second sample, the multi-axial deformation unit is further configured to apply
different levels of stress on the second sample until a strain on the second sample matches the stabilized strain value on
the first sample to produce a material that is equally stabile under conditions equivalent to the deformation/strain levels
achieved under isobaric conditions.

US Pat. No. 9,255,040

BORON CARBIDE PYROTECHNIC TIME DELAY

The United States of Amer...

1. An environmentally friendly and easily compressed pyrotechnic delay composition, comprising:
a ternary mixture of B4C (boron carbide), NalO4 (sodium periodate), and PTFE (polytetrafluoroethylene);

which mixture has an inverse burning rate from about 1.3 to about 20.8 s/cm when pressed into a consolidated column.
US Pat. No. 9,243,364

METHODS OF PRETREATING LIGNOCELLULOSIC BIOMASS WITH REDUCED FORMATION OF FERMENTATION INHIBITORS

The United States of Amer...

1. A method of pretreating lignocellulosic biomass, the method comprising:
a) mixing the lignocellulosic biomass with either a sulfite solution having an initial pH of at least about 3 or a hydroxide
solution having an initial pH of at least about 9, as measured at room temperature, and maintaining the mixture at a temperature
in the range from about 150° C. to about 200° C. for a first treatment period; and

b) subsequently decreasing the pH of the intact mixture of step a) to a pH in the range from about 1 to less than 3 by introducing
a pH-reducing agent into the mixture and maintaining the mixture at a temperature in the range from about 150° C. to about
200° C. for a second treatment period to provide a treated product comprising pretreated biomass solids and a process liquor.

US Pat. No. 9,281,568

APPARATUS AND METHOD FOR IMPROVING THE GAIN AND BANDWIDTH OF A MICROSTRIP PATCH ANTENNA

The United States of Amer...

1. A method for improving bandwidth and gain of a microstrip patch antenna, comprising the steps of:
forming a highly anisotropic superstrate wherein the highly anisotropic superstrate includes a plurality of conductive strips
regularly disposed over a dielectric material and the plurality of conductive strips are provided with an electron dissipation
region at each end of each conductive strip; and

positioning said highly anisotropic superstrate at a predetermined spacing from the microstrip patch antenna on the side opposite
a ground plane side of the microstrip patch antenna.

US Pat. No. 9,174,422

APPARATUS FOR MANUFACTURING MICROCONDUIT NETWORKS FORMED BY ELECTROSPINNING TECHNIQUES

The United States of Amer...

1. An apparatus to manufacture microconduit network structures, comprising:
at least one mechanism having a set of electrospinning orifices to expel an effective amount of solution;
at least one ground plane, wherein said orifices are maintained at a desired voltage to said grounding plane;
a device that induces opposite electrical charges from said voltage to electrify jets of said solution and said jets of solution
accelerate to and on said grounding plane transforming said solution into branched webs of filaments;

at least one carrier substrate, wherein a mechanism deposits at least one interconnected branched webs of filaments on the
carrier substrate;

at least one said dispensing mechanism;
at least one matrix precursor fluid added into said interconnected branched webs of filaments from said dispensing mechanism;
a device to solidify said matrix fluid; and
a device that extracts or removes said interconnected branched webs of filaments from said matrix.
US Pat. No. 9,526,777

METHODS FOR THE INDUCTION OF EBOLA VIRUS-SPECIFIC IMMUNE RESPONSES COMPRISING ADMINISTERING A REPLICATION-DEFECTIVE CHIMPANZEE ADENOVIRUS VECTOR EXPRESSING THE EBOLA VIRUS GLYCOPROTEIN

The United States of Amer...

1. A method of inducing a protective immune response against an Ebola virus infection in a subject, the method comprising
intramuscularly administering to the subject 1010 to 1012 viral particles of a recombinant chimpanzee adenovirus type 3 (ChAd3) vector comprising a nucleic acid encoding an Ebola virus
glycoprotein, followed by administering to the subject a prophylactically effective amount of a modified vaccinia virus Ankara
(MVA) vector comprising a nucleic acid encoding the Ebola virus glycoprotein.

US Pat. No. 9,281,809

NONLINEAR TRANSMISSION LINE EXTRACTION SYSTEMS

The UNITED STATES OF AMER...

1. A system for extraction of electromagnetic energy from nonlinear transmission line, comprising:
a nonlinear transmission line deriving nonlinear behavior from a nonlinear dielectric material contained therein, said nonlinear
transmission line coupled to a singular adjacent waveguide containing a waveguide material;

said waveguide material being different from said nonlinear dielectric material; and
said nonlinear transmission line being for transferring electromagnetic energy having varying phase velocities from said nonlinear
transmission line into said adjacent singular waveguide.

US Pat. No. 9,305,252

SYSTEMS AND METHODS FOR RFID-ENABLED PRESSURE SENSING APPARATUS

The United States of Amer...

1. A radio frequency identification (RFID)-enabled pressure sensing apparatus, comprising:
a plurality of RFID tags attached to an operatively insulating and compressible substrate;
a collector in communication with the plurality of RFID tags;
an operably planar open waveguide, the waveguide being bonded on an operatively insulating dielectric base and in communication
with the collector; and

a load connected to one end of the waveguide, wherein the substrate having the plurality of RFID tags attached thereto is
positioned over the dielectric base and adjacent to the waveguide, one or more of the plurality of RFID tags being energized
when operably depressed to enable an electromagnetic coupling between the waveguide, allowing the operably depressed RFID
tag to send signals via the collector to an interrogator.

US Pat. No. 9,289,145

IDENTIFICATION OF ABNORMAL CARDIAC SUBSTRATE DURING LEFT-VENTRICULAR PACING

Medtronic, Inc., Minneap...

1. A system for identifying abnormal cardiac substrate, the system comprising:
at least one implantable left-ventricular (LV) lead comprising a plurality of electrodes, wherein the plurality of electrodes
includes at least one bipolar electrode pair configured to sense a LV bipolar cardiac electrogram signal of LV tissue proximate
the bipolar electrode pair;

a signal generator configured to deliver cardiac pacing pulses to a left ventricle via at least one electrode of the plurality
of electrodes of the at least one LV lead,

wherein the bipolar electrode pair does not include the at least one electrode of the plurality of electrodes via which the
signal generator is configured to deliver cardiac pacing pulses to the left ventricle, and

wherein a distance from the bipolar electrode pair to the at least one electrode of the plurality of electrodes via which
the signal generator is configured to deliver cardiac pacing pulses to the left ventricle is greater than or equal to approximately
ten millimeters; and

a cardiac tissue analysis module configured to:
determine an amplitude of a depolarization within the LV bipolar cardiac electrogram signal, the depolarization resulting
from the delivery of cardiac pacing pulses to the left ventricle, wherein the amplitude indicates whether the LV tissue proximate
the bipolar electrode pair comprises abnormal cardiac substrate; and

provide an indication of whether the LV tissue proximate the bipolar electrode pair comprises abnormal cardiac substrate based
on the amplitude.

US Pat. No. 9,102,983

SINGLE NUCLEOTIDE POLYMORPHISMS ASSOCIATED WITH RENAL DISEASE

The United States of Amer...

1. A method for detecting a genetic predisposition to focal segmental glomerulosclerosis (FSGS) in a human subject and administering
an angiotensin-converting enzyme (ACE) inhibitor to the human subject, comprising:
obtaining a sample from the subject comprising DNA;
contacting the DNA with a primer or probe for at least one single nucleotide polymorphism (SNP) in a non-coding region of
a MYH9 gene encoding non-muscle myosin heavy chain IIA comprising rs5750250;

genotyping the sample obtained from the subject for the at least one SNP comprising rs5750250;
detecting two copies of guanine (G) at rs5750250, as compared to a human subject with no G or a single copy of G at rs5750250,
thereby determining that the subject has a genetic predisposition to FSGS; and

administering the ACE inhibitor to the human subject with the genetic predisposition to FSGS.

US Pat. No. 9,354,025

MODIFIED TAIL FIN

The United States of Amer...

1. A dart tail fin assembly, comprising:
a cylindrical dart body comprising a nose, a tail opposite the nose and an outer surface extending from the nose to the tail;
a plurality of tail fins being attached to and spaced around the outer surface of the dart body,
wherein each fin of the plurality of tail fins comprises a trailing edge, a leading edge, a length from the trailing edge
to the leading edge, and a flat portion,

wherein the trailing edge is aligned with the tail of the dart,
wherein the leading edge is opposite the trailing edge toward the nose of the dart,
wherein said each fin is detached from the outer surface of the dart body along a portion of the length, which extends from
the leading edge, and

wherein the flat portion disposed at the leading edge extends perpendicularly outward from the outer surface by a first width;
and

a gap existing between said each fin and the outer surface of the dart body along the portion of the length over which said
each fin being detached from the outer surface.

US Pat. No. 9,273,942

DISPOSABLE, MINIATURE INTERNAL OPTICAL IGNITION SOURCE FOR AMMUNITION APPLICATION

The United States of Amer...

1. An optically initiated ammunition cartridge for a gun, comprising: a brass cartridge case comprising a projectile element,
a bed of propellant, a flashtube embedded in said bed of propellant, and a primer assembly to initiate said propellant, said
primer assembly comprising a primer, a primer button and a brass cup, and having an optical primer initiation means producing
light fluence to ignite said primer, which ignited primer in turn ignites into said flashtube, and which ignited flashtube
in turn ignites said bed of propellant.
US Pat. No. 9,150,431

FLUOROPHTHALOCYANINE PHOTODYNAMIC WATER STERILIZATION

The United States of Amer...

1. A method of sanitizing contaminated water comprising:
(a) exposing the contaminated water to an electrically neutral metal complex of a perfluoroalkylated fluorinated phthalocyanine
photosensitizer, having only external R groups with C—F bonds, in the presence of light;

(c) whereby, a sufficient quantity of singlet oxygen is provided by the chemical reaction of the light and the photosensitizer
to destroy the pollutants or pathogens present in the contaminated water;

(c) thereby rendering the water potable.

US Pat. No. 9,108,035

METHODS AND SYSTEMS FOR USING THERAPEUTIC, DIAGNOSTIC OR PROPHYLACTIC MAGNETIC AGENTS

University of Maryland, C...

1. A method for treating a patient comprising the steps of:
administering a plurality of magnetizable objects to a patient;
externally applying to the patient a static magnetic field, said field being formed by at least one external magnet;
altering an arrangement of said field relative to the patient to drive different portions of said plurality of magnetizable
objects in different coordinate planes through desired target volumes within the patient.

US Pat. No. 9,121,679

LIMITED RANGE PROJECTILE

The United States of Amer...

1. A projectile, comprising:
an ogive portion including a solid penetrator that defines a forward end of the projectile and, abutting a rear of the solid
penetrator and discrete from the solid penetrator, an ogive shell that defines a hollow interior;

a cylindrical portion that abuts a rear of the ogive portion and is discrete from the ogive portion, the cylindrical portion
including a shell and a hollow interior;

a base portion that abuts a rear of the cylindrical portion and is discrete from the cylindrical portion, the base portion
including a shell and a hollow interior;

pyrotechnic initiating material disposed in the hollow interior of the base portion and extending from a rear end of the projectile
forward into the hollow interior of the cylindrical portion;

reactive material disposed in each of the hollow interiors of the base portion, the cylindrical portion and the ogive portion,
the reactive material completely surrounding at least a portion of the pyrotechnic initiating material and extending from
the rear end of the projectile past a forward-most extent of the pyrotechnic initiating material, an entire radially outermost
surface of the reactive material being contiguous with respective inner surfaces of the base portion shell, the cylindrical
portion shell and the ogive portion shell, a forward end of the reactive material abutting the rear of the penetrator.

US Pat. No. 9,109,088

POROUS CROSS-LINKED POLYIMIDE NETWORKS

OHIO AEROSPACE INSTITUTE,...

1. A porous cross-linked polyimide network comprising an anhydride end-capped polyamic acid oligomer, wherein the oligomer
(i) comprises a repeating unit of a dianhydride and a diamine and terminal anhydride groups, (ii) has an average degree of
polymerization of 10 to 50, (iii) has been cross-linked via a cross-linking agent, comprising three or more amine groups,
at a balanced stoichiometry of the amine groups to the terminal anhydride groups, and (iv) has been chemically imidized to
yield the porous cross-linked polyimide network.

US Pat. No. 9,081,409

EVENT DETECTION CONTROL SYSTEM FOR OPERATING A REMOTE SENSOR OR PROJECTILE SYSTEM

The United States of Amer...

1. A damage detection and remediation system comprising:
a sensing device configured to be operably coupled to a structure of interest and to sense damage events, the sensing device
including a layer, each of the measuring portions including an input coupling point and an output coupling point and adapted
to conduct an electrical signal from the input coupling point to the output coupling point through said layer, wherein each
of said input and output coupling points are formed on opposing sides of said layer;

a measurement system in electrical communication with the measuring portions of the sensing device, the measurement system
configured to provide electrical signal inputs to the input coupling points of the sensing device, and configured to measure
electrical signal outputs at the output coupling points of the sensing device;

a damage detection processing system operably coupled to the measurement system, the processing system configured to determine
data on a damage event from the sensed damage event based on changes between the electrical signal inputs at the input coupling
points and the electrical signal outputs at the output coupling points, the data including a location of the damage event
on the sensing device, size of damage event, time data of damage event, corresponding damage assessment comprising a category
of the damage event, and a damage event origination axis approximately oriented upon a point of origin of an object associated
with said damage event; and

a targeting device operably coupled to the measurement system and damage detection processing system operable to control movement
and operation of an equipment item having a first operation axis associated with operation of said equipment item comprising
an operation to orient an aiming axis of said equipment item along said damage event orientation axis up to said point of
origin of said object;

wherein said damage event is further determined based on a comparison of changes of said electrical signal outputs between
a first measuring portion and a second measuring portion;

wherein said electrical signal output changes of said first measuring portion includes a baseline measurement data determination
based on a resistance data value associated with a first state of said layer by taking a measurement of electrical signal
outputs of said layer before at least one said damage event, said damage detection processing system and said measuring system
are configured to perform a plurality of continuous said comparisons of changes of said electrical signals to continually
monitor said sensing device for said damage event or damage events at a specified time interval, wherein said baseline measurement
is provided in an initial said measurement of said electrical signal outputs at the output coupling points of the sensing
device;

wherein one or more of said baseline measurement data is reset and stored with one or more new baseline measurement data after
a determination is made by said damage detection processing system that one or more of said measured electrical signals are
different than one or more said baseline measurement data so as to reset damage event detection capability on an ongoing basis
for remaining sections of said sensing device;

further comprising an acoustic sensor supported by a vehicle and in communication with the damage detection processing system,
the acoustic sensor configured to detect soundwaves generated by the firing of a projectile and provide sound wave data to
said damage detection processing system, wherein said damage detection processing system is configured to determine a sound
wave origination axis approximately oriented upon a sound wave point of origin, wherein said damage detection processing system
is further configured to correlate said sound wave point of origin with said damage event origination axis and said point
of origin of said object associated with said damage event and determine a range of spatial orientation correlations, wherein
if said damage detection processing system determines said range of spatial orientation correlations then said damage detection
processing system outputs a damage event correlation data output to a user interface indicating an increased probability of
accurate target identification to a user.

US Pat. No. 9,255,186

THERMOSETTING RESINS WITH ENHANCED CURE CHARACTERISTICS CONTAINING ORGANOFUNCTIONAL SILANE MOIETIES

The United States of Amer...

1. A thermosetting resin comprising:
a silane comprising:
a quaternary silicon atom;
a first non-hydrolyzable moiety bonded to the quaternary silicon atom and including a first reactive group;
a second non-hydrolyzable moiety bonded to the quaternary silicon atom and including a second reactive group;
a third non-hydrolyzable moiety bonded to the quaternary silicon atom and including a third reactive group; and
a fourth non-hydrolyzable moiety bonded to the quaternary silicon atom,
wherein each of the first, second, and third reactive groups includes at least one triple bond and is selected from the group
consisting of a cyanate ester and a phthalonitrile; and

a co-reactant monomer configured to react and form a three dimensional network with the silane.

US Pat. No. 9,203,030

RECYCLABLE ORGANIC SOLAR CELLS ON SUBSTRATES COMPRISING CELLULOSE NANOCRYSTALS (CNC)

Georgia Tech Research Cor...

1. A recyclable organic solar cell comprising:
a first electrode;
a second electrode;
a photoactive layer disposed between the first electrode and the second electrode;
an interlayer comprising a Lewis basic oligomer or polymer disposed between the photoactive layer and at least a portion of
the first electrode or the second electrode; and

a substrate comprising cellulose nanocrystals disposed adjacent to the first electrode or the second electrode;
wherein one or more of the first electrode, the second electrode, the photoactive layer, the interlayer, and the substrate
of the organic solar cell comprise recyclable material.

US Pat. No. 9,279,719

ELECTRIC FIELD QUANTITATIVE MEASUREMENT SYSTEM AND METHOD

The United States of Amer...

1. A system for making a quantitative measurement of an original true, non-distorted electric field, including static and
quasi-static electric fields, independent of the time of measurement, the system comprising:
an object;
a plurality of antennas separated from one another by known distances, said plurality of antennas arrayed in a region that
extends in at least one dimension;

means coupled to said plurality of antennas for measuring a voltage difference between at least one selected pair of antennas
from said plurality of antennas; and

a processor coupled to said means for measuring, said processor dividing each said voltage difference by one of said known
distances associated with said selected pair of antennas corresponding thereto to thereby generate a resulting quantity with
a plurality of resulting quantities being thereby defined over said region to quantitatively describe an electric, electrostatic,
quasi-electrostatic field therein,

wherein said system quantitatively describes said electric field when said object is electrically conductive, and said system
quantitatively describes said electric, electrostatic, and quasi-electrostatic field when said object is electrically non-conductive,
and wherein the system makes a quantitative measurement of an original true, non-distorted electric field, including static
an quasi-static electric fields independent of the time of measurement.

US Pat. No. 9,276,197

HYBRID DOMAIN WALL-HALL CROSS DEVICE

The United States of Amer...

1. A hybrid domain wall Hall cross device, comprising:
a semiconductor Hall cross having a top surface and a pair of arms intersecting at a center region;
and a ferromagnetic wire fabricated on the top surface, electrically isolated from the Hall cross, and having a constriction
proximate to the center of the Hall cross, said ferromagnetic wire having a first end and a second end, and wherein each said
end terminates in an electrode whereby upon pulses of current being applied thereto a domain wall correlated with a binary
state is established.

US Pat. No. 9,264,154

DYNAMIC RANGE ENHANCEMENT OF HIGH-SPEED ELECTRICAL SIGNAL DATA VIA NON-LINEAR COMPRESSION

The United States of Amer...

1. A method for measuring an electrical signal utilizing a data acquisition device, comprising the steps of:
obtaining a first analog electrical signal waveform with a probe originating from a device under test (DUT);
altering at least a portion of the first analog electrical signal waveform utilizing a transfer function component to create
a second analog electrical signal waveform;

conveying the second analog electrical signal waveform to the data acquisition device;
applying an algorithmic inverse transfer function to the second analog electrical signal waveform to restore the first analog
waveform; and

outputting an electrical signal measurement based on the restored first analog waveform.

US Pat. No. 9,288,557

METHOD AND APPARATUS FOR ANALYZING THE SPECTRUM OF RADIO-FREQUENCY SIGNALS USING UNAMPLIFIED FIBER OPTIC RECIRCULATION LOOPS

The United States of Amer...

1. An apparatus for generating a frequency spectrum of an RF signal comprising:
a gate switch for generating an output signal pulse within a predetermined time window from a laser of wavelength lambda modulated
by an input RF signal;

a first fiber optical loop for circulating a first percentage of a first pulse of the output signal pulse from the gate switch,
for a predetermined number of cycles n where each cycle takes time t1;

a second fiber optical loop for conducting a second percentage of the first pulse for predetermined number of cycles “k”,
where each cycle takes time t2, where t2*k=t1*n;

a low-loss switch with a first state for coupling the first pulse from the gate switch to a coupler that splits the output
signal pulse into the first percentage output and the second percentage output, the coupler coupling the first pulse into
the first fiber optical loop and tapping replicas of the pulse from the first fiber optical loop, and a second state for coupling
the second percentage of the first pulse to recycle back via the second loop to the first loop by the coupler to increase
the intensity of the tapped replica pulses; and

a processor for correlating the replicas of the pulse with each other to produce a set of data points comprising a plurality
of multiplexed correlated pulses and transforming the data points into a channelized frequency spectrum of the input RF signal.

US Pat. No. 9,272,090

BURN PATIENT RESUSCITATION SYSTEM

The United States of Amer...

1. A system for use in resuscitating a patient comprising:
a urine sensor;
an infusion pump;
an electronic medical records interface; and
a processor connected to said urine sensor and said infusion pump, said processor having
means for calculating an infusion rate using an infusion rate model based on at least a current infusion rate received from
at least one of said infusion pump and said electronic medical records interface, a current urinary output, and infusion rate
model based constants, the new infusion rate is calculated using the following equation


 where It is the new infusion rate, It-1 is the last infusion rate, e(t) is the urinary output error between the current urinary output and a target urinary output,
IRCt is the infusion rate constant at time t based on the hours post burn, and UOCt is the urinary constant, and

wherein the urinary output error is further multiplied by a Gaussian function calculated using a mid-point of a target urinary
output range.

US Pat. No. 9,219,553

METHOD OF TESTING A COMMUNICATION SYSTEM USING A PORTABLE WIDEBAND ANTENNA-RADIATED SIGNAL GENERATOR

The United States of Amer...

1. A method of testing a communications system at least partially included within a submarine sail comprising:
aiming a hand-held wideband harmonic signal generator at a selected receiving antenna that is mounted on the submarine sail,
wherein the aiming is performed from a location that is proximate to the selected receiving antenna mounted on the submarine
sail, wherein the hand-held wideband harmonic signal generator includes circuitry for generating a signal having a selected
fundamental frequency, for producing a signal having a harmonic series of the selected fundamental frequency, for transferring
the signal having the harmonic series using a balanced impedance output, for directionally transmitting transferred signal
having the harmonic series using a directional antenna having a characteristic impedance that is matched to the balanced impedance
output;

irradiating the selected receiving antenna to produce an induced signal using the directionally transmitted signal having
the harmonic series generated by the hand-held wideband harmonic signal generator; and

measuring the induced signal in the communications system of the submarine.

US Pat. No. 9,273,920

INTEGRAL MULTI-CHAMBERED VALVED SUPPRESSOR

The United States of Amer...

1. A gas operated projectile firing system suppressor comprising:
a suppressor structure having a first end and a second end on a side opposing said first end, wherein said suppressor structure
comprises a first chamber and a second chamber, wherein said first chamber and said second chamber are formed on opposing
sides of said suppressor structure, wherein said suppressor structure comprises a bore defined by an inner side wall of said
suppressor structure, wherein said bore passes unobstructed from said first end of said suppressor structure through said
second end through said suppressor structure along a first axis, wherein said bore is formed to receive and slide over a section
of a barrel of said gas operated projectile firing system such that a muzzle is in proximity to said second end and said first
end is positioned over said barrel away from said muzzle, wherein said suppressor structure is adapted to substantially surround
a length of said barrel such that said second end of said suppressor structure is proximal to said muzzle but does not extend
substantially beyond said muzzle, wherein said suppressor structure further comprises an adjustable coupling mechanism that
is adapted to selectively fix said suppressor structure with respect to said barrel so as to prevent said suppressor structure
from moving relative to said barrel in a first position and also permits said suppressor structure to rotate around said barrel
in a second position;

at least one gas intake port formed into said inner side wall, wherein said gas intake port is closer to said first end of
said suppressor structure than said second end of said suppressor structure, wherein said gas intake port is adapted to convey
gas from a barrel port formed in a side of said barrel to a section of said suppressor structure in proximity to said second
end of said first chamber;

at least one gas pass-through port formed in proximity to said first end, wherein said pass-through port is formed with a
passage to convey said gas passing into said first chamber into said second chamber in proximity to said first end of said
suppressor structure; and

at least one exhaust port formed in a section of said second end of said suppressor structure, wherein said exhaust port is
adapted to expel said gas from said second chamber and so exhaust said gas from said suppressor structure.

US Pat. No. 9,279,019

HUMAN MONOCLONAL ANTIBODIES SPECIFIC FOR CD22

The United States of Amer...

1. A monoclonal antibody that specifically binds human CD22, the antibody comprising
a heavy chain or portion thereof, which comprises an amino acid sequence comprising residues 26-35 of SEQ ID NO: 3, residues
53-61 of SEQ ID NO: 3 and residues 100-113 of SEQ ID NO: 3, and

a light chain or portion thereof, which comprises an amino acid sequence comprising residues 27-32 of SEQ ID NO: 4, residues
50-52 of SEQ ID NO: 4 and residues 89-97 of SEQ ID NO: 4.

US Pat. No. 9,415,099

METHOD OF ALTERING THE IMMUNDOMINANCE HIERARCHY OF HIV GAG BY DNA VACCINE EXPRESSING CONSERVED REGIONS

The United States of Amer...

1. A method of inducing an immune response in a subject, the method comprising:
(a) administering a first Gag conserved element nucleic acid that encodes a first Gag conserved element polypeptide that comprises
six conserved elements from Gag to the subject, wherein the conserved elements are from different regions of Gag, and further,
wherein each conserved element is at least 12 amino acids in length, but less than 30 amino acids in length and the conserved
elements are not contiguous;

(b) administering a second Gag conserved element nucleic acid that encodes a second Gag conserved element polypeptide that
comprises at least one variant of a conserved element polypeptide differs from the variant in the first polypeptide by 1,
2, or 3 amino acids; and

(c) administering a nucleic acid encoding a full-length Gag protein;
wherein the nucleic acid encoding the full-length Gag protein is administered after the first and the second Gag conserved
element nucleic acids, and

wherein the region of the nucleic acid encoding the full-length Gag protein encodes only the full-length Gag protein.

US Pat. No. 9,286,418

METHOD FOR DESIGNING AN ACOUSTIC ARRAY

The United States of Amer...

1. A method for designing an acoustic array comprising:
determining a desired beam pattern of angles and associated power levels for the array;
determining a desired acoustic wavelength for the array;
determining a desired beamwidth for the array;
establishing an array radius of curvature based on the determined acoustic wavelength and the desired beamwidth;
modeling the array as a plurality of elements positioned on a curved surface having the established array radius of curvature;
calculating an amplitude shading function as a plurality of weightings that when applied to the modeled array would give the
desired beam pattern; and

constructing an array of acoustic elements in accordance with the modeled array radius of curvature with each element at a
location having an area proportional to at least one weighting given by the calculated amplitude shading function.

US Pat. No. 9,278,374

MODIFIED SURFACE HAVING LOW ADHESION PROPERTIES TO MITIGATE INSECT RESIDUE ADHESION

The United States of Amer...

1. A process of mitigating insect residue adhesion on an aerodynamic surface to maintain laminar flow, the process comprising:
a. providing at least one article having at least one aerodynamic surface that is impacted by insects in use;
b. topographically modifying said aerodynamic surface;
c. chemically modifying said aerodynamic surface by coating said aerodynamic surface with a low surface energy coating;
wherein the modified aerodynamic surface comprises a water contact angle of greater than about 80 degrees and a surface roughness
of about 0.2 micron to about 50 microns after said aerodynamic surface is topographically and chemically modified, wherein
the modified aerodynamic surface is configured to maintain laminar flow of air that moves across the modified aerodynamic
surface and mitigate adhesion of insect residue without creating significant turbulence in air that moves along the modified
aerodynamic surface in use.

US Pat. No. 9,276,564

NOISE-ASSISTED REPROGRAMMABLE NANOMECHANICAL LOGIC GATE AND METHOD

THE UNITED STATES OF AMER...

1. A nanomechanical logic device comprising:
a single crystal nanomechanical resonator operating in a nonlinear frequency regime having two different vibrational steady
states;

first bias means applied to the resonator for inducing the two vibrational steady states with a controllable drive signal
thereby creating the two vibrational steady states representing different logic states having a logic value as an output;

second bias means for applying noise to the resonator; and
logic signal input bias means applied to the resonator for producing a modulation of the nonlinear frequency regime which,
with the presence of the noise, induces switching between the two vibrational steady states and changing the logic value of
the output.

US Pat. No. 9,102,742

SEROLOGIC CORRELATES OF PROTECTION AGAINST BACILLUS ANTHRACIS INFECTION

1. A process of determining if a subject has acquired immunity against B. anthracis infection in a subject comprising:
obtaining a biological sample from a subject;
screening said biological sample for the presence or absence of antibodies to one or more predefined regions of Bacillus anthracis protective antigen, at least one of said predefined regions consisting of residues 681-710 of SEQ ID NO: 1; and

determining subject as having acquired immunity against B. anthracis by the presence of antibodies to one or more of said predefined regions, or determining said subject as lacking acquired immunity
against B. anthracis from said screening by the absence of antibodies to one or more of said predefined regions.

US Pat. No. 9,287,993

RF CHANNELIZER BASED ON PARAMETRICALLY GENERATED COMBS DERIVED FROM A SINGLE MASTER SEED

The United States of Amer...

12. A radio frequency (RF) channelizer comprising:
a master laser configured to generate a reference beam at a reference frequency;
a splitter configured to split the reference beam into first and second beams;
an RF reference oscillator;
a first modulator module configured to convert the first beam into a first modulated beam comprising a multitude of frequencies
spaced from the reference frequency by integer multiples of a first RF frequency that is referenced to the RF reference oscillator;

a second modulator module configured to convert the second beam into a second modulated beam comprising a multitude of frequencies
spaced from the reference frequency by integer multiples of a second RF frequency that is referenced to the RF reference oscillator;

a first seed tone generator configured to derive at least three seed beams from the first modulated beam, at least two seed
beams with high optical power with frequency spaced by 2?fP and a given seed beam with frequency offset by ?fP/2 from one of the other seed beams, where ?fP/2 is equal to or a multiple of the first RF frequency;

a signal modulator configured to modulate a received RF signal to be channelized onto the given seed beam, wherein the first
seed tone generator is further configured to filter and combine the at least three seed beams into a single first seed tone
beam;

a first parametric mixer configured to receive and convert the first seed tone beam into a first comb comprising a comb of
lines spaced by 2?fP and multicasted copies of the modulated given seed beam with spacing ?fP and offset in frequency by ?fP/2 from the comb of lines spaced by 2?fP;

a second seed tone generator configured to derive from the second modulated beam a second seed tone beam comprising at least
two second seed tones, spaced by (?fP+?)/n, where n is a positive integer and the absolute value of ? is the channel spacing, or resolution bandwith, of the channelizer,
and where (?fP+?)/n is a multiple of the second RF frequency;

a second parametric mixer configured to receive and convert the second seed tone beam into a second comb with frequency pitch
(?fP+?)/n;

a first optical filter configured to receive and separate the first comb into a plurality of first filtered beams, the center
frequency of each first filtered beam corresponding to a frequency of an individual line of the second comb;

a second optical filter configured to receive and separate the second comb into a plurality of second filtered beams, each
second filtered beam corresponding to an individual line of the second comb; and

a coherent detection array configured to select, combine, and detect corresponding pairs from the first filtered beams and
the second filtered beams, and further configured to provide as an output a contiguous bank of channelized coherent I/Q down-converted
intermediate frequency (IF) signals, spaced in frequency by the absolute value of ? covering the bandwidth of the received
RF signal.

US Pat. No. 9,066,948

OXADIAZOLO[3,2-A]PYRIMIDINES AND THIADIAZOLO[3,2-A]PYRIMIDINES

THE UNITED STATES OF AMER...

6. A pharmaceutical composition comprising a compound according to claim 1, in combination or association with a pharmaceutically acceptable diluent or carrier.
US Pat. No. 9,345,758

MATERIALS AND METHODS FOR RESPIRATORY DISEASE CONTROL IN CANINES

University of Florida Res...

1. An inactivated canine influenza virus,
wherein said inactivated influenza virus comprises a polypeptide having 95% or greater sequence identity with the amino acid
sequence shown in any of SEQ ID NOs: 64, 66, 68, 70, 72, 74, 76, or 78; or

wherein said inactivated influenza virus comprises a polynucleotide which encodes a polypeptide having the amino acid sequence
shown in any of SEQ ID NOs: 64, 66, 68, 70, 72, 74, 76, or 78, or said polynucleotide encodes a polypeptide having 95% or
greater sequence identity with the amino acid sequence shown in any of SEQ ID NOs: 64, 66, 68, 70, 72, 74, 76, or 78; and

wherein said inactivated influenza virus is inactivated by exposure of said virus to an effective amount of an inactivation
chemical selected from formalin, beta propiolactone (BPL), binary ethylenimine (BEI), or phenol.

US Pat. No. 9,217,010

N-SUBSTITUTED INDENOISOQUINOLINES AND SYNTHESES THEREOF

PURDUE RESEARCH FOUNDATIO...

1. A process for preparing a compound of the formula

without isolating an intermediate product, the process comprising: reacting a compound of the formula

with a compound of the formula

 and
cyclizing the intermediate product
wherein
Ra represents 1-4 substituents each of which is independently selected from the group consisting of hydrogen, halo, hydroxy,
optionally substituted alkyl, optionally substituted alkoxy, cyano, nitro, optionally substituted alkylthio, optionally substituted
alkylsulfonyl, carboxylic acid and derivatives thereof, and sulfonic acid and derivatives thereof; or Ra represents 2-4 substituents where 2 of said substituents are adjacent substituents and are taken together with the attached
carbons to form an optionally substituted heterocycle, and where any remaining substituents are each independently selected
from the group consisting of hydrogen, halo, hydroxy, optionally substituted alkyl, optionally substituted alkoxy, cyano,
nitro, optionally substituted alkylthio, optionally substituted alkylsulfonyl, carboxylic acid and derivatives thereof, and
sulfonic acid and derivatives thereof;

Rd represents 1-4 substituents each of which is independently selected from the group consisting of hydrogen, halo, hydroxy,
optionally substituted alkyl, optionally substituted alkoxy, cyano, nitro, optionally substituted alkylthio, optionally substituted
alkylsulfonyl, carboxylic acid and derivatives thereof, and sulfonic acid and derivatives thereof; or Rd represents 2-4 substituents where 2 of said substituents are adjacent substituents and are taken together with the attached
carbons to form an optionally substituted heterocycle, and where any remaining substituents are each independently selected
from the group consisting of hydrogen, halo, hydroxy, optionally substituted alkyl, optionally substituted alkoxy, cyano,
nitro, optionally substituted alkylthio, optionally substituted alkylsulfonyl, carboxylic acid and derivatives thereof, and
sulfonic acid and derivatives thereof.

US Pat. No. 9,085,604

ANTIPROLIFERATIVE FACTOR AND METHODS OF USE

University of Maryland, B...

1. A composition comprising a glycopeptide having one to six sugar moieties, wherein at least one sugar moiety is linked to
a) a peptide moiety comprises SEQ ID NO:10; or
b) a peptide moiety having one or two conservative substitutions in SEQ ID NO:10; or
c) a peptide moiety comprising SEQ ID NO:10 except that the first and second N-terminal amino acids are serine and leucine,
respectively.

US Pat. No. 9,260,762

REAL TIME PCR ASSAY FOR DETECTION OF BACTERIAL RESPIRATORY PATHOGENS

1. A method for detecting presence of one or more of a Mycoplasma pneumoniae nucleic acid, a Chlamydophila pneumoniae nucleic acid, and a Legionella spp. nucleic acid in a sample, comprising:
performing hybridization by contacting the sample with a first probe consisting of the nucleotide sequence of SEQ ID NO: 7
and a detectable label; a second probe consisting of the nucleotide sequence of SEQ ID NO: 10 and a detectable label; and
a third probe consisting of the nucleotide sequence of SEQ ID NO: 13 and a detectable label or consisting of the nucleotide
sequence of SEQ ID NO: 17 and a detectable label; and detecting hybridization between one or more detectably labeled probe
and a nucleic acid by detecting a change in signal from one or more detectably labeled probe during or after hybridization
relative to signal from the label before hybridization, wherein detection of hybridization between the first probe and a nucleic
acid indicates the presence of M. pneumoniae nucleic acid in the sample, detection of hybridization between the second probe and a nucleic acid indicates the presence
of C. pneumoniae nucleic acid in the sample, and detection of hybridization between the third probe and a nucleic acid indicates the presence
of Legionella spp. nucleic acid in the sample.

US Pat. No. 9,629,203

RADIANT HEAT BARRIER INSULATION SYSTEM

The United States of Amer...

1. A radiant heat barrier insulation system, comprising:
a first substrate having an inner and outer side;
a first layer of aluminum on said outer side of said first substrate;
a second substrate having an inner and outer side, said second substrate positioned so that said inner side of said second
substrate opposes said inner side of said first substrate, forming a gap therebetween;

a second layer of aluminum on said outer side of said second substrate; and
a randomly-oriented nest of carbon nanotube fibers disposed within said gap.

US Pat. No. 9,270,385

SYSTEM AND METHOD FOR QUANTUM BASED INFORMATION TRANSFER

The United States of Amer...

1. A system for communicating data comprising:
a sender subsystem;
a receiver subsystem;
at least one data input configured to input data into the sender subsystem; at least one entangled photon source configured
to output entangled photon pairs; first photons of the pairs of entangled photons outputted by the at least one photon source
being processed by one of the sender or receiver subsystem; second photons of the pairs of entangled photons being processed
by the other of the sender or receiver subsystem;

a photonic element configured to receive the first photons of the pairs of entangled photons and enable interference therebetween;
at least one absorber configured to absorb the first photons of the pairs of entangled photons after passage through the photonic
element, the absorbance of the first photons of the pairs of entangled photons operating to transfer the properties of the
entanglement to the second photons of the pairs of entangled photons; and

a Bell state measurement element operatively associated with the receiver subsystem; the Bell state measurement element configured
to measure the second photons of the pairs of entangled photons.

US Pat. No. 9,260,746

PHOTOINDUCED ELECTRON TRANSFER (PET) PRIMER FOR NUCLEIC ACID AMPLIFICATION

1. A method of detecting a target nucleic acid molecule, comprising:
incubating a sample comprising the target nucleic acid molecule with a forward primer comprising a sequence homologous to
the target nucleic acid molecule and a reverse primer comprising a sequence homologous to the target nucleic acid molecule
under conditions sufficient to allow amplification of the target nucleic acid molecule;

amplifying the target nucleic acid molecule using real-time polymerase chain reaction (PCR), thereby generating a labeled
amplicon;

denaturing the labeled amplicon;
generating a melting curve; and
detecting a signal from the label,
wherein the forward primer or the reverse primer is linked at its 5?-end to the 3?-end of a photoinduced electron transfer
(PET) tag, wherein the PET tag comprises the sequence 5?-AGGCGCATAGCGCCTGG-3? (SEQ ID NO: 4); 5?-AGGCGCGATACGCGCCTGG-3? (nucleotides
1 to 19 of SEQ ID NO: 10); 5?-AGGCGCGATCACGCGCCTGG-3? (nucleotides 1 to 20 of SEQ ID NO: 11); 5?-AGGCGCGATTCACGCGCCTGG-3?
(nucleotides 1 to 21 of SEQ ID NO: 12); 5?-AGGCGATACGCCTGG-3? (nucleotides 1 to 15 of SEQ ID NO: 23); 5?-AGGCGCATCAGCGCCTGG-3?
(nucleotides 1 to 18 of SEQ ID NO: 24); 5?-AGGCGATCACGCCTGG-3? (nucleotides 1 to 16 of SEQ ID NO: 25); 5?-AGGCGCATTCAGCGCCTGG-3?
(nucleotides 1 to 19 of SEQ ID NO: 26); or 5?-AGGCGATTCACGCCTGG-3? (nucleotides 1 to 17 of SEQ ID NO: 27), wherein the 5?-end
nucleotide of the PET tag comprises a label, wherein the PET tag comprises a stem and a loop of a stem-loop, wherein the PET
tag comprises two consecutive G nucleotides at the 3?-end of the PET tag, wherein the stem-loop brings the label on the 5?-end
nucleotide and the two consecutive G nucleotides at the 3?-end of the PET tag into proximity, thereby quenching a detectable
signal from the label in the absence of a target nucleic acid sequence, wherein the PET tag does not substantially hybridize
to the target nucleic acid sequence recognized by the forward and reverse primers, and wherein the detectable signal from
the label is unquenched when the labeled forward or reverse primer is incorporated into the amplicon,

wherein an increase in signal detected during the real-time PCR indicates that the target nucleic acid molecule is present
in the sample and wherein no significant increase in signal detected during the real-time PCR indicates that the target molecule
is not present in the sample, and

wherein a single peak detected during generating the melting curve indicates that the target nucleic acid molecule is present
in the sample and wherein no single peak detected during generating the melting curve indicates that the target molecule is
not present in the sample.

US Pat. No. 9,044,457

ANTI-DR4 AGONIST ANTIBODIES

The United States of Amer...

1. An antibody that binds to and is an agonist of DR4, wherein the antibody comprises a heavy chain variable region and a
light chain variable region, wherein the heavy chain variable region and the light chain variable region each comprise the
following three complementary determining regions (CDRs): CDR1, CDR2 and CDR3; wherein:
i) the CDR1 of the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:8;
ii) the CDR2 of the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:9;
iii) the CDR3 of the heavy chain variable region comprises the amino acid sequence of SEQ ID NO:10;
iv) the CDR1 of the light chain variable region comprises the amino acid sequence of SEQ ID NO:5;
v) the CDR2 of the light chain variable region comprises the amino acid sequence of SEQ ID NO:6;
vi) the CDR3 of the light chain variable region comprises the amino acid sequence of SEQ ID NO:7.
US Pat. No. 9,441,048

ANTIBODY FOR 3?-ISOLM1 AND 3?,6?-ISO-LD1 GANGLIOSIDES

The United States of Amer...

1. An isolated antibody construct which comprises the amino acid sequence shown in SEQ ID NO: 6, wherein the antibody construct
binds to both 3?-isoLM1 and 3?,6?-iso-LD1 gangliosides.
US Pat. No. 9,260,758

CELLULAR ARRAYS AND METHODS OF DETECTING AND USING GENETIC DISORDER MARKERS

The United States of Amer...

1. A method of detecting the presence of cancerous cells in a human breast tissue specimen, the method comprising:
a) obtaining a breast tissue specimen,
b) providing a probe set consisting of two or more labeled probes selected from a locus specific probe for chromosomal region
7q31, a locus specific probe for chromosomal region 8p11-p12, a locus specific probe for chromosomal region 10q25 and a probe
specific for PDGFB, wherein at least one probe is specific for PDGFB,

c) contacting said specimen with said two or more labeled probes of b), and
d) detecting the presence of cancerous cells when PDGFB and at least one of the chromosomal regions of step b) are amplified
in the human breast tissue specimen.

US Pat. No. 9,150,869

SUGAR TRANSPORT SEQUENCES, YEAST STRAINS HAVING IMPROVED SUGAR UPTAKE, AND METHODS OF USE

Wisconsin Alumni Research...

1. A nucleic acid construct comprising a first coding sequence operably linked to a first promoter not natively associated
with the coding sequence, the coding sequence encoding a glucose/xylose transporter polypeptide having at least 95% amino
acid identity to SEQ ID NO: 2.

US Pat. No. 9,291,710

METHOD AND APPARATUS FOR DETECTING SUBSURFACE TARGETS USING DATA INVERSION AND A TEMPORAL TRANSMISSION LINE MODEL

Board of Regents, The Uni...

1. A computer program embodied on a non-transitory computer readable medium for detecting one or more subsurface targets comprising:
a code segment for receiving a reflectivity data from two or more subsurface reflectors using a ground penetrating radar,
wherein the two or more subsurface reflectors comprise the one or more subsurface targets and a medium surrounding the one
or more subsurface targets;

a code segment for calculating an impedance data for the two or more subsurface reflectors by inverting the reflectivity data
using a temporal transmission line model with a “layer-peeling” method;

a code segment for calculating one or more constitutive parameters of the two or more subsurface reflectors based on the impedance
data; and

a code segment for detecting the one or more subsurface targets based on a change in the one or more constitutive parameters.

US Pat. No. 9,255,777

GRENADE FUZE AND DETONATOR WITH FLYING DISC

The United States of Amer...

1. An apparatus, comprising:
an energetics train including
an explosive charge containing PBXN-5;
a first charge containing PBX-9407 disposed adjacent to the PBXN-5 explosive charge;
a flying disc disposed adjacent to the first charge of PBX-9407;
a barrel having one end disposed adjacent to the flying disc; and
a second charge containing PBX-9407 disposed adjacent to an opposite end of the barrel;
wherein detonation of the first charge containing PBX-9407 causes the flying disc to accelerate through the barrel, impact
the second charge containing PBX-9407 and detonate the second charge containing PBX-9407.

US Pat. No. 9,102,807

TOUGHENING CROSS-LINKED THERMOSETS

The United States of Amer...

1. A grafted triglyceride comprising an acrylated triglyceride grafted with an average of more than zero fatty acid residues
per triglyceride, wherein the grafted triglyceride has a molecular weight of at least about 900 g/mole, the fatty acid residue
contains from 4 to 28 carbon atoms and the ratio of vinyl groups to grafted fatty acid residues is from about 0.2 to about
5.0.

US Pat. No. 9,387,224

TREATMENT OF SPECIFIC CARDIOVASCULAR CONDITIONS WITH NITRITE

The United States of Amer...

1. A method for treating pulmonary hypertension in a subject in need thereof by decreasing pulmonary arterial blood pressure
or increasing vasodilation, or both, the method comprising administering by inhalation a therapeutically effective amount
of pharmaceutically acceptable non-acidified sodium nitrite to the subject to decrease the pulmonary artery blood pressure,
or increase vasodilation, or both, in the subject, thereby treating pulmonary hypertension.
US Pat. No. 9,115,400

LMNA GENE AND ITS INVOLVEMENT IN HUTCHINSON-GILFORD PROGERIA SYNDROME (HGPS) AND ARTERIOSCLEROSIS

The Government of the Uni...

1. An isolated cDNA molecule, encoding a mutant Lamin A protein comprising the amino acid sequence as set forth in any one
of
(a) SEQ ID NO: 7;
(b) a sequence having at least 95% sequence identity to SEQ ID NO: 7; or
(c) a conservative variant of SEQ ID NO: 7.
US Pat. No. 9,382,302

LUTZOMYIA LONGIPALPIS POLYPEPTIDES AND METHODS OF USE

The United States of Amer...

1. An expression vector comprising:
a nucleic acid sequence encoding a salivary Lu. longipalpis polypeptide, wherein the polypeptide comprises amino acid residues 24-301 of SEQ ID NO: 15; and

a heterologous expression control sequence.
US Pat. No. 9,283,272

TARGETING INTRACELLULAR TARGET-BINDING DETERMINANTS WITH INTRACELLULAR ANTIBODIES

The United States of Amer...

1. A method for inhibiting an intracellular target in a cell with a bispecific antibody comprising contacting the cell with
a bispecific antibody having a first Fv fragment with a cell-penetrating determinant and a second Fv fragment with an intracellular
target-binding determinant under suitable conditions so that the first Fv fragment causes the bispecific antibody to enter
the cell and the second Fv fragment binds the intracellular target in the cell, and wherein the second Fv fragment is directed
to the Mdm2 oncoprotein, thereby inhibiting the intracellular target.
US Pat. No. 9,278,929

SYNTHESIS OF INTERMEDIATE ANILINO METHYL ESTERS USED IN THE PRODUCTION OF SYNTHETIC OPIOID ANALGESICS

The United States of Amer...

1. A process of making 4-(phenylamino)-1-(phenylalkyl)-4-piperidinecarboxamide, by converting in sequence:
a) 1 -phenylalkyl-4-piperidinone to 4-(phenylamino)-1-(phenylalkyl)-4-piperidinenitrile; and
b) said 4-(phenylamino)-1-(phenylalkyl)-4-piperidinenitrile, to 4-(phenylamino)-1-(phenylalkyl)-4-piperidinecarboxamide, by
reaction in trifluoroacetic acid solvent with non-aqueous sulfuric acid, said phenylalkyl being phenylmethyl or phenylethyl.

US Pat. No. 9,347,935

MAMMALIAN SWEET AND AMINO ACID HETERODIMERIC TASTE RECEPTORS COMPRISING T1R3 AND T1R1

The Regents of the Univer...

1. A method for determining a functional effect of a compound upon a cell expressing a first recombinant polypeptide and a
second recombinant polypeptide, the method comprising the steps of:
(a) expressing the first recombinant polypeptide and the second recombinant polypeptide in a plasma membrane of the cell,
wherein the first recombinant polypeptide comprises a first extracellular region and a first transmembrane region, wherein:
(i) the first extracellular region amino acid sequence is selected from the group consisting of: an amino acid sequence that
has at least 93% amino acid sequence identity to the extracellular region of SEQ ID NO:20 or an amino acid sequence that has
at least 94% amino acid sequence identity to the extracellular region of SEQ ID NO:23,

(ii) the first transmembrane region amino acid sequence is selected from the group consisting of: an amino acid sequence that
has at least 93% amino acid sequence identity to the transmembrane region of SEQ ID NO:20 or has at least 94% amino acid sequence
identity to the transmembrane region of SEQ ID NO:23, and

the second recombinant polypeptide comprises a second extracellular region and a second transmembrane region, and wherein
the second extracellular region has an amino acid sequence having at least 90% amino acid sequence identity to the extracellular
region of SEQ ID NO:2 and the second transmembrane region has an amino acid sequence having at least 90% amino acid sequence
identity to the transmembrane region of SEQ ID NO:2,

(b) assaying a parameter in the cell, the parameter indirectly or directly under the influence of a T1R GPCR protein or a
sweet and/or an amino acid taste receptor comprising one or more T1R GPCR proteins wherein the parameter is ligand binding
or transduction of a cellular signal in response to ligand binding;

(c) contacting the cell with the compound;
(d) assaying the cell for an increase or decrease in the parameter, thereby determining the functional effect, if any, of
the compound.

US Pat. No. 9,671,953

SYSTEMS AND METHODS USING DRAWINGS WHICH INCORPORATE BIOMETRIC DATA AS SECURITY INFORMATION

The United States of Amer...

1. A computing device comprising:
a touchscreen display or a pen and tablet, configured to receive gesture information comprising a plurality of points for
a user drawn security picture for a user drawing a security picture on the touchscreen display or the tablet; and

a security manager executed by at least one processor that is configured to:
determine one or more characteristics associated with input of the gesture information including a curvature and a distance
for the plurality of points for the user drawn security picture;

select a single point to be a reference point for the curvature and distance information;
model a curve for the user drawn security picture with respect to the selected reference point using a probabilistic distribution
model function which provides a measure of likelihood that a random point along the curve has a curvature and is a distance
from the selected reference point;

compare the modeled curve for the user drawn security picture with a model of a pre-determined curve having been modeled by
the model function; and

authenticate the user based on the drawn security picture and the comparison of the modeled curve for the user drawn security
picture and the modeled pre-determined curve.

US Pat. No. 9,254,319

COMPOSITIONS AND METHODS FOR GENERATING AN IMMUNE RESPONSE

Emory University, Atlant...

1. A vector comprising a insert encoding one or more antigens that elicit an immune response against an HIV of a subtype or
recombinant form, said insert encoding for (a) a HIV-1 Gag protein in which both zinc fingers have been inactivated by amino
acid changes corresponding to HIV Clade B HXB2 C392S, C395S, C413S and C416S; (b) a HIV-1 Pol protein in which (i) the integrase
activity is inhibited by the deletion of integrase, (ii) the reverse transcriptase activity is inhibited by amino acid changes
corresponding to HIV Clade B HXB2 D185N, W266T and E478Q, and (iii) the protease activity is inhibited by amino acid change corresponding to HIV Clade
B HXB2D25A.

US Pat. No. 9,283,875

SEAT CUSHION

The United States of Amer...

1. A method of absorbing energy and damping vehicular vibrational motion in a seat cushion, the method comprising the steps
of:
supplying a pressurized fluid to each of a plurality of chambers of the seat cushion, wherein the plurality of chambers are
in fluid communication with one another;

sensing whether the seat cushion is operational;
continuously receiving sensor data from a plurality of sensors;
determining whether vehicular vibrational motion transmitted to an occupant of the seat cushion exceeds a predetermined threshold
amount; and

opening one or more relief valves to release pressurized fluid from one or more of the plurality of chambers of the seat cushion
in a controlled manner according to an optimized control law such that the seat cushion absorbs an optimal amount of energy
and decreases the vehicular vibrational motion transmitted to the occupant.

US Pat. No. 9,090,915

SULFITE PRETREATMENT FOR BIOREFINING BIOMASS

Wisconsin Alumni Research...

1. A method for treating a cellulose-containing material to produce sugars comprising the steps of:
(a) providing cellulose-containing woody biomass comprising hemicellulose and lignin;
(b) treating the woody biomass of step (a) for 0.1 to 120 minutes with a solution comprising a base of sulfite or bisulfite
adjusted to have an initial pH of from about 1.5 to 5.0, wherein said treating is at a temperature of about 150 to 250° C.,
wherein sulfite or bisulfite charge (w/w), based on oven dried woody biomass, is no more than 9%, but greater than 0, and
wherein treating removes hemicellulose and produces only partial delignification; and

(c) enzymatically hydrolyzing the resultant treated biomass of step (b) to produce sugars,
wherein the woody biomass is mechanically size-reduced or treated by steam explosion prior to or during step (a) or (b).
US Pat. No. 9,078,915

PROSTATE CARCINOGENESIS PREDICTOR

University of South Flori...

1. A method of treating a prostate tumor in a subject comprising the step of administering to the subject a substance that
inhibits PKC-?, wherein in the subject PKC-? is overexpressed in the prostate tumor relative to benign or normal prostate
tissue.

US Pat. No. 9,521,753

VIBRATION DAMPING CIRCUIT CARD ASSEMBLY

The United States of Amer...

1. A vibration damping circuit card assembly, comprising:
a populated circuit card having a mass M;
a closed metal container coupled to a surface of said populated circuit card at a region of said populated circuit card that
includes a geometric center of said populated circuit card, said closed metal container including

a base having a planar surface bonded to said surface of said populated circuit card, said base having a continuous ridge
extending away therefrom wherein an annular flange is defined adjacent said continuous ridge,

a housing having an open end that is in sliding engagement with said continuous ridge, said housing having a continuous flange
defined about said open end for engagement with said annular flange, and

an adhesive disposed between said open end of said housing and said continuous ridge, said adhesive also disposed between
said continuous flange and said annular flange; and

tungsten balls filling approximately 90% of said metal container, wherein a mass of said tungsten balls is approximately (0.07)M.
US Pat. No. 9,163,068

INFLUENZA VIRUS RECOMBINANT PROTEINS

1. A composition comprising oligomers of unglycosylated polypeptides, the polypeptides comprising:
a. at least a portion of an influenza Hemagglutinin-1 (HA-1) domain; and
b. lacking:
an Hemagglutinin-2 (HA-2) domain; or
both an Hemagglutinin-2 (HA-2) domain and an Hemagglutinin transmembrane domain;
wherein administration of the composition to an animal generates neutralizing antibodies against an influenza virus.
US Pat. No. 9,394,427

TOUGHENING CROSS-LINKED THERMOSETS

The United States of Amer...

1. A cured resin comprising a cured product obtained by curing a material selected from the group consisting of vinyl esters
and unsaturated polyesters and mixtures thereof and a grafted triglyceride comprising an acrylated triglyceride grafted with
an average of more than zero fatty acid residues per triglyceride, wherein the grafted triglyceride has a molecular weight
of at least about 900 g/mole, the fatty acid residue contains from 4 to 28 carbon atoms and the ratio of vinyl groups to grafted
fatty acid residues is from about 0.2 to about 5.0.

US Pat. No. 9,212,876

LARGE CALIBER FRANGIBLE PROJECTILE

The United States of Amer...

1. A frangible training projectile for a large caliber gun, comprising:
a generally cylindrical base portion;
a generally conical portion contiguous with the base portion, the base portion and the conical portion having a common central
longitudinal axis and made of steel having a yield strength of at least 60 ksi;

at least three longitudinal slits formed in the base and conical portions, the slits being equally spaced circumferentially,
each slit extending from a bottom surface of the base portion through the base portion and into the conical portion, each
pair of adjacent slits defining a projectile section therebetween;

wherein, upon impact of the projectile, the projectile sections break away from a central core.

US Pat. No. 9,303,044

7-(PIPERAZIN-1-YL)-5H-[1,3,4]THIADIAZOLO[3,2-A]PYRIMIDIN-5-ONES FOR THE TREATMENT OF THROMBOTIC DISORDERS

THE UNITED STATES OF AMER...

10. A pharmaceutical composition comprising the compound of claim 1, in combination or association with a pharmaceutically acceptable diluent or carrier.

US Pat. No. 9,296,729

LOW MOLECULAR WEIGHT THYROID STIMULATING HORMONE RECEPTOR (TSHR) AGONISTS

The United States of Amer...

1. A method for detecting thyroid cancer in a subject, comprising administering to the subject in need thereof a diagnostically
effective amount of radioiodine and a diagnostically effective amount of at least one compound of formula I:

or a pharmaceutically acceptable salt thereof, wherein:
R1-R4 are each independently H, hydroxyl, alkyl, alkoxy, aminocarbonyl, or halogen;

R5 is H, alkyl, aryl, aralkyl, or aminocarbonyl;

A represents —N?C(R15)— (wherein a bond at the left end bonds to the benzene ring of formula I above and a bond at the right end bonds to the nitrogen
heteroatom of formula I above) or —NH—CH(R15)— (wherein a bond at the left end bonds to the benzene ring of formula I above and a bond at the right end bonds to the nitrogen
heteroatom of formula I above);

R15 is represented by formula II:


wherein:
R6-R9 are each independently H, hydroxyl, alkyl, or alkoxy;

R10-R14 are each independently H, hydroxyl, alkyl, alkoxy, or aminocarbonyl; and

X is O, S or N(H).
US Pat. No. 9,173,932

VIBRIO CHOLERAE O139 CONJUGATE VACCINES

The United States of Amer...

1. A method for preparing a conjugate molecule, comprising:
(a) contacting capsular polysaccharide of Vibrio cholerae O139 with adipic acid dihydrazide in the presence of a carboxyl activating reagent; and

(b) contacting the product of (a) with a recombinant diphtheria toxin mutant comprising CRMH21G in the presence of a carboxyl
activating reagent, thereby preparing the conjugate molecule comprising capsular polysaccharide of Vibrio cholerae O139, covalently bound with adipic acid dihydrazide to the recombinant diphtheria toxin mutant CRMH21G which functions as
a carrier protein, in which the toxin is covalently bound to the polysaccharide by coupling with a dicarboxylic acid dihydrazide
linker and wherein the dicarboxylic acid dihydrazide linker comprises adipic acid dihydrazide, whereby, the conjugate elicits
serum antibodies vibriocidal to at least Vibrio cholerae O139.

US Pat. No. 9,236,786

APPARATUS AND METHODS FOR MITIGATING ELECTROMAGNETIC EMISSIONS

The United States of Amer...

1. An electromagnetic field mitigation system comprising:
a linear alternator comprising:
magnets movable along a path; and
an alternator coil positioned about the magnets and configured to generate an electromotive force, resulting in a first magnetic
field;

a mechanism coupled to the linear alternator to oscillate the magnets along the path; and
a mitigating coil positioned about the linear alternator and configured to generate a second magnetic field, wherein the second
magnetic field is configured to cancel out an externally emitted portion of the first magnetic field.

US Pat. No. 9,244,791

FUSION OF MULTIPLE MODALITIES FOR DETERMINING A UNIQUE MICROELECTRONIC DEVICE SIGNATURE

The United States of Amer...

1. A test system apparatus for measuring a plurality of multiple test modalities and determining a defective or counterfeit
microelectronic device, comprising:
an electronic test board or fixture having a plurality of I/O pins adapted to couple with a device under test (DUT), said
electronic test board or fixture further comprises a sensor array including a plurality of electromagnetic EM sensors adapted
to be movable to cover specific areas of interest of said DUT;

a first testing modality apparatus comprising a plurality of differential amplifiers comprising a time domain and signal domain
signal analysis section, wherein the said differential amplifier coupled to an oscilloscope used to measure power signature
data (PSD) as current versus time across a resistor in series with said DUT and a power supply during interrogation;

a second testing modality apparatus comprising a plurality of electrical automatic test equipment (ATE) providing stimulation
to said DUT through said test board or fixture, said ATE is operable to acquire internal timing properties, voltage thresholds,
and correct functional operation characteristics from said DUT;

a third testing modality comprising a plurality of E-field or H-field probes that measure a particular EM emission pattern
generated from said DUT, the EM signature data comprising a field emission map in a frequency or time domain;

a fourth testing modality comprising a plurality of infrared (IR) imagers that captures a plurality of thermal signature data
of said DUT surface;

a fifth testing modality comprising a plurality of voltmeters providing a plurality of current versus voltage curve data by
injecting voltage into one or more sections of said DUT and measuring a resulting current;

a sixth testing modality comprising a plurality of electrostatic discharge (ESD) test equipment which can apply a pulse for
measurement by one or more said EM sensors coupled with said DUT or with said oscilloscope providing one or more per pin pulse
responses; and

an seventh testing modality comprising a plurality of JTAG controllers used to set or read levels on said I/O pins via boundary
scan, initiate logic built-in self-test (LBIST) or program internal memory.

US Pat. No. 9,459,776

DEVICE FOR USE IN STUDIES INVOLVING MULTIPLE SUBJECTS TO RECORD OBSERVATION DATA IN AN OUTPUT FILE

The United States of Amer...

1. A device for use in studies involving multiple subjects to record observation data in an output file, comprising:
a display for displaying a plurality of subject buttons, start time buttons, and observation buttons within a graphical user
interface;

the plurality of subject buttons for selecting a subject for which observation data will be recorded wherein said subject
buttons have an ON condition and an OFF condition responsive to a user input to the device via a selection mechanism such
that when a subject button is selected it is set to the ON condition and all other subject buttons are set to the OFF condition;

the plurality of start time buttons corresponding to said plurality of subject buttons for selecting a subject such that each
subject button has an associated start time button, and wherein said start time buttons are initially set to a value of zero
elapsed time, and wherein selection of a start time button by a user input to the device via the selection mechanism causes
the start time button thus selected to track and display the elapsed time for the corresponding subject since said start time
button was selected; and

the plurality of observation buttons corresponding to pre-defined and different observation data established by a user wherein
selection of an observation button by a user input to the device via the selection mechanism causes the observation button
thus selected to record in the output file the pre-defined and different observation data associated with the observation
button thus selected and the elapsed time when the observation button was selected as measured by the time start button associated
with the subject button in the ON condition, so that a plurality of observations can be recorded for each subject during the
same study by selecting the subject button for that subject so that it is set to the ON condition and then selecting the observation
button for the observed data for that subject;

upon selection of the start time button by the user input to the device via the selection mechanism, displaying on the start
time button thus selected the elapsed time for the corresponding a subject since said start time button was selected; and

upon selection of the observation button by the user input to the device via the selection mechanism, recording in the output
file the pre-defined observation data associated with the observation button thus selected and the elapsed time when the observation
button was selected as measured by the time start button associated with the subject button in the ON condition.

US Pat. No. 9,230,717

UNIVERSAL CABLE JACKET REMOVAL TOOL

The United States of Amer...

8. An apparatus for incising a cable, the apparatus comprising:
a Kellum gripping device;
a ratcheting device;
at least two wires connecting said Kellum gripping device and said ratcheting device; and
a blade assembly adjoining said ratcheting device and interposed between said ratcheting device and said Kellum gripping device,
said blade assembly including a vertical V-notched plate, a horizontal bar, and at least three wheel blades, said V-notched
plate having an upwardly open V-notch geometrically describing an isosceles triangle lying in a vertical plane and having
two equal sides, a horizontal base above the two equal sides, and a vertical bisector between the two equal sides, said horizontal
bar attached to said V-notched plate and extending across the V-notch, the three wheel blades spaced apart so as to respectively
correspond to the two equal sides and horizontal base of the isosceles triangle, each wheel blade rotatable perpendicular
to the geometric plane;

wherein, while a cable is secured by the Kellum gripping device and is positioned through the V-notch with the wheel blades
contacting the cable, ratcheting of the wires by the ratcheting device causes the ratcheting device together with the blade
assembly to approach the Kellum gripping device, the wheel blades thereby incising the cable to form three parallel cable-lengthwise
cuts in the cable.

US Pat. No. 9,067,385

HIGH KINETIC ENERGY PENETRATOR SHIELDING AND HIGH WEAR RESISTANCE MATERIALS FABRICATED WITH BORON NITRIDE NANOTUBES (BNNTS) AND BNNT POLYMER COMPOSITES

Jefferson Science Associa...

1. A method for manufacturing an impact resistant material, comprising:
synthesizing a boron containing nanomaterial/polymer material from a boron containing nanomaterial, wherein the boron containing
nanomaterial comprises boron, nitrogen, carbon and hydrogen, and a matrix by controlled dispersion of the boron containing
nanomaterial into the matrix; and

applying the synthesized material to an object to be protected from impact.

US Pat. No. 9,293,272

FUSE TO CIRCUIT BREAKER ADAPTER

The United States of Amer...

1. A circuit breaker adapter for use in a fuse holder having at least one pair of gripping clips, comprising:
a modified circuit breaker including at least two pronged terminals,
wherein a first pronged terminal comprises a pivotally attached first arcuate conductive articulable extension, and a second
pronged terminal comprises a pivotally attached second arcuate conductive articulable extension;

a housing comprising an insulating and supportive contiguous block of material for receiving the modified circuit breaker
and said at least one pair of gripping clips of the fuse holder,

wherein said housing comprises a left top side, a right top side, a left end side, a right end side, a bottom side, and center
chute shaped section, which includes a right side, a left side, a right ledge, a left ledge, a lower channel with a lower
second right side, a lower second left side, a floor, and a pair of accessible open cavities inside the housing,

wherein each of the pair of accessible open cavities is configured to receive, respectively, a gripping clip of said at least
one pair of gripping clips, to grip one of the first articulable extension and the second articulable extension,

wherein a right socket on the right ledge and a left socket on the left ledge respectively receive the pivotally attached
first arcuate conductive articulable extension and the pivotally attached second arcuate conductive articulable extension,

wherein both said extensions are rotated outboard into one of the accessible open cavities, and
wherein an inboard corner of each of the extensions is rounded to permit rotation of each of said both said extensions and
avoid impingement of the modified circuit breaker.

US Pat. No. 9,230,055

METHOD OF OPTIMIZING FILM COOLING PERFORMANCE FOR TURBO-MACHINERY COMPONENTS

The United States of Amer...

1. A method of optimizing film cooling performance for turbomachinery components, the method comprising:
defining a set of cooling hole designs, each design consisting of a predefined hole pattern including a plurality of different
film cooling row patterns and placements which are a representative subset of a cooling hole pattern of an implementation
pattern, and within each pattern there is axial and radial hole location variability;

defining a design space by selecting process variables and limits for film cooling of turbomachinery components;
defining sectors throughout the high pressure surface of a turbine vane,
providing a random initial population of pressure side turbine vane cooling designs derived from the set of cooling hole designs
by placing the implementation pattern represented by the predefined hole pattern of the cooling hole designs in any one of
the sectors of the turbine vane;

evaluating the film cooling performance of each design of the initial population of cooling designs;
vary the process variables across the design space while iteratively performing in order:
determining a fitness function value based on predicted heat transfer performance from 3-D CFD of each of the evaluated designs
of the population of cooling designs,

selecting a half of the population of cooling designs having higher fitness function values,
randomly pairing designs of the selected half of the population of cooling designs to generate two new designs from each random
pair of designs forming a new population of cooling designs,

evaluating the film cooling performance of each design of the new population of cooling designs; and
selecting a set of the cooling designs that maximizes cooling effectiveness and minimizes area-averaged heat transfer over
the high pressure surface side of the turbine vane.

US Pat. No. 9,371,140

SYSTEM AND METHOD FOR PROVIDING A REAL TIME AUDIBLE MESSAGE TO A PILOT

The United States of Amer...

1. A method for providing an audio message to an aircraft crew while in-flight by use of a computer installed in the aircraft,
comprising:
providing a set of screening parameters to screen messages, the screening parameters including at least one of target word
and target phrase;

receiving a text message while in-flight via a communication interface of the computer;
filtering the received text message based on the set of screening parameters to select a message that includes at least one
of the target word and target phrase; and

presenting the selected message as an audio message.

US Pat. No. 9,090,950

ABNORMAL GRAIN GROWTH SUPPRESSION IN ALUMINUM ALLOYS

The United States of Amer...

1. A process for suppressing abnormal grain growth in welded aluminum alloys comprising:
(a) providing an article comprising an aluminum alloy;
(b) friction-stir-welding the article under effective friction-stir-welding conditions;
(c) inserting an intermediate annealing treatment (“IAT”) using an inert gas after the welding step on the article under effective
intermediate annealing conditions, wherein the IAT is performed at a temperature of 470° C. for at least 48 hours and the
inert gas is selected from the group consisting of nitrogen, noble gases, and combinations thereof lower than a solvus line
on a phase diagram for the aluminum alloy;

(d) conducting solution heat treatment on the article under effective solution heat treatment conditions immediately after
the IAT; and

(e) recovering the article characterized with greater than about 90% reduction in area fraction abnormal grain growth in any
friction-stir-welded nugget.

US Pat. No. 9,239,997

REMOTE ENVIRONMENTAL AND CONDITION MONITORING SYSTEM

The United States of Amer...

1. A maintenance system comprising:
a plurality of containers, each of the containers being sealed and receiving a payload, each payload being sensitive to environmental
conditions;

a plurality of sensors received within each of the containers;
wherein the sensors are configured to detect temperature and humidity within the container, and the sensors are further configured
to detect vibration and shock on the container;

at least one logging device in communication with the sensors and configured to receive readings of detected temperature,
humidity, vibration and shock from the sensors;

wherein the logging device is configured to store a plurality of successive readings of detected temperature, humidity, vibration
and shock from the sensors for multiple years;

wherein the logging device interfaces with the sensors from each of the containers;
wherein the logging device is configured to output the readings of detected temperature, humidity, vibration and shock from
the sensors to a computer program;

wherein the computer program is configured to compare the readings with known allowable levels for the payload in the container
and produce a result indicating a likelihood of failure within each respective said payload within each separate container
on a real time basis as a status indicator of the respective payload;

wherein the computer program is further configured to display the status indicator of the payload for all of the containers;
and

wherein an operator of the computer program determines which payload to utilize based upon the status indicator of the payload.
US Pat. No. 9,217,134

APTAMER DRUG FOR DETOXIFICATION OF STAPHYLOCOCCUS AUREUS ALPHA-TOXIN

The United States of Amer...

1. An aptamer that binds to Staphylococcus aureus alpha toxin and reduces its cytolytic and cytotoxic effects, wherein the aptamer comprises a nucleotide sequence selected
from the group consisting of SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12.

US Pat. No. 9,228,730

VARIABLE RADIUS MULTI-LAMP ILLUMINATION SYSTEM

THE UNITED STATES OF AMER...

1. An adjustable lighting apparatus comprising:
a rigid frame being square and having a geometric frame center;
a plurality of pulleys attached to the frame, with each of the pulleys being rotatable about its own axis of rotation;
a plurality of lamps, with each of the lamps being attached to one of the pulleys by means of a rigid lamp arm;
a belt being in frictional contact with the pulleys and a drive pulley, wherein the drive pulley is for synchronously rotating
the pulleys about their respective axes of rotation and, therefore, synchronously rotating the lamps about the axes, respectively;

each of the lamps traversing an angle from a respective starting point when rotated;
the lamps being at an equal radial distance from the geometric frame center and the respective angles being equal at every
rotational position;

an identical point on each of the lamps, and a locus being formed by each of the identical points when the lamps are rotated
about the pulley axes, respectively;

the loci forming respective arcs; and
the arcs lying in a plane.

US Pat. No. 9,285,354

SYSTEMS AND METHODS FOR THE DETECTION OF LOW-LEVEL HARMFUL SUBSTANCES IN A LARGE VOLUME OF FLUID

The United States of Amer...

1. A method for the detection of low-level harmful substances in a volume of fluid comprising:
a) using a concentrator system to perform a method comprising:
i) pumping at least 10 liters of fluid from a sample source through a filter and back into said sample source; said filter
preventing the passage of at least one harmful substance;

ii) diverting retentate from said filter into a container that is separate from said sample source;
iii) recirculating at least part of said retentate in said container again through said filter;
iv) circulating air to and from said container through an air filter;
v) preventing the release of said retentate out of said concentrator system;
vi) controlling the speed of a pump with a control system thereby maintaining a fluid pressure less than 25 PSI during said
pumping of said fluid;

vii) monitoring the quantity of retentate within said container with a control system and maintaining the quantity of retentate
within a predetermined range comprising:

(1) detecting a value of the volume or weight of said retentate;
(2) controlling the amount of retentate diverted in said step of diverting retentate; and
(3) selectively drawing in additional fluid from said sample source in order to maintain said quantity of retentate within
said container within said predetermined range; and

b) analyzing said retentate for the presence of at least one harmful substance.
US Pat. No. 9,346,875

THERAPY FOR FILOVIRUS INFECTION

Albert Einstein College o...

1. An isolated humanized anti-filovirus glycoprotein pre-fusion core antibody comprising a framework region having a sequence
of 95% or greater identity to a human antibody framework region, and comprising
(a) a heavy chain CDR1 comprising GFAFNYYDM/I/LH (SEQ ID NO:1); a heavy chain CDR2 comprising YINPGGGNTYYADSV (SEQ ID NO:2);
and a heavy chain CDR3 comprising QLYGNSFMDY (SEQ ID NO:3), and

(b) a light chain sequence, comprising a light chain CDR1, CDR2 and CDR3, wherein the light chain comprises DIQMTQSPSSLSASVGDRVTITCK/R/QASQDVTTAVAWYQQKPGKAPKL
(SEQ ID NO:12) and LIYAASRLHNGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ (SEQ ID NO:14) and wherein the CDR3 comprises HYSTPLT (SEQ
ID NO:5).

US Pat. No. 9,334,522

AGENTS AND METHODS TO ELICIT ANTI-TUMOR IMMUNE RESPONSE

THE TRUSTEES OF COLUMBIA ...

1. A method for making CD8+ T-cells which do not require co-stimulation in order to become activated and proliferate, the method comprising:
(a) providing CD8+ T-cells, and

(b) reducing Cbl-b activity in the CD8+ T-cells, thereby creating CD8+ T cells which do not require co-stimulation to become activated and proliferate.

US Pat. No. 9,119,757

SELF LEVELING WALKER

The United States of Amer...

16. A self leveling walker retrofit kit for mounting on an existing separate frame assembly of a walker comprising:
a leveling assembly, said leveling assembly comprising at least:
a plurality of leveling components;
a single activation mechanism both for controlling and effectuating automatic, continuous fluid flow directed extension and
retraction of plurality of leveling components in tandem together in a synchronized, simultaneous fashion.

US Pat. No. 9,083,449

METHOD AND SYSTEM FOR OPTIMIZING SIGNAL RECOGNITION IN A MULTIWAVELENGTH OPTICAL COMMUNICATION SYSTEM

The United States of Amer...

1. A method for optimizing signal recognition in a multiwavelength optical communication system by approximately maximizing
the minimum distance between received constellation points; the method comprising:
identifying the constellation region containing points representing signals having multiple wavelengths for transmitting symbols;
identifying channel impairments;
transforming the constellation region according to the channel impairments into a constellation region of potential received
symbols;

using signal processing circuitry, applying an algorithm which operates to maximize the minimum distance between constellation
points to obtain a symbol constellation in the receiver constellation region; and

inverting the transformation to obtain the designed transmitted-symbol constellation.

US Pat. No. 9,264,809

MULTITASK LEARNING METHOD FOR BROADBAND SOURCE-LOCATION MAPPING OF ACOUSTIC SOURCES

THE UNITED STATES OF AMER...

1. A method comprising the steps of:
determining a grid of G tentative locations rg of one or more K acoustic sources;

using an acoustic model to predict replicas caused by simulated acoustic sources at locations in , wherein the replicas are Fourier coefficient vectors at F frequencies {?f}f=1F corresponding to the acoustic pressure field as sampled by an acoustic sensor array having N sensors;

collecting, using the acoustic sensor array, time series data of actual acoustic measurements at each sensor of the acoustic
sensor array due to the acoustic sources;

using a discrete-time Fourier transform (DFT) on the collected time series data partitioned to m blocks to compute Fourier
coefficients at frequencies {?f}f=1F for all sensors;

constructing DFT coefficient vectors ym,f?N, ?m,f using the Fourier coefficients previously obtained via the DFT;

modeling DFT coefficient vectors at ?f for the m-th measurement block of the collected time series data as ym,f=?g=1Gsg,f(pg,f+vg,f)+?m,f, ?m, f, where sg,f denotes the acoustic gain at ?f for a source located at rg, pg,f?N is the replica for ?f corresponding to a source located at rg normalized so that ?pg,f?2=1, vg,f?N is an unknown perturbation vector effecting pg,f, and ?m,f denotes the Fourier coefficients at ?f corresponding to the noise in the m-th block;

discarding locations within from a set of tentative source locations via a regression-coefficient screening procedure that depends on the available measurements,
desired sparsity level, and specific form of an estimator for a complex-valued matrix S comprising all regression coefficients
{sg,f};

estimating S as
where, for a given ?f, Yf:=[y1,f, . . . yM,f] comprises all MDFT Fourier coefficient vectors, Pf:=[p1,f, . . . , pG,f]?N×G comprises all normalized replicas corresponding to locations in where ?pg,f?2=1, ?g, f, Vf:=[v1,f, . . . , vG,f]?N×G is a complex-valued matrix comprising all perturbation vectors for ?f, ? is a tuning parameter controlling sparsity of the groups formed by the rows of S, çg:=[sg,1, . . . , sg,F]??F comprises the vector corresponding to the g-th row of S, sf:=[s1,f, . . . , sG,f]??F comprises the vector corresponding to the f-th column of S, 1M? an M×1 vector of ones, and q?(1, ?]; and
constructing one or more SLMs over per frequency ?f using ?, wherein each location on a particular SLM is associated with its corresponding acoustic gain estimate ?g,f, wherein estimates of the actual locations of the K acoustic sources correspond to the locations of the K-largest in magnitude
coefficients ?g,f depicted in the SLM.

US Pat. No. 9,227,719

REACTIVE ORTHOTROPIC LATTICE DIFFUSER FOR NOISE REDUCTION

The United States of Amer...

1. A flap of the type that is movably connected to an aircraft wing to provide control of an aircraft in flight, the flap
comprising:
an elongated flap structure defining inboard and outboard ends and forward and rearward portions extending between the inboard
and outboard ends, the elongated flap structure defining an upper side extending between the inboard and outboard ends and
between the forward and rearward portions, and a lower side, wherein the upper side generally faces upwardly in use, and the
lower side generally faces downwardly in use, and wherein the inboard end defines an inwardly-facing inboard end surface and
the outboard end defines an outwardly-facing outboard end surface, and wherein the upper and lower sides define inboard and
outboard end portions adjacent the inboard and outboard end surfaces, respectively, that tend to generate noise to form a
noise source in use, and wherein:

at least a portion of at least one of the inboard and outboard end surfaces and at least one of the inboard and outboard end
portions of the upper and lower sides include a perforated portion having perforations that are connected to corresponding
perforations internal to the flap, wherein the internal perforations are located within at least one of the inboard and outboard
end portions, wherein the internal perforations comprise an approximately orthogonal lattice arrangement, and wherein the
connecting corresponding perforations comprise the substantially same cross-sectional shape and dimensions.

US Pat. No. 9,248,501

METHOD FOR ADDITIVE MANUFACTURING USING PH AND POTENTIAL CONTROLLED POWDER SOLIDIFICATION

The United States of Amer...

1. A powder consolidation method, comprising:
contacting a metal-containing powder comprising metal particles with an acidic or basic liquid at a pH and in a potential
range at which dissolution of metal from the particles and reduction of soluble metal-containing ions to reduced metal on
surfaces of the particles occur such that the metal particles are bound together by the reduced metal to form a body.

US Pat. No. 9,186,270

DYNAMIC EXOSKELETAL ORTHOSIS

The United States of Amer...

1. An orthosis, comprising:
a proximal cuff comprising at least one hinge along an upper edge of the cuff forming a proximal fixed axis point;
an ankle section/footplate; and
at least one posterior strut attached at a proximal end to the proximal cuff and attached at a distal end to the ankle section/footplate,
thereby forming a vertical axis between the proximal cuff and the ankle section/footplate,

wherein the at least one hinge allows part of a lower edge of an anterior portion of the proximal cuff to open in a direction
upward and away from said vertical axis via the proximal fixed axis point while a posterior portion of the proximal cuff maintains
its position.

US Pat. No. 9,356,341

AEROGEL-BASED ANTENNAS FOR AEROSPACE AND TERRESTRIAL APPLICATIONS

The United States of Amer...

1. An antenna, comprising:
a substrate portion; and
a metallized portion capable of receiving and/or transmitting an electromagnetic signal, the metallized portion being deposited/grown
onto the substrate portion;

where the substrate portion is a polymer aerogel consisting entirely of polymer material.
US Pat. No. 9,243,150

OXIDE COATED METAL PIGMENTS AND FILM-FORMING COMPOSITIONS

The United States of Amer...

1. Electrochemically corrosion-resistant compositions for application onto metal substrates in amounts ranging up to ten mils
consisting essentially of, in parts by weight, from about:
5 to 80 parts of lubricating grease, from about
0.1 to 10 parts of at least one organic corrosion inhibitor, from about
0.1 to 5.0 parts or a surfactant, from about
1.0 to 5.0 parts of an organic solvent, and from about
20-80 parts of a sacrificial-metal pigment having a particle size ranging from about 2 to 100 microns; said metal pigment
coated with an effective amount of metal oxides derived from an acidic aqueous solution consisting essentially of from about:

0.01 to 22 parts of a trivalent chromium compound, from about
0.01 to 12 parts of hexafluorozirconate, from about
0.01 to 12 parts of at least one fluorocarbon, from about
0.0-12 parts of a divalent zinc compound, and from about
0.0-5 parts by weight of water soluble corrosion inhibitor.

US Pat. No. 9,497,846

PLASMA GENERATOR USING SPIRAL CONDUCTORS

The United States of Amer...

1. A plasma generator, comprising:
a first electrical conductor having first and second ends, said first electrical conductor shaped to form a first spiral between
said first and second ends thereof, said first spiral lying in a first plane, said first spiral having a geometric center,
said first electrical conductor so-shaped having inductance and capacitance wherein, in the presence of a time-varying electromagnetic
field, said first electrical conductor so-shaped resonates to generate a harmonic electromagnetic field response;

a second electrical conductor having first and second ends, said second electrical conductor shaped to form a second spiral
between said first and second ends thereof, said second spiral being identical to said first spiral and lying in a second
plane parallel to said first plane, said second spiral having a geometric center, said second electrical conductor so-shaped
having inductance and capacitance wherein, in the presence of a time-varying electromagnetic field, said second electrical
conductor so-shaped resonates to generate a harmonic electromagnetic field response;

said first spiral and said second spiral partially overlapping one another in a direction perpendicular to said first plane
and said second plane;

said geometric center of said first spiral and said geometric center of said second spiral defining endpoints of a line, wherein
said line is non-perpendicular with respect to said first plane and said second plane;

dielectric material disposed between said first electrical conductor and said second electrical conductor; and
a voltage source coupled across said first electrical conductor and said second electrical conductor for applying a voltage
sufficient to generate a plasma in at least a portion of said dielectric material.

US Pat. No. 9,279,915

SELF PATTERNING PLASMONIC ARRAY STRUCTURES

The United States of Amer...

1. A plasmonic structure(s), comprising:
a self patterning copolymer array including at least two distinct hydrophobic and hydrophilic homopolymer blocks, wherein
said copolymer having a surface generated by using polymer processing procedures, wherein said homopolymer blocks have complimentary
surface functionality, wherein said hydrophobic homopolymer blocks without hydroxylated or carboxylated functionalities that
reject incident gas phase precursors or hydrophilic homopolymer blocks having hydroxylated or carboxylated functionalities
that accept incident gas phase precursors, wherein said surfaces of said homopolymers will either bond or reject gas phase
precursors based on said surface functionality; and wherein said surface of said homopolymers were subjected to gas phase
precursors for inorganic materials allowing deposition of said inorganic material on at least one homopolymer with at least
one homopolymer rejecting deposition.

US Pat. No. 9,067,325

HUMAN GRASP ASSIST DEVICE SOFT GOODS

GM Global Technology Oper...

13. A grasp assist system comprising:
a glove constructed at least partially of elastane fiber, and having:
a plurality of fingers;
a thumb;
a force sensor positioned with respect to the thumb, wherein the force sensor is configured to measure a grasping force applied
to an object by an operator wearing the glove;

an adjustable wrist strap;
a plurality of adjustable phalange rings, wherein a different pair of the adjustable phalange rings is positioned with respect
to the proximal and medial phalanges of a corresponding one of the fingers;

a plurality of arcuate saddles, wherein a different one of the saddles is positioned at one of the medial and the distal phalanges
of the corresponding fingers;

flexible tendons each having a first end connected to a corresponding one of the saddles;
a plurality of conduits, wherein each of the conduits contains a corresponding one of the tendons; and
a conduit anchor attached to the glove, wherein the conduit plastic anchor receives the conduits therein via a first set of
openings and allows the tendons to pass through the conduit anchor via another set of openings; and

a flexible sleeve that is wearable on a forearm of the operator, wherein the sleeve includes:
a plurality of motorized actuator assemblies, wherein each of the assemblies is connected to a second end of a corresponding
one of the flexible tendons and is contained in a pocket of the sleeve; and

a controller in communication with the force sensor, wherein the controller is configured to calculate a tensile force in
response to the measured grasping force, and to command the tensile force from at least one of the actuator assemblies.

US Pat. No. 9,187,457

LOW MOLECULAR WEIGHT THYROID STIMULATING HORMONE RECEPTOR (TSHR) AGONISTS

The United States of Amer...

1. A compound having formula I:

or a pharmaceutically acceptable salt thereof, wherein:
R1-R4 are each independently H, hydroxyl, alkyl, alkoxy, aminocarbonyl, or halogen;

R5 is —CH2-Ph, wherein Ph is a substituted phenyl;

A represents —N?C(R15)— (wherein a bond at the left end bonds to the benzene ring of formula I above and a bond at the right end bonds to the nitrogen
heteroatom of formula I above) or —NH—CH(R15)— (wherein a bond at the left end bonds to the benzene ring of formula I above and a bond at the right end bonds to the nitrogen
heteroatom of formula I above);

R15 is represented by formula II:


wherein:
R6-R9 are each independently H, hydroxyl, alkyl, or alkoxy;

R10, R11, R13 and R14 are each independently H;

R12 is acetamido; and

X is O, S or N(H).

US Pat. No. 9,486,140

COHERENCE GATED DOPPLER MOTION SENSOR AND MEDICAL APPLICATIONS

University of Maryland, B...

1. An apparatus comprising:
an optical source of light comprising a band of wavelengths with a bandwidth that is in a range between 0.1% and 2.9% of a
center wavelength of the band of wavelengths;

an optical detector;
a first optical coupler configured to direct light from the optical source through an emission optical path that terminates
at a distal end in a single probe tip;

a second optical coupler configured to direct onto the optical detector scattered light returning from the single probe tip
through a return optical path; and

a presentation device configured to output a signal that indicates motion in a target volume of a sample in a vicinity of
the single probe tip based on a Doppler shift between the light from the light source and the scattered light received at
the detector through the single probe tip,

whereby the target volume is based on a coherence distance determined by the bandwidth of the band of wavelengths of the light
from the optical source.

US Pat. No. 9,351,981

USE OF PKC-IOTA INHIBITORS FOR THE TREATMENT OF BREAST CANCER

UNIVERSITY OF SOUTH FLORI...

1. A method of treating breast cancer or tumor comprising administering, to a subject in need of such treatment, an effective
amount of a PKC-iota inhibitor, and, optionally, a pharmaceutical acceptable carrier, wherein the PKC-iota inhibitor is 1H-imidazole-4-carboxamide,5-amino-1-[2,3-dihydroxy-4-[(phosphonoxy)methyl]cyclopentyl],[1R-(1?,
2?, 3?, 4?)] or a salt thereof.

US Pat. No. 9,299,025

CASE-BASED REASONING SYSTEM USING CASE GENERALIZATION METHOD

THE UNITED STATES OF AMER...

1. A computer-implemented method comprising the steps of:
setting an error ratio threshold;
comparing a user-specified context comprising one or more natural language contextual antecedents to a plurality of cases
stored in a case base, each case stored in the case base comprising one or more case antecedents and one or more case consequents;

determining if a matching case exists in the case base, wherein the matching case is the case having case antecedents that
exactly match the contextual antecedents;

selecting the matching case if it exists, else selecting a best matching case, wherein the step of selecting a best matching
case includes generalizing the case antecedents of the cases stored in the case base and comparing the user-specified context
to the cases stored in the case base having generalized antecedents to determine the best-matching case, wherein the generalization
of the case antecedents involves minimizing |Si?context|/|Si|, where Si is a situational variable representing a case antecedent and the context is the contextual antecedents, wherein the best matching
case is the case having the highest ratio of matching case antecedents to contextual antecedents and having a matching error
ratio that does not exceed the error ratio threshold; and

displaying the case consequents of the selected case to a user.

US Pat. No. 9,283,468

METHOD AND APPARATUS FOR PERFORMANCE OPTIMIZATION THROUGH PHYSICAL PERTURBATION OF TASK ELEMENTS

The United States of Amer...

11. A method for encouraging self-regulation of a physiological state consistent with the optimal performance of a task comprising
the steps of:
a. positioning a trainee within a task environment having a surface;
b. positioning a target, having a variable area for the receipt of a projectile, within said task environment at a distance
from said trainee;

c. equipping said trainee with a biofeedback device that is worn by said trainee;
d. equipping said trainee with a task device with which to cast said projectile at said target;
e. connecting said trainee to at least one biosensing device that is an operative component of said biofeedback device worn
by said trainee;

f. using said biosensing device to measure said trainee's physiological state by measuring at least one physiological signal
of said trainee;

g. outputting said measurement of said trainee's physiological state obtained by said biosensing device as a signal encoding
said at least one measured value of said physiological signal to a computing device;

h. using said computing device to compare said measured value of said physiological signal output to said computing device
by said biosensing device to a preprogrammed, or downloaded, or trainee-input corresponding value of a physiological signal
that is optimally consistent with the successful performance of said task by said trainee, termed a physiological target value;

i. using said computing device to compute a physiological difference value as the absolute value of a difference between said
measured value of said physiological signal and said corresponding value of a physiological signal that is optimally consistent
with said successful performance of said task by said trainee;

j. displaying said physiological difference value to said trainee by means of an auditory or tactile display device that is
an operative component of said biofeedback device;

k. using said computing device to transmit said physiological difference value as an encoded signal to at least one computer-controlled
mechanical system;

l. providing said task environment with a surface operationally connected to a first computer-controlled mechanical system
adapted to impart a vibration or undulation to said surface, said vibration or undulation having a frequency or an amplitude,
or both, that increase as said physiological difference value increases, said physiological difference value being received
by said computer-controlled mechanical system as encoded in a signal that is transmitted to said computer-controlled mechanical
system by said computing device;

m. providing said task environment with a surface operationally connected to a second computer-controlled mechanical system
adapted to vary a gradient of said surface in proportion to said physiological difference value by means of a computer-controlled
mechanical system adapted to increase said gradient as said physiological difference value increases, said physiological difference
value being received by said computer-controlled mechanical system as encoded in a signal that is transmitted to said computer-controlled
mechanical system by said computing device;

n. providing said target with a third computer-controlled mechanical system adapted to decrease said variable area as said
physiological difference value increases, said physiological difference value being received by said computer-controlled mechanical
system as encoded in a signal that is transmitted to said computer-controlled mechanical system by said computing device;

o. providing said task device used by said trainee to cast said projectile at said target with a fourth computer-controlled
mechanical system adapted to impart a vibration or undulation to said task device, said vibration or undulation having a frequency
or an amplitude, or both, that increase as said physiological difference value increases, said physiological difference value
being received by said computer-controlled mechanical system as encoded in a signal that is transmitted to said computer-controlled
mechanical system by said computing device;

p. making said distance from said trainee to said target proportional to said physiological difference value by means of a
fifth computer-controlled mechanical system adapted to increase said distance as said physiological difference value increases,
said physiological difference value being received by said computer-controlled mechanical system as encoded in a signal that
is transmitted to said computer-controlled mechanical system by said computing device.

US Pat. No. 9,216,213

ADJUVANTED RABIES VACCINE WITH IMPROVED VISCOSITY PROFILE

MERIAL, INC., Duluth, GA...

1. A single-dose adjuvanted Rabies virus vaccine composition consisting essentially of an attenuated recombinant Orthopox
or Avipox viral vector and a trimethylated chitosan (TMC) adjuvant, wherein the vector expresses in an animal host a full-length
G protein from the ERA Rabies virus strain; and
wherein the TMC is present in an amount at about 2.5% w/v;
wherein the presence of the adjuvant is associated with both increased viscosity and increased protective efficacy against
subsequent experimental or natural challenge with virulent Rabies virus, as compared to an otherwise equivalent composition,
wherein the adjuvant has been omitted; and

wherein the single-dose elicits in at least 90% of the animals protective levels of Rabies virus specific neutralizing antibodies
within 90 days of administration of the single-dose composition.

US Pat. No. 9,120,224

FRAMEWORK AND METHOD FOR CONTROLLING A ROBOTIC SYSTEM USING A DISTRIBUTED COMPUTER NETWORK

GM Global Technology Oper...

1. A robotic system operable for performing an autonomous task, the robotic system comprising:
a humanoid robot having a plurality of integrated system components, including a plurality of compliant robotic joints, actuators
adapted for moving the robotic joints, and sensors adapted for measuring feedback data of the integrated system components
including the plurality of joints; and

a multi-level distributed control framework (DCF) adapted for controlling the integrated system components over multiple high-speed
communication networks, including a backplane, the DCF including:

a plurality of first controllers each configured as a joint controller operable for processing the measured feedback data
within a corresponding one of the integrated system components, such that each of the first controllers controls a single
degree of freedom (DOF) of the robot, wherein each of the plurality of joint controllers is embedded in the humanoid robot
in close proximity to a respective one of the robotic joints;

a second controller in the form of a brainstem having a plurality of modules connected to the backplane, wherein the brainstem,
via the modules, provides reactive commands to the first controllers to command performance of the autonomous task in response
to top-level commands, and prioritizes actions of the robot for the autonomous task by assigning a required communications
speed to each of the actions and

a third controller in the form of a system commander that is adapted for transmitting the top-level commands to the second
controller as a signal, thereby commanding performance of the autonomous task;

wherein the DCF centralizes and abstracts control data to, and the feedback data from, the integrated system components in
a single logical location such that access to the centralized control data is provided only via the system commander to facilitate
control of the humanoid robot across the multiple high-speed communication networks.

US Pat. No. 9,086,351

FIXTURE FOR SYSTEM-LEVEL GLOVE TESTING OF CONTACT PERMEATION

The United States of Amer...

1. A system for testing contact permeation of a glove, comprising:
a mannequin hand having fingers and a thumb;
a hand cradle adapted to contact a back surface of the mannequin hand and the fingers to stabilize the hand with a palm of
the hand facing outward away from the hand cradle;

a patterned weight block shaped to fit onto the palm of the mannequin hand and positioned on said palm for applying pressure
to the palm, fingers, and thumb of the hand;

a weight block disposed on an outer surface of the patterned weight block; and
an air tight containment box to receive the mannequin hand supported by the hand cradle and having the patterned weight block
on the palm of the mannequin hand and the weight block disposed on the outer surface of the patterned weight block.

US Pat. No. 9,970,782

RFID-ENABLED ANGULAR POSITION SENSING SYSTEM

The United States of Amer...

1. A system for sensing angular position, comprising:a first support;
a plurality of ring-shaped elements disposed on said first support and spaced apart from one another in a curvilinear arrangement, each of said ring-shaped elements including an electrically-conductive ring and an RFID integrated circuit electrically coupled to said electrically-conductive ring;
a second support;
an antenna coupled to said second support, said antenna defining an electrically-conductive path commensurate in size and shape to at least a portion of said electrically-conductive ring; and
an interrogator for transmitting a signal to said antenna wherein an electric current is generated along said electrically-conductive path and electromagnetic energy emanates from said antenna, wherein at least one of said ring-shaped elements and said RFID integrated circuit associated therewith is energized by said electromagnetic energy, and wherein each said RFID integrated circuit so-energized generates a data transmission for receipt by said interrogator and for further processing of an angular position of one of said first support and said second support using said data transmission.

US Pat. No. 9,083,149

NANOPARTICLE DOPED HYBRID PHOTOREFRACTIVES

The United States of Amer...

1. A photorefractive hybrid cell comprising:
a window; and
a gain media disposed adjacent the window, the gain media having a plurality of nanoparticles disposed therein,
wherein the plurality of nanoparticles are coated, and
wherein the coating includes other nanoparticles of the plurality of nanoparticles.

US Pat. No. 9,352,175

METHOD AND APPARATUS FOR PROLONGING THE SERVICE LIFE OF A COLLECTIVE PROTECTION FILTER USING A SUPPLEMENTAL BED

The United States of Amer...

1. An apparatus for extending the service life of a Collective Protection (CP) filter, the apparatus comprising:
a CP filter comprising a filter bed; and
a supplemental bed configured so as to enhance the service life of the filter bed by promoting reactions that facilitate the
removal of chemical warfare agents and toxic chemicals, wherein the supplemental bed comprises one or more of zirconium hydroxide
(Zr(OH)4) impregnated with one or more base metals and with triethylenediamine TEDA), cobalt-zirconium-zinc-triethylenediamine (Co-ZZT),
cobalt-zirconium-zinc-silver-triethylenediamine (Co-ZZAT); other zirconium-based (ZB) media impregnated with TEDA; aluminum
hydroxide impregnated with TEDA; and iron hydroxide impregnated with TEDA.

US Pat. No. 9,085,661

PHOTOMECHANICALLY ACTIVE COPOLYIMIDES DERIVED FROM AN AZOBENZENEDIAMINE, A RIGID DIANHYDRIDE, AND A FLEXIBLE DIANHYDRIDE

The United States of Amer...

1. A copolyimide having photomechanical properties and comprising an azobenzenediamine, a rigid dianhydride, and a flexible
dianhydride, the copolyimide having the general formula:

wherein Ar is at least one of 1,2,4,5-benzene (pyromellitic), 1,4,5,8-naphthalene, and 3,3?,4,4?-biphenyl; wherein R is at
least one of —C(CF3)2—, —O—, >C?O, >SO2, —OPh-C(CF3)2—PhO—, —OPh-C(CH3)2—PhO—, >C(CF3)Ph, —O(1,3-Ph)O—, and —O(1,4-Ph)O—;

wherein R? and R? are —H, —F, —Cl, or —CH3 when R? and R? are identical, or wherein R? is —H and R? is at least one of —F, —Cl, —CH3, —CF3, and —OCH3 when R? and R? are different; and

wherein 0.05?x?0.50.

US Pat. No. 9,085,302

MODULAR ROBOTIC VEHICLE

The United States of Amer...

1. A vehicle comprising:
a chassis;
a plurality of driver input devices;
an energy storage system (ESS);
at least one electronic modular assembly (eModule) that is electrically connected to the ESS, and that includes:
a drive wheel containing a by-wire propulsion-braking module configured to selectively propel and brake the drive wheel;
a mounting bracket covering a steering control assembly having at least one steering controller which controls a by-wire steering
function of the vehicle; and

a housing positioned adjacent to the mounting bracket, and containing a propulsion control assembly, a braking control assembly,
and a spring-damper assembly, wherein the propulsion control assembly and the braking control assembly include a propulsion
controller and a brake controller, respectively, which together control the by-wire propulsion-braking module; and

a master controller in communication with the at least one steering controller, the propulsion controller, and the brake controller,
and with the plurality of driver input devices, wherein the master controller is programmed to communicate with and independently
control the at least one eModule to selectively establish one of a plurality of different operating modes in response to driver
input commands from the plurality of driver input devices.

US Pat. No. 9,445,779

INFRASONIC STETHOSCOPE FOR MONITORING PHYSIOLOGICAL PROCESSES

The United States of Amer...

1. An infrasonic stethoscope for monitoring physiological processes of a patient, comprising:
a microphone capable of detecting acoustic signals in an entire frequency range of 0.03 Hertz to 1000 Hertz, the microphone
comprising a body having first and second spaced apart openings;

a body coupler attached to the first opening of the body to form a substantially air-tight seal, wherein the body coupler
is capable of engagement with the patient;

a flexible tube attached to the body at the second opening; and
an earpiece attached to the flexible tube.
US Pat. No. 9,346,858

PROTEINS WITH REPETITIVE BACTERIAL-IG-LIKE (BIG) DOMAINS PRESENT IN LEPTOSPIRA SPECIES

Cornell Research Foundati...

1. A recombinant expression vector comprising a heterologous polynucleotide molecule encoding a polypeptide comprising an
amino acid sequence greater than 90% identical to the amino acid sequence set forth as SEQ ID NO: 8.

US Pat. No. 9,498,144

SYSTEM AND METHOD FOR RECONSTRUCTING CARDIAC ACTIVATION INFORMATION

The Regents of the Univer...

1. A method of reconstructing cardiac activation information, the method comprising:
accessing, by a computing device, an analysis cardiac signal and a reference cardiac signal obtained from a patient;
processing, by the computing device, the analysis cardiac signal and the reference cardiac signal to determine a first point
of change in the analysis cardiac signal at which a derivative of the analysis cardiac signal diverges with respect to a derivative
of the reference cardiac signal, the derivative of the analysis cardiac signal and the derivative of the reference cardiac
signal being one of zero, first, and second order derivative;

processing, by the computing device, the analysis cardiac signal and the reference cardiac signal to determine a second point
of change in the analysis cardiac signal at which a different derivative of the analysis cardiac signal diverges with respect
to a different derivative of the reference cardiac signal, the different derivative of the analysis cardiac signal and the
different derivative of the reference cardiac signal being a different one of zero, first, and second order derivative; and

assigning an activation onset time in the analysis cardiac signal at a point based on a mathematical association of the first
point of change and the second point of change to define cardiac activation indicating a beat in the analysis cardiac signal.

US Pat. No. 9,120,868

RECOMBINANTLY EXPRESSED PLASMODIUM CELTOS ANTIGEN AND METHODS OF USE THEREOF

The United States of Amer...

1. A synthetic nucleic acid comprising a sequence which has been recoded by codon harmonization, and contains at least one
substitution modification relative to the naturally occurring Plasmodium CelTOS nucleic acid sequence, said synthetic nucleic acid comprising the sequence identified in SEQ ID NO:1.
US Pat. No. 9,107,932

METHODS FOR TREATING NEURAL CELL SWELLING

University of Maryland, B...

1. A method of treating a subject having brain injury or cerebral ischemia, comprising the step of administering an antagonist
of a NCca-ATP channel that blocks the channel, prevents the channel opening, and/or reduces the magnitude of membrane current through the
channel, wherein the antagonist is a sulfonylurea compound or a benzamido derivative.

US Pat. No. 9,303,717

RATE-RESPONSIVE, STRETCHABLE DEVICES

The United States of Amer...

1. A rate-dependent, elastically-deformable device comprising:
an elastically-deformable confinement member;
one or more filaments placed inside the elastically-deformable confinement member;
a fluid that substantially fills the remaining volume inside the elastically-deformable confinement member; and
one or more barbed plugs inserted into the ends of the elastically-deformable confinement member to contain the fluid and
which are mechanically attached to at least one end of one filament,

wherein the resistance force to extension of the device increases as the extension rate of the device increases.

US Pat. No. 9,264,148

TWO DIMENSIONAL PHOTONIC CLUSTER STATE GENERATOR FROM SEQUENTIAL PHOTONS WITH MULTIPLE ENTANGLEMENT GATES

The United States of Amer...

1. An apparatus for sequentially entangling photons in two dimensions, comprising:
a waveguide chip having integrated optical components and interconnecting optical waveguide disposed therein, wherein said
optical components further comprise

an input port connected to said optical waveguide for inputting said photons into said waveguide chip;
a polarization controller connected to said input port fir rotating the polarization of photons received via said input port;
a plurality of delay lines for synchronizing said photons in time;
a plurality of multimode interferometers for selectably routing said photons through any of said interconnecting optical waveguide;
a controller for switching an input mode of any of said plurality of multimode interferometers so as to route said photons
into and out of a selected interferometer's input and output ports;

a clock source for synchronizing said controller with the arrival of said photons;
a plurality of entangling gates having bypass and entangling inputs and bypass and entangling outputs for selectively entangling
said photons; and

an output port for routing said entangled photons out of said waveguide chip.

US Pat. No. 9,089,269

SYSTEM AND METHOD FOR RECONSTRUCTING CARDIAC SIGNALS ASSOCIATED WITH A COMPLEX RHYTHM DISORDER

The Regents of the Univer...

1. A system to reconstruct cardiac signals associated with a complex rhythm disorder received from a plurality of sensors
associated spatially with a patient's heart, the system comprising at least one computing device that comprises:
an analytic engine comprising:
a beat classification module configured to identify a plurality of discernible beats on high-confidence signals of sensors
that are spatially adjacent to a sensor associated with a low-confidence signal, the discernible beats on the high-confidence
signals corresponding to a non-discernible beat on the low-confidence signal;

an activation onset module configured to:
compute a time vector between at least two activation onsets associated with the identified discernible beats on the high-confidence
signals through the non-discernible beat on the low-confidence signal;

define a time interval associated with the non-discernible beat about a region of the low-confidence signal where the computed
time vector crosses the non-discernible beat, the time interval indicating how early the non-discernible beat is able to activate
based on a previous beat on the low-confidence signal that has a selected or determined activation onset and how late the
non-discernible beat is able to terminate based on at least one predetermined property; and

assign the non-discernible beat an activation onset during the defined time interval that is closest to the computed time
vector; and

a representation tool configured to generate a clinical representation associated with the complex rhythm disorder using at
least the activation onset assigned to the non-discernible beat.

US Pat. No. 9,051,177

ACTIVE OPTICAL LIMITING SEMICONDUCTOR DEVICE AND METHOD WITH ACTIVE REGION TRANSPARENT TO LIGHT BECOMING OPAQUE WHEN NOT BIASED

The United States of Amer...

1. An optical device comprising a semiconductor device, said semiconductor device comprising:
an input portion adapted to receive inputted light and an output portion adapted to output light;
an n-type region,
a p-type region;
an active region sandwiched between the p-type and n-type regions wherein either the p-type or n-type region is adjacent one
side of the active region and the other is adjacent the other side of the active region, the active region being substantially
transparent to light of a predetermined wavelength range when a bias is applied across the n-type and p-type regions and substantially
opaque to light within a predetermined wavelength range when a bias is not applied across the n-type and p-type regions.

US Pat. No. 9,392,948

SYSTEM AND METHOD OF IDENTIFYING SOURCES FOR BIOLOGICAL RHYTHMS

The Regents of the Univer...

1. A method of determining regularity associated with a rhythm disorder of a heart, the method comprising:
processing by a computing device a derivative of a first cardiac signal associated with a first location at a plurality of
first time points against a derivative of a second cardiac signal associated with a second location at a plurality of second
time points to define a plurality of coordinate pairs of the first cardiac signal against the second cardiac signal, wherein
the derivative of the first signal and the derivative of the second signal are one of a first order derivative and a higher
order derivative; and

determining by the computing device an index of regularity that exceeds a threshold, the index of regularity, associated with
periodic repeating activity, indicating an approximate congruence of the plurality of coordinate pairs among the first cardiac
signal and the second cardiac signal.

US Pat. No. 9,328,150

RECOMBINANT POLYPEPTIDE CONSTRUCT COMPRISING MULTIPLE ENTEROTOXIGENIC ESCHERICHIA COLI FIMBRIAL SUBUNITS

The United States of Amer...

1. A recombinant polypeptide construct comprising a whole or immunogenic fragment of an Escherichia coli fimbrial minor or major subunit connected to one or more major fimbrial subunits or immunogenic fragments, thereof, of the
same fimbrial type, via a polypeptide linker, and wherein each of the one or more major fimbrial subunits contain a donor
? strand and are also connected to each other via a polypeptide linker, wherein the C-terminal Escherichia coli fimbrial major subunit is connected, via a linker, to a C-terminal donor ? strand derived from a major Escherichia coil fimbrial subunit that is homologous or heterologous to the immediately N-terminal major subunit and wherein said composition
can comprise a histidine tag at the C-terminus.

US Pat. No. 9,212,877

RETENTION SYSTEM FOR A DEPLOYABLE PROJECTILE FIN

The United States of Amer...

1. A fin retention system for a projectile having a plurality of deployable fins comprising:
a plurality of fin retention units, each retention unit having an alignment device and a pair of span arms, said span arms
extending outwardly from opposite sides of said alignment device,

an attachment device positioned adjacent a free end of one of said span arms and a cooperating attachment device positioned
adjacent a free end of the other of said span arms,

wherein, with the fins of the projectile in an undeployed position, one alignment device is aligned with each fin and the
attachment device of each retention unit is attached to said cooperating attachment device of its adjacent retention unit
to lock said retention units together and simultaneously hold the fins in an undeployed position.

US Pat. No. 9,175,914

REMOTE WEAPONS CHARGING HANDLE ADAPTER

The United States of Amer...

1. A remote weapons charging handle adapter for charging a gun having a forward and a rear end, the gun being mounted in a
cradle having a linear actuator, the adapter comprising:
a flange portion fixed to the linear actuator;
a housing fixed to the flange portion, the housing having an upper rear bearing surface, a pair of side surfaces, a forward
surface, and a rear stepped surface;

a wire rope having a first end selectively engageable with one of a hard stop on the flange and a hard stop on the housing;
a second end of the wire rope extending into an upper portion of the housing through a first spring and a piston such that
the second end of the wire rope is translatable against the spring in a rear direction;

an arm block having a rear curved bearing surface and a front planar surface that bears against the rear stepped surface of
the housing;

a rod fixed eccentrically to the arm block and extending through the housing; and
a second spring disposed around the rod and bearing against the forward surface of the housing and a spring stop on an end
of the rod to thereby bias the arm block in a forward direction.

US Pat. No. 9,355,439

JOINT CONTRAST ENHANCEMENT AND TURBULENCE MITIGATION METHOD

THE UNITED STATES OF AMER...

1. A method comprising the steps of:
generating a denoised image by performing a denoising operation on an input image of an object ôk(x), the input image having turbulence and a contrast reducing scattering medium therein;

generating a contrast enhanced image from the denoised image using a contrast enhancement algorithm;
estimating a global motion vector ?g,k of the contrast enhanced image using an image alignment algorithm;

generating a contrast enhanced aligned image by globally aligning the contrast enhanced image to ?g,k and locally aligning the contrast enhanced image with an optical flow method;

temporally averaging the contrast enhanced aligned image with K frames;
generating an output image of the object ôk(x) by performing a deblur operation on the temporally averaged contrast enhanced aligned image; and

measuring turbulence using a turbulence mitigation metric (TMM).

US Pat. No. 9,329,149

WIRELESS CHEMICAL SENSOR AND SENSING METHOD FOR USE THEREWITH

The United States of Amer...

1. A wireless chemical sensor, comprising:
an electrically-insulating substrate having opposing faces;
an open-circuit pattern of electrically-conductive material on a first face of said opposing faces of said substrate, said
pattern having two electrically unconnected ends, said pattern shaped for storage of an electric field and a magnetic field,
said pattern having inductance and capacitance that allows said pattern to generate harmonic electric and magnetic field responses
when in the presence of a time-varying magnetic field, each of said electric and magnetic field responses having a frequency,
amplitude and bandwidth associated therewith; and

a material on a second face of said opposing faces of said substrate wherein said material lies within at least one of said
electric and magnetic field responses so-generated, said material selected to affect attenuation of energy associated with
said electric and magnetic field responses so-generated in the presence of a chemical-of-interest.

US Pat. No. 9,200,962

WINDOW CALIBRATION METHOD FOR HARMONIC ANALYSIS OF OPTICAL SPECTRA

THE UNITED STATES OF AMER...

1. A method comprising the steps of:
using a photodiode to collect light transmitted from a sweep of a Fabry-Perot interferometer device;
correlating a photocurrent produced by the photodiode, responsive to the collected light, with an applied voltage to generate
a Raman spectrum waveform, the Raman spectrum waveform displayed within a wavelength window having a beginning wavelength
value and an ending wavelength value;

determining a position of a highest peak of the Raman spectrum waveform;
using a wavelength threshold to iteratively modify the beginning wavelength value and the ending wavelength value by equal
amounts, while maintaining the fixed wavelength range, to shift the wavelength window so the position of the highest peak
is centered at a first position within the wavelength window;

determining a second highest peak of the Raman spectrum waveform displayed within the wavelength window; and
iteratively expanding or contracting the Raman spectrum waveform, while maintaining the highest peak centered at the first
position, to locate the second highest peak at a predetermined position within the wavelength window with respect to the first
position.

US Pat. No. 9,511,075

TARGETING NCCA-ATP CHANNEL FOR ORGAN PROTECTION FOLLOWING ISCHEMIC EPISODE

The University of Marylan...

1. A method of treating or reducing ischemic damage in one or more organs or tissues, comprising delivering to an individual
in need thereof an effective amount of an inhibitor of an NCCa-ATP channel in a pharmaceutically acceptable carrier, wherein the organ or tissue comprises the heart, liver, pancreas, spleen,
intestine, cornea, skin, bone marrow, heart valve, or connective tissue, wherein the inhibitor is
a) a SUR1 antagonist;
b) a Transient Receptor Potential cation channel subfamily M member 4 (TRPM4) antagonist; or
c) selected from the group consisting of flufenamic acid, mefanimic acid, niflumic acid, antagonists of matrix metalloproteinase
(MMP), and a combination thereof.

US Pat. No. 9,371,855

FLEXURE BASED LINEAR AND ROTARY BEARINGS

The United States of Amer...

1. A bearing, consisting essentially of:
a rigid top plate positioned above and parallel to a fixed rigid bottom plate;
first and second flexures disposed between and connecting aid rigid top plate and said bottom plate, said flexures together
constraining relative motion of said top plate relative to said bottom plate in exactly four degrees of freedom, the four
degrees of freedom being X and Y axis translation and rotation about the X and Y axes; a mechanical stop connected to the
top and bottom plates for limiting Z axis translation of one plate relative to another plate; and

a strut connecting the top and bottom plates and further constraining exactly one additional degree of freedom of the plates,
the one degree of freedom being rotation about the Z axis.

US Pat. No. 9,373,174

CLOUD BASED VIDEO DETECTION AND TRACKING SYSTEM

The United States of Amer...

1. A method for video detection and tracking of a target, comprising the steps of:
defining said target, wherein in said step of defining further comprises the steps of:
selecting a dataset of target image frames from a database; and
selecting the desired color of said target;
converting said color to a template hue histogram representation;
initializing an image detector;
performing target image frame alignment and registration in which homography matrices are generated;
generating an optical flow field;
performing morphology processing on said optical flow field so as to produce candidate target contours;
matching said target contours to said template hue histogram representation;
initializing tracking of said target and generating target tracks;
aligning current said target image frame so as to form a sequential track of said target; and
when said target is not located, redefining said target.
US Pat. No. 9,329,310

MULTILAYERED PLEXCITONIC NANOPARTICLES AND METHODS OF PRODUCING SAME FOR CONTROLLING PLASMON-EXCITON DISTANCE

The United States of Amer...

1. Multilayered plexcitonic nanoparticles, comprising:
a silver core;
a polyelectrolyte spacer layer exterior to said silver core; and
a J-aggregate cyanine dye outer shell exterior to said polyelectrolyte spacer layer.

US Pat. No. 9,458,086

COMPOSITIONS AND METHODS FOR ADIPOCYTE MODULATION

University of South Flori...

1. A method for specifically inhibiting expression of PKC?II, PKC?VIII, or any homolog thereof in a subject in need thereof,
the method comprising administration of a therapeutically effective amount of a compound of Formula II or a salt, prodrug
or metabolite thereof

wherein R1 and R4 are each independently selected from the group consisting of —N(R7)2 and —R8N(R7)2;

wherein R2 and R3 are each independently selected from the group consisting of hydrogen, and substituted and unsubstituted alkyl, heteroalkyl,
aryl, aralkyl, alkenyl, and alkynyl groups having from 1 to 30 carbon atoms;

wherein each occurrence of R7 is independently selected from the group consisting of substituted and unsubstituted alkyl and heteroalkyl groups having from
1 to 30 carbon atoms; and

wherein R8 is selected from the group consisting of substituted and unsubstituted alkyl and heteroalkyl groups having from 1 to 12 carbon
atoms,

wherein the effective amount is effective to specifically inhibit expression of PKC?II, PKC?VIII, or any homolog thereof in
the subject.

US Pat. No. 9,329,010

WATER-LINED MUNITION CONTAINER

The United States of Amer...

1. An apparatus, comprising;
a closed, metal container having a central longitudinal axis;
a munition containing energetic material and having a central longitudinal axis, the munition being disposed in the container
with the central longitudinal axis of the munition generally parallel to the central longitudinal axis of the container;

a pressure relief valve disposed in a wall of the container for relieving steam pressure in the container;
a heat-absorbing liner disposed between an interior surface of the container and the munition, the liner having a central
longitudinal axis generally parallel to the central longitudinal axis of the munition, the liner extending around a perimeter
of the munition and extending axially along at least a portion of the munition;

the liner having an inner layer facing the munition and an outer layer facing the interior of the container, the inner and
the outer layers defining a plurality of segregated compartments wherein each compartment contains water; and

a fluid conduit having a spiral-shaped cross-section and a central longitudinal axis that is generally parallel to the central
longitudinal axis of the munition, the munition being disposed internal to the fluid conduit.

US Pat. No. 9,234,732

EXPLOSIVES STORAGE SYSTEM

The United States of Amer...

1. An explosives storage system comprising:
a substantially cylindrical container having an opening extending from a top end of the container along a center axis of the
container, a sidewall formed between an outer perimeter of the container and an inner perimeter of the opening, and a base
portion formed at a bottom end of the container to enclose a bottom of the opening, the bottom of the opening having a hemispherical
shape;

a lid removably disposed on the top end of the container having a through-hole aligned substantially over the opening of the
container, the through-hole including a reinforcing structure having openings to allow a detonation blast to escape through
the through-hole and covered over with a flexible covering; and

one or more latching devices attached to the container and the lid that permit the lid to be secured to the top of the cylindrical
container,

wherein the container and the lid are made of reinforced cement.

US Pat. No. 9,154,704

RADIAL FPA BASED ELECTRO-OPTIC IMAGER

THE UNITED STATES OF AMER...

1. A radial focal plane array (FPA) having rings of pixels around a center pixel based on radial addressing the radial focal
plane array comprising:
a center pixel of the radial FPA having an assigned initial pair of address values to designate the center pixel of the radial
FPA, wherein one of the address pair is a row address and another of the address pair is a ring address;

rings of pixels, wherein each ring of pixels successively ringing around said center pixel is assigned a unique ring value
using said ring address of the address pair, and wherein each pixel of each ring of pixels is assigned a row value using the
row address of the address pair;

row and ring access lines for reading out signals from the pixels using said address pairs; and
a read-out integrated circuit connected to said row and ring access lines to read-out said signals from said pixels to generate
radial read-out signals, wherein said radial focal plane array is better matched to a circular optical design of circular
optics to achieve radial focal plane array read-outs while not discarding performance.

US Pat. No. 9,266,798

ACYCLIC MONOTERPENES AS BIOFUELS BASED ON LINALOOL AND METHOD FOR MAKING THE SAME

The United States of Amer...

1. A fuel produced by the methods, comprising:
hydrogenating at least one acyclic monoterpene alcohol with at least one transition metal hydrogenation catalyst to produce
a fully saturated monoterpene alcohol tetrahydrolinalool (THL);

dehydrating said tetrahydrolinalool (THL) with at least one acid catalyst and azeotropic distillation and recovering benzene
to produce 3,7-dimethyloctene isomers;

acid catalyzing reaction of said 3,7-dimethyloctene isomers and recovering benzene;
hydrogenating said 3,7-dimethyloctene isomers with at least one transition metal catalyst to produce a mixture of 2,6-dimethyloctane
(DMO), dimers (C20 isomers), and trimers (C30 isomers);

distillation isolating said 2,6-dimethyloctane (DMO), dimers (C20 isomers), and trimers (C30 isomers) from said mixture to produce a substantially purified set of C10 to C30 for producing fuels; and

leaving said distillation pot residue (C40+) for subsequent use biolubricant additives.

US Pat. No. 9,108,601

TRAILER BRAKING SYSTEM FOR USE WITH A FIFTH WHEEL/GOOSENECK HITCH HAVING A SURGE BRAKE ACTUATOR

The United States of Amer...

1. A braking system for a trailer pulled by a tow vehicle, the braking system comprising:
an arm member extending downward from and pivotally connected to an upper portion of the trailer;
a surge brake actuator coupled to the upper portion of the trailer that is configured to control braking of wheels of the
trailer; and

a lever arm pivotally connected to the surge brake actuator,
wherein, when the tow vehicle decelerates, inertial force caused by forward momentum of the trailer pivots the arm member
such that force is exerted on the surge brake actuator.

US Pat. No. 9,052,236

METHOD FOR GROUND-TO-SATELLITE LASER CALIBRATION SYSTEM

The United States of Amer...

1. A method of calibrating an optical sensor on board a satellite orbiting the earth, the method comprising:
utilizing at least one ground-based laser to generate a first light signal having a first wavelength, and a second light signal
having a second wavelength that is not equal to the first wavelength;

pointing the optical sensor at the one ground-based laser;
aiming the first and second light signals at the satellite whereby at least a portion of the first and second light signals
are incident on an optical sensor on the satellite;

measuring the response of the optical sensor to the first and second light signals;
utilizing a difference between the response of the optical sensor to the first and second light signals to calibrate the optical
sensor.

US Pat. No. 10,104,805

SELF COOLING STRETCHABLE ELECTRICAL CIRCUIT HAVING A CONDUIT FORMING AN ELECTRICAL COMPONENT AND CONTAINING ELECTRICALLY CONDUCTIVE LIQUID

The United States of Amer...

1. A self-cooling stretchable electrical circuit comprising:a stretchable platform,
at least one fluid conduit formed in said stretchable platform, said at least one fluid conduit forming an electrical component and containing an electrically conductive liquid,
electrical contacts in said at least one fluid conduit which allow electricity to flow through the electrically conductive liquid as an electrical circuit,
a heat sink, wherein at least a portion of said at least one fluid conduit is positioned adjacent said heat sink, and
a pump which circulates said electrically conductive liquid through said at least one fluid conduit.

US Pat. No. 9,405,005

AUTOMATIC DEPENDENT SURVEILLANCE BROADCAST (ADS-B) SYSTEM FOR OWNERSHIP AND TRAFFIC SITUATIONAL AWARENESS

The United States of Amer...

1. An ADS-B system coupled to an unmanned aerial vehicle for increased situational awareness and self-separation assurance
comprising:
a telemetry system in said unmanned aerial vehicle, said telemetry system including a transceiver for wireless communication
with a ground control station;

at least one GPS/WAAS antenna disposed on said unmanned aerial vehicle;
at least an upper and lower UAT antenna disposed on said unmanned aerial vehicle;
at least one altitude encoder,
a Universal Access Transceiver (UAT) in said unmanned aerial vehicle and in communication with said telemetry system for compiling
ownship ADS-B Out messages and for receiving air-to-air ADS-B In messages from nearby aircraft and ADS-R and TIS-B messages
from ground based transceivers, said UAT further comprising a digital computer programmed with control software comprising
computer instructions stored on non-transitory computer memory for storing said ADS-B In messages and consolidating said ADS-B
In messages with said ADS-B Out messages, and for communicating said consolidated ADS-B Out messages to said telemetry system
for transmission to a ground control station; and

a ground control station (GCS) comprising a digital computer programmed with control software stored on non-transitory computer
memory, said software including,

a loss link redundancy module to compensate for a lost telemetry link,a translation module for generating KML scripts from ADS-B Out and ADS-B In data, and
a synthetic display management user-interface for providing a synthetic user-configurable three-dimensional display of said
ADS-B Out and ADS-B In data on a geobrowser.

US Pat. No. 9,233,394

HYDROPHOBIC-CORE MICROCAPSULES AND THEIR FORMATION

The United States of Amer...

1. A method of forming hydrophobic-core microcapsules comprising:
forming a hydrophobic phase including a pre-polymer or monomer, a cross-linking agent, at least one active substance, wherein
said at least one active substance is a corrosion indicator, a corrosion inhibitor, or combination thereof, an optional co-solvent,
and a hydrophobic substance;

forming a hydrophilic phase;
mixing the hydrophobic phase with the hydrophilic phase to create and disperse droplets of the hydrophobic phase within the
hydrophilic phase to form an emulsion;

initiating a reaction at an interface of the hydrophilic phase and the hydrophobic phase to form a solid shell encapsulating
the hydrophobic phase forming hydrophobic-core microcapsules, wherein said solid shell includes a shell wall comprising a
compound having one or more chemical bonds that are broken down when contacted with an alkali produced during a corrosion
reaction causing the release of the hydrophobic phase, wherein said alkali has a pH above about 8.

US Pat. No. 9,340,889

METHOD OF FABRICATING A BIPOLAR ELECTRODE FOR USE IN A SEMI FUEL CELL

The United States of Amer...

1. A method of fabricating a bipolar electrode comprising the steps of:
applying a thin coating of adhesive to a first surface of foil having two surfaces;
curing said adhesive by allowing it to dry;
electrochemically depositing a catalyst on the dry adhesive; and
affixing the second opposite surface of the foil to a metal anode;
wherein applying the adhesive comprises:
disposing the adhesive over the first surface of the foil;
applying a mesh over the adhesive;
pressing the mesh onto the first surface of the foil; and
removing excess adhesive from the mesh.